Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E14850g5.699ON47047022920.0
Kwal_55.197165.699ON4674688021e-101
KLTH0E01122g5.699ON4724647821e-98
Ecym_40215.699ON4594606481e-78
AFR283W5.699ON4524626392e-77
KLLA0A00660g5.699ON5245045875e-69
ZYRO0G06666g5.699ON5035025158e-59
TDEL0B022205.699ON4894934781e-53
Smik_9.235.699ON5274003907e-41
Skud_9.225.699ON5374013653e-37
YIL146C (ATG32)5.699ON5294243582e-36
Suva_9.435.699ON5134053405e-34
CAGL0H06545g5.699ON4922052725e-25
TBLA0E020905.699ON7491662392e-20
NCAS0G002605.699ON5103112033e-16
KNAG0L021005.699ON4443791811e-13
KAFR0D022505.699ON5561421812e-13
TPHA0D045805.699ON470143870.044
Kpol_2001.735.699ON41195850.071
KLTH0G18898g8.20ON941161790.43
SAKL0B00902g8.20ON94473697.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E14850g
         (470 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} simi...   887   0.0  
Kwal_55.19716 s55 complement(93412..94815) [1404 bp, 467 aa] {ON...   313   e-101
KLTH0E01122g Chr5 complement(110889..112307) [1419 bp, 472 aa] {...   305   1e-98
Ecym_4021 Chr4 complement(53316..54695) [1380 bp, 459 aa] {ON} s...   254   1e-78
AFR283W Chr6 (945526..946884) [1359 bp, 452 aa] {ON} Syntenic ho...   250   2e-77
KLLA0A00660g Chr1 complement(64397..65971) [1575 bp, 524 aa] {ON...   230   5e-69
ZYRO0G06666g Chr7 complement(532862..534373) [1512 bp, 503 aa] {...   202   8e-59
TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {O...   188   1e-53
Smik_9.23 Chr9 complement(51874..53457) [1584 bp, 527 aa] {ON} Y...   154   7e-41
Skud_9.22 Chr9 complement(51263..52876) [1614 bp, 537 aa] {ON} Y...   145   3e-37
YIL146C Chr9 complement(74184..75773) [1590 bp, 529 aa] {ON}  AT...   142   2e-36
Suva_9.43 Chr9 complement(68866..68940,68994..69068,69093..69122...   135   5e-34
CAGL0H06545g Chr8 (643447..644925) [1479 bp, 492 aa] {ON} simila...   109   5e-25
TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.6...    97   2e-20
NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}...    83   3e-16
KNAG0L02100 Chr12 (374542..375876) [1335 bp, 444 aa] {ON} Anc_5....    74   1e-13
KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {O...    74   2e-13
TPHA0D04580 Chr4 (1000005..1001417) [1413 bp, 470 aa] {ON}             38   0.044
Kpol_2001.73 s2001 (199741..200976) [1236 bp, 411 aa] {ON} (1997...    37   0.071
KLTH0G18898g Chr7 complement(1631048..1633873) [2826 bp, 941 aa]...    35   0.43 
SAKL0B00902g Chr2 (83877..86711) [2835 bp, 944 aa] {ON} similar ...    31   7.4  

>SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} similar
           to uniprot|Q753M9 Ashbya gossypii AFR283W AFR283Wp and
           weakly similar to YIL146C uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 470

 Score =  887 bits (2292), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/470 (93%), Positives = 438/470 (93%)

Query: 1   MRQISMKKSHSGSDIPDPSASGSMPFQKRSILDPHFSVLQLLERNGCEQEEDVNQASSQI 60
           MRQISMKKSHSGSDIPDPSASGSMPFQKRSILDPHFSVLQLLERNGCEQEEDVNQASSQI
Sbjct: 1   MRQISMKKSHSGSDIPDPSASGSMPFQKRSILDPHFSVLQLLERNGCEQEEDVNQASSQI 60

Query: 61  PVELKSAFNRPLSPHKRYPEALNQSISDSWQSIKMVDYSILNSLHDTSSSQAVGIXXXXX 120
           PVELKSAFNRPLSPHKRYPEALNQSISDSWQSIKMVDYSILNSLHDTSSSQAVGI     
Sbjct: 61  PVELKSAFNRPLSPHKRYPEALNQSISDSWQSIKMVDYSILNSLHDTSSSQAVGILSSSD 120

Query: 121 XXXXXXXHLNSPSPSSQQVFPNGPPISFQTQAGVLTASATLPNPGVLEEDDNETVTVSLA 180
                  HLNSPSPSSQQVFPNGPPISFQTQAGVLTASATLPNPGVLEEDDNETVTVSLA
Sbjct: 121 TSEEELDHLNSPSPSSQQVFPNGPPISFQTQAGVLTASATLPNPGVLEEDDNETVTVSLA 180

Query: 181 ASSNSFVMPQLSLSQRSHRFEILVVGKPARKFWNNVPKMYQKMFDIGDFESISAPKVSHY 240
           ASSNSFVMPQLSLSQRSHRFEILVVGKPARKFWNNVPKMYQKMFDIGDFESISAPKVSHY
Sbjct: 181 ASSNSFVMPQLSLSQRSHRFEILVVGKPARKFWNNVPKMYQKMFDIGDFESISAPKVSHY 240

Query: 241 TAVMIIFQDTKEVSFILDSLVTKLDGKAIIPICQRGQKQQLASLLEPFVKAKKIRLMFQP 300
           TAVMIIFQDTKEVSFILDSLVTKLDGKAIIPICQRGQKQQLASLLEPFVKAKKIRLMFQP
Sbjct: 241 TAVMIIFQDTKEVSFILDSLVTKLDGKAIIPICQRGQKQQLASLLEPFVKAKKIRLMFQP 300

Query: 301 TVMSNHQEIHKLLRYLHRLSTEIDSGYETDETHLXXXXXXXXXXXXXXGTSNRWVIWGLS 360
           TVMSNHQEIHKLLRYLHRLSTEIDSGYETDETHL              GTSNRWVIWGLS
Sbjct: 301 TVMSNHQEIHKLLRYLHRLSTEIDSGYETDETHLKVRKRKKTHKKKSKGTSNRWVIWGLS 360

Query: 361 LTVGVGIGCCISFILXXXXXXVQIPHASRDDVVLVEEVPTLPDKAEGNGPIGQVITLLRK 420
           LTVGVGIGCCISFIL      VQIPHASRDDVVLVEEVPTLPDKAEGNGPIGQVITLLRK
Sbjct: 361 LTVGVGIGCCISFILSSYSSSVQIPHASRDDVVLVEEVPTLPDKAEGNGPIGQVITLLRK 420

Query: 421 TVKQFNLVLKQFIYEQVGSLSWIQRVGKELISEDSDGTVGRVAALDLVLL 470
           TVKQFNLVLKQFIYEQVGSLSWIQRVGKELISEDSDGTVGRVAALDLVLL
Sbjct: 421 TVKQFNLVLKQFIYEQVGSLSWIQRVGKELISEDSDGTVGRVAALDLVLL 470

>Kwal_55.19716 s55 complement(93412..94815) [1404 bp, 467 aa] {ON}
           YIL146C (ECM37) - (putative) involved in cell wall
           biogenesis [contig 159] FULL
          Length = 467

 Score =  313 bits (802), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 194/468 (41%), Positives = 266/468 (56%), Gaps = 30/468 (6%)

Query: 17  DPSASGSMPFQKR-SILDPHFSVLQLLERNGCEQEEDVNQASSQIPVELKSAFNRPLSPH 75
           DP  S S     R SILDPH SVLQLLERN    E          P E + + + P SPH
Sbjct: 16  DPRFSTSERLNNRNSILDPHLSVLQLLERNEVHSE----------PQEFRHS-DIP-SPH 63

Query: 76  ---KRYPEALNQSISDSWQSIKMVDYSILNSLHDTSSSQAVGIXXXXXXXXXXXXHLNSP 132
              +   E + +SISDSWQSI+  DYSILN + +TS  Q  GI            H  SP
Sbjct: 64  LLSRSSSEPMGRSISDSWQSIRHTDYSILNLIGETSH-QPAGILSSSDTSEDEPDHFLSP 122

Query: 133 SPSSQQVFPNGPPISF--QTQAGVLTASATLPNP-----GVLEEDDNETVTVSLAASSNS 185
           SP+ +  F NG    F   + A    + ATL +       V E++DNETVT+SL  SSNS
Sbjct: 123 SPN-EYAFANGAKTVFPEASHAPEGPSLATLQDSVYEHSNVAEDNDNETVTLSLINSSNS 181

Query: 186 FVMPQLSLSQRSHRFEILVVGKPARKFWNNVPKMYQKMFDIGDFESISAPKVSHYTAVMI 245
           FVMP+LSL+Q   +F IL+VGKPA++F+ ++P+ YQKMF++ D ES     V  ++A+M+
Sbjct: 182 FVMPKLSLAQPLRKFSILIVGKPAQRFYRDIPRAYQKMFEVCDAESFKTRDVDQFSAIMV 241

Query: 246 IFQDTKEVSFILDSLVTKLDGKAIIPICQRGQKQQLASLLEPFVKAKKIRLMFQPTVMSN 305
           IF D K    +L+ +  +     II +CQRGQ+QQ+++LL  F K   +RL++  TVMS+
Sbjct: 242 IFTDPKNGQSLLEMVTGR--SSNIIAVCQRGQQQQISNLLNRFSKTHHLRLIYHLTVMSD 299

Query: 306 HQEIHKLLRYLHRLSTEIDSGYETD-ETHLXXXXXXXXXXXXXXGTSNRWVIWGLSLTVG 364
           HQ++H+LLRYL+ LS EIDS Y+T+                      NRWVIW +SLTVG
Sbjct: 300 HQDVHRLLRYLYTLSNEIDSEYDTEVGPRKVRKRRKSYKKRETPAAVNRWVIWSISLTVG 359

Query: 365 VGIGCCISFILXXXXXXV--QIPHASRDDVVLVEEVPTLPDKAEGNGPIGQVITLLRKTV 422
           VGIG CIS +L          +   S D++ L+EE P  P +        Q++   +K V
Sbjct: 360 VGIGYCISCLLSSTMSVRGNTLTLHSSDEIALIEEAPISPHETVLENYFRQLVLAFKKAV 419

Query: 423 KQFNLVLKQFIYEQVGSLSWIQRVGKELISEDSDGTVGRVAALDLVLL 470
           KQ +   KQ ++     + W+QR+GK+ +SE SD T+  V ALDLVL+
Sbjct: 420 KQVSQSFKQCLHGHSLPVLWMQRIGKDWMSEASDTTLPGVTALDLVLI 467

>KLTH0E01122g Chr5 complement(110889..112307) [1419 bp, 472 aa] {ON}
           weakly similar to uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 472

 Score =  305 bits (782), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 187/464 (40%), Positives = 277/464 (59%), Gaps = 32/464 (6%)

Query: 20  ASGSMPF-QKRSILDPHFSVLQLLERNGCEQEEDVNQASSQIPVELKS----AFNRPLSP 74
           A+ S+P  Q+ SILDPH SVLQLL+R             +  P EL S       +P +P
Sbjct: 28  ATSSVPLNQRNSILDPHLSVLQLLDR-------------ADPPSELSSLKHGEIAKPATP 74

Query: 75  HKRYPEALNQSISDSWQSIKMVDYSILNSLHDTSSSQAVGIXXXXXXXXXXXXHLNSPSP 134
            +   E++N SIS+SWQSIK  D S++N+  D ++ Q  GI               SPSP
Sbjct: 75  RRSGFESVNCSISESWQSIKHTDCSMVNTQGD-ATHQHAGILSSSDTSEDEPDAQLSPSP 133

Query: 135 SSQQVFPNGPPISFQTQAGVLTASA-------TLPNPGVLEEDDNETVTVSLAASSNSFV 187
           ++   FPN     F      L AS+        + NP   EE+DNETVT+SL  SSNSFV
Sbjct: 134 NNF-AFPNSATSIFPEAPHNLEASSLREYQNSEIANPR--EENDNETVTMSLMNSSNSFV 190

Query: 188 MPQLSLSQRSHRFEILVVGKPARKFWNNVPKMYQKMFDIGDFESISAPKVSHYTAVMIIF 247
           MP+LSL Q+S +F IL+VGKPA++F+ ++P+ Y KMF++ D   +S  +++ Y+AVM+IF
Sbjct: 191 MPKLSLIQQSQKFCILIVGKPAQRFYRDIPRAYHKMFEVRDVGHLSPREMNKYSAVMVIF 250

Query: 248 QDTKEVSFILDSLVTKLDGKAIIPICQRGQKQQLASLLEPFVKAKKIRLMFQPTVMSNHQ 307
            + KE   +L+ +        II +CQRGQ+QQ++++L  + K+ +IRL++  TVMS+HQ
Sbjct: 251 GEPKEGKELLEKVAAH--NSNIIAVCQRGQQQQISNILNRYSKSNEIRLVYHLTVMSDHQ 308

Query: 308 EIHKLLRYLHRLSTEIDSGYETD-ETHLXXXXXXXXXXXXXXGTSNRWVIWGLSLTVGVG 366
           ++H+LLRYL+ LSTE+DSGYET+  +                 T NRWVIW +SLTVGVG
Sbjct: 309 DVHRLLRYLNTLSTEVDSGYETEVGSRKIRKRRKSSKKRSPQITVNRWVIWSISLTVGVG 368

Query: 367 IGCCISFILXXXXXXVQIPHASRDDVVLVEEVPTLPDKAEGNGPIGQVITLLRKTVKQFN 426
           +G CIS +L      + +   S D+V ++E++   P ++  +  +  ++  +++ VKQ N
Sbjct: 369 LGYCISCLLSSTSSTLSVTLRSGDEVTIMEDIHNSPHESPFDNYLRHLLLAVKRAVKQVN 428

Query: 427 LVLKQFIYEQVGSLSWIQRVGKELISEDSDGTVGRVAALDLVLL 470
              KQ++  Q   + W+QR+GKE +SE SD T+  V ALDLVL+
Sbjct: 429 SSFKQYLSGQSLPVLWMQRIGKEWLSEASDPTLPGVTALDLVLV 472

>Ecym_4021 Chr4 complement(53316..54695) [1380 bp, 459 aa] {ON}
           similar to Ashbya gossypii AFR283W
          Length = 459

 Score =  254 bits (648), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 171/460 (37%), Positives = 251/460 (54%), Gaps = 22/460 (4%)

Query: 19  SASGSMP-FQKRSILDPHFSVLQLLERNGCEQEEDVNQASSQIPVELKSAFNRPLSPHKR 77
           + +G +P   +RSILDPH SVL++LE       +++N+     P EL  A +R       
Sbjct: 14  TQNGGLPGTTQRSILDPHLSVLEILE------GKELNKVEG--PHELSGA-SRVSGKQFE 64

Query: 78  YPEALNQSISDSWQSIKMVDYSILNSLHDTSSSQ--AVGIXXXXXXXXXXXX-HLNSPSP 134
               L+ SIS+SWQSIK  DY  L+  +DTS  Q  AVGI             H + P P
Sbjct: 65  GERVLHHSISESWQSIKSTDYLFLSRANDTSLQQQSAVGILSSSDTSEEEQDIHPSPPPP 124

Query: 135 SSQQVFPNGPPISFQTQAGVLTASATLPNPGVLEEDDN-ETVTVSLAASSNSFVMPQLSL 193
           +S     +   I+   QA     SATL +    +EDD+ ETVTVSL  +  S VMP+LSL
Sbjct: 125 NSASSAFDSRIINIAGQA----FSATLSHLRSEDEDDDGETVTVSLPNTMTSLVMPKLSL 180

Query: 194 SQRSHRFEILVVGKPARKFWNNVPKMYQKMFDIGDFESISAPKVSH-YTAVMIIFQDTKE 252
           S R    ++L+VG+PARKFW ++PK YQKMF+I     +    V   Y+ +M+IF D   
Sbjct: 181 SDRIIESKVLIVGQPARKFWFSIPKSYQKMFEICSLSVLRDKDVDEKYSTIMVIFHDMGL 240

Query: 253 VSFILDSLVTKLDGKAIIPICQRGQKQQLASLLEPFVKAKKIRLMFQPTVMSNHQEIHKL 312
              +LD +  K+    IIPICQ+GQKQ L+SLL+ +V   +I+L   P VMSNH E H+L
Sbjct: 241 APELLDRICNKVVRPRIIPICQKGQKQHLSSLLKQYVSGNRIKLFCNPIVMSNHHEKHRL 300

Query: 313 LRYLHRLSTEIDSGYETDET--HLXXXXXXXXXXXXXXGTSNRWVIWGLSLTVGVGIGCC 370
           L++LH+LS+  DSGYET+ T   +               T   WV+W  S+T+G+GIGCC
Sbjct: 301 LKHLHQLSSGSDSGYETEVTVEPVKKLPRKAKKRPSKPSTFRDWVVWTASITIGIGIGCC 360

Query: 371 ISFILXXXXXXVQIPHASRDDVVLVEEVPTLPDKAEGNGPIGQVITLLRKTVKQFNLVLK 430
           +S ++      +     + DD+      P   DK+  N  +    +L + ++K+    L+
Sbjct: 361 VSLMVSTRYAFLVPRQLAVDDITSSPLSPEGTDKSSHNLFL-HAYSLCKTSLKKLASSLR 419

Query: 431 QFIYEQVGSLSWIQRVGKELISEDSDGTVGRVAALDLVLL 470
            F  +++ S +WI  +G EL  +DS  ++GR+  LD ++L
Sbjct: 420 PFFSDRLESCTWIHTLGIELSYDDSLISMGRIMPLDFIML 459

>AFR283W Chr6 (945526..946884) [1359 bp, 452 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL146C (ECM37)
          Length = 452

 Score =  250 bits (639), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 153/462 (33%), Positives = 237/462 (51%), Gaps = 54/462 (11%)

Query: 27  QKRSILDPHFSVLQLLERNGCEQEEDVNQASSQIPVELKSAFNRPLSPHKRYPEALNQSI 86
           Q + ILDPH SVL++L+R   +    V + +     +            +R   +L+ SI
Sbjct: 27  QHKGILDPHLSVLEMLDRQDGDGAGQVEEGAVMTVGK------------RRVERSLHHSI 74

Query: 87  SDSWQSIKMVDYSILNSLHDTSSSQA-VGIXXXXXXXXXXXXHLNSPSPSSQQVFPNGPP 145
           S+SWQ+IK  DYS L+  H+  +  + VGI               S S +S++     P 
Sbjct: 75  SESWQAIKRSDYSFLSGTHEVGAMHSSVGIL--------------SSSDTSEEEAEMRP- 119

Query: 146 ISFQTQAGVLTASATLPNP----------GVLEEDDNETVTVSLAASSNSFVMPQLSLSQ 195
               +  G +   ++L +P             EEDD +TVT+S+ +SS S VMP+LSLSQ
Sbjct: 120 ----SAHGTVHLGSSLASPMRQLLVEEDNSCAEEDDCQTVTISMPSSSTSLVMPKLSLSQ 175

Query: 196 RSHRFEILVVGKPARKFWNNVPKMYQKMFDIGDFESISAPKVSH-YTAVMIIFQDTKEVS 254
           R    ++L+VG+PARKFW  +PK YQK+FD+ +   ++   V   Y AVM++F D  +  
Sbjct: 176 RLGEPQLLLVGQPARKFWLTIPKCYQKLFDVKNLGMVTRWDVGQRYLAVMVVFHDIAQAP 235

Query: 255 FILDSLVTKLDGKAIIPICQRGQKQQLASLLEPFVKAKKIRLMFQPTVMSNHQEIHKLLR 314
            +LD L  K     +IP+CQ+GQK  LA+LL+ +   K IR+   P +MSNH E H+LL+
Sbjct: 236 ELLDGLCEKAPCPTVIPVCQKGQKSTLAALLKRYTARKCIRVYCSPIIMSNHHEKHRLLK 295

Query: 315 YLHRLSTEIDSGYETDETHLXXXXXXXXXXXXXXGTSNR-WVIWGLSLTVGVGIGCCISF 373
           +LH L  E +SGYET+ T                  + R W IW  S T+G+GIGCCIS 
Sbjct: 296 HLHNLCNESESGYETELTVKSKKQHRRPRKKDAGPVALRHWAIWTASFTIGIGIGCCISL 355

Query: 374 ILXXXXXXVQIPHASRDDVVLVEEVPT-LPDKAEGNGPIGQVI----TLLRKTVKQFNLV 428
           +        +    S   + L   +P  +P     + P  +++     L + T++Q    
Sbjct: 356 M-----ATTRFTFFSSAPLPLTAVIPAQIPSSVASDKPPHRLVPHFYMLCKTTIRQLGTS 410

Query: 429 LKQFIYEQVGSLSWIQRVGKELISEDSDGTVGRVAALDLVLL 470
           L+ F +E+  S +W+   G +L S+D   ++GR+  LD ++L
Sbjct: 411 LRLFFFEKFESRTWVHIFGMDLHSDDPLASLGRLMPLDFIML 452

>KLLA0A00660g Chr1 complement(64397..65971) [1575 bp, 524 aa] {ON}
           weakly similar to uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 524

 Score =  230 bits (587), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 162/504 (32%), Positives = 245/504 (48%), Gaps = 76/504 (15%)

Query: 27  QKRSILDPHFSVLQLLE-RNGCEQEEDVNQASSQIPVELKSAFNRPLSPHKRYPEALNQS 85
           Q+ SILDPH SV+ LL  +  C  +  + Q    I  + KS     +  +       ++ 
Sbjct: 37  QRHSILDPHDSVMDLLNGQQSCAFDSRLIQNQDLIDRKGKS---NNIDHNDINTHTHSKG 93

Query: 86  ISDSWQSIKMVDYSILNS-----LHDTSS---SQAVGIXXXXXXXXXXXXHLNSPSP--- 134
           ++DSWQ+I   +YS LN+      H+TS+   +Q  G                +PSP   
Sbjct: 94  LTDSWQAIDRDEYSFLNAGNHNNYHNTSNGDFNQQFGGVLSSDTSEEEVEINAAPSPNLS 153

Query: 135 SSQQ-------------------------VFPNGPPISFQTQAGVLTASATLPNPGVLEE 169
           +SQQ                          F +G P+   T+ G  + +      G    
Sbjct: 154 ASQQHNQFLAYPLSSTGFGDQGNSETTVHQFSDGDPVK-STKTGQFSKAELGAGTG---- 208

Query: 170 DDNETVTVSLAAS--SNSFVMPQLSLSQRSHRFEILVV--GKPARKFWNNVPKMYQKMFD 225
            ++ET+ V+L  S   + FVMP+LSLS+   RF+IL++  G  A  F+N + + ++ MFD
Sbjct: 209 -EDETIMVNLGHSWAGSFFVMPKLSLSESMKRFKILILSDGDSANSFYNRLSRYHRLMFD 267

Query: 226 IGDFESISAPKVSHYTAVMIIFQDTKEVSFILDSLVTKLDGKAIIPICQRGQKQQLASLL 285
           +G     S  +   YTA MIIF D+K+V+ IL+ +  K     +IPICQ+GQKQ +   +
Sbjct: 268 VGKLNEASKEEALKYTAFMIIFSDSKKVTTILNRMWKKYGDFTLIPICQKGQKQSVTEKV 327

Query: 286 EPFVKAKKIRLMFQPTVMSNHQEIHKLLRYLHRLSTEIDSGYETDETHLXXXXXXXXXXX 345
           + F  + KI+LM  P V+S+H EIH LLR+LH L  E+DS YETD               
Sbjct: 328 KTFANSNKIKLMSYPVVISDHYEIHGLLRHLHSLYVEVDSDYETD-IPKKTKPRKGAKKK 386

Query: 346 XXXGTSNRWVIWGLSLTVGVGIGCCISFILXXXXXXVQIPHASRDDVVLV-----EEVPT 400
                + RW  W +S+ +GVGIGCC++F         +   +S +  V V     +E+  
Sbjct: 387 PAPHLAKRWWFWPISIALGVGIGCCVTFYFS------KFETSSYNSSVGVIQTADKEIDA 440

Query: 401 LPDKAEGNGP--------------IGQVITLLRKTVKQFNLVLKQFIYEQVGSLSWIQRV 446
           + D  EGN P              +GQV  L++ T  Q N +LKQF+   + + +WIQ +
Sbjct: 441 IVDAIEGNSPSILEESSPQSISDFLGQVCKLVKDTAIQINELLKQFLSAHLMTSAWIQSI 500

Query: 447 GKELISEDSDGTVGRVAALDLVLL 470
           GKE +  DS  T+ +V ALDLV+ 
Sbjct: 501 GKEFMQPDSQSTISKVTALDLVMF 524

>ZYRO0G06666g Chr7 complement(532862..534373) [1512 bp, 503 aa] {ON}
           similar to uniprot|P40458 Saccharomyces cerevisiae
           YIL146C ECM37 Non-essential protein of unknown function
          Length = 503

 Score =  202 bits (515), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 152/502 (30%), Positives = 237/502 (47%), Gaps = 76/502 (15%)

Query: 26  FQKRSILDPHFSVLQLLERNGCEQEEDVNQASSQIPVE-LKSAFNRPLSPHKRYPEALNQ 84
            ++RSILDPH SVL+LL R            S   P E LK   +  +          N 
Sbjct: 21  IERRSILDPHLSVLELLRR-----------PSDTRPHEALKGEVSDIVGNCAGTTGTGNG 69

Query: 85  SISDSWQSIKMVDYSILNSLHDTSSSQ--AVGIXXXXXXXXXXXXHLNSPSPSSQQVFPN 142
           SIS SWQ+I   D S L+ + +   SQ  A GI             +NSPS   QQ+  +
Sbjct: 70  SISQSWQTIHRND-SCLSVVPERCPSQATAAGILSSSDTSEDEPDAVNSPSAVHQQL--H 126

Query: 143 GPPISFQTQAGVLTASATLPNPGVL---------------------EEDDNETVTVSLAA 181
             P    T++     S  +  P VL                     EEDDN+T+T SL +
Sbjct: 127 ATPPQKHTKSLEDYRSLNVGIPLVLPEDSNNINNNNKNGSTTGSNGEEDDNDTITKSLNS 186

Query: 182 SSNSFVMPQLSLSQRSHRFEILVVGKPARKFWNNVPKMYQKMFDIGDFESISAPKVSHYT 241
           SSNSF+MP+LSLSQ++ +F ILV+G+P  KF++++PK YQ MF++    S    +   YT
Sbjct: 187 SSNSFIMPKLSLSQKTQKFRILVLGRPGLKFYHSIPKKYQHMFELP--RSHDPAEFKQYT 244

Query: 242 AVMIIFQDTKEVSFILDSLVTKLDGKAIIPICQRGQKQQLASLLEPFVKAKKIRLMFQPT 301
            ++++FQ+ KE+  +L+ +      + +IP+CQ GQ+QQ+ +LLE  +K + + L++ P 
Sbjct: 245 GILVVFQELKEMVSLLNRVCQCNPNRPVIPVCQSGQRQQVRNLLESLLKNRLVSLLYPPV 304

Query: 302 VMSNHQEIHKLLRYLHRLSTEIDSGYETDETHLXXXXXXXXXXXXXXGTS---------- 351
           V++N  ++  + R+L  LS  +    + D                               
Sbjct: 305 VVNNQPDLLGMFRFLQELSKTVSDNSDMDAEEPNNGSKRLKRSLQRKKKKFIETSAERNG 364

Query: 352 ------------NRWVIWGLSLTVGVGIGCCISFILXXXXXXVQI-------PHASRDDV 392
                       NRWV+WG+SLT+GVG+G CIS ++      +         P +   D+
Sbjct: 365 RPHKKRHNNEKVNRWVLWGVSLTLGVGVGYCISHLVSSTWISLTTNPLGPVDPESVSKDL 424

Query: 393 VLVE--EVPTLPDKAEGNGPIGQVITLLRKTVKQFNLVLKQFIYEQVGSLSWIQRVGKEL 450
            + +  E+       + + P G  + L ++ +KQ+NL +KQF+      LS ++R+G   
Sbjct: 425 FVFDRQELKLGEMDMDSDHPFGHALFLFKQALKQWNLAVKQFLGRH---LSCMERIGPAN 481

Query: 451 ISE--DSDGTVGRVAALDLVLL 470
             E   SD    RV AL  V+L
Sbjct: 482 CLEWPTSDEHTNRVLALGYVML 503

>TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {ON}
           Anc_5.699 YIL146C
          Length = 489

 Score =  188 bits (478), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 149/493 (30%), Positives = 234/493 (47%), Gaps = 77/493 (15%)

Query: 26  FQKRSILDPHFSVLQLLERNGCEQEEDVNQASSQIPVELKSAFNRPLSPHKRYPEALNQS 85
           F+K+S+LDPH SVL+LLER G  Q                    R +          N S
Sbjct: 26  FEKKSLLDPHLSVLELLERTGDTQR-----------------VGRGVEKADDMANTTN-S 67

Query: 86  ISDSWQSIKMVDYSILNSLHDTSSSQA--VGIXXXXXXXXXXXXHLNSPSPSSQQVFPNG 143
           IS SWQ+I   D +++  + +  SSQA  VGI              +SP+ +    F   
Sbjct: 68  ISSSWQAIHRND-AMITGVPERCSSQAAAVGILSSSDTSEEEIDPASSPNVAHFTQFHQS 126

Query: 144 ---PPISFQTQAGVL------TASATLPNPGVLEEDDNETVTVSLAASSNSFVMPQLSLS 194
              P + F+    V+        S     P   +E D+ET+T SL+ SSNSFVMP+LSLS
Sbjct: 127 QQPPRLPFKLDVPVILPARDQEPSGQTQTPDNDDERDDETLTKSLSNSSNSFVMPKLSLS 186

Query: 195 QRSHRFEILVVGKPARKFWNNVPKMYQKMFDIGDFESISAPKVSHYTAVMIIFQDTKEVS 254
           Q+SH+  IL++G+P  KF+ ++PK YQ  F++   +  S  +   +T ++I+FQ+ KE+ 
Sbjct: 187 QKSHKLRILILGRPGLKFYQSIPKRYQHFFELSRLQDPS--EFRQFTGILIVFQELKEMV 244

Query: 255 FILDSLVTKLDGKAIIPICQRGQKQQLASLLEPFVKAKKIRLMFQPTVMSNHQEIHKLLR 314
            +L+ +      + +IP+CQ GQ QQ+ ++LE  +K+K I L++ P V+SNH +++ + R
Sbjct: 245 SLLNRVCQCAPTRPVIPVCQTGQHQQVRNVLESLLKSKLISLLYPPVVISNHSDLNNMYR 304

Query: 315 YLHRLSTEIDSG--------------YETDETHLXXXXXXXXXXXXXXGTS--------N 352
           +L  LS  I                  +  ++H                          N
Sbjct: 305 FLLDLSKTISDNSEDDEDEEERELLDKKIKKSHQRKKKRAGSYDKTDKPRKRRSKETKIN 364

Query: 353 RWVIWGLSLTVGVGIGCCISFILXXXXXXVQIPH-ASRDDVVLVEEVPTLPDKAEGNG-- 409
           +W++WG+SLTVGVG+G C+S+        +     AS +     + V    D + G G  
Sbjct: 365 KWIVWGISLTVGVGVGYCMSYFASSGLISMSAKSIASINGCRPNDNVVVFDDSSLGMGEY 424

Query: 410 ------PIGQVITLLRKTVKQFNLVLKQFIY------EQVGSLSWIQRVGKELISEDSDG 457
                 P    + LL++T+KQ+N  +KQF+       E   S ++     KE  +ED+  
Sbjct: 425 DHDLENPFAHALYLLKQTLKQWNWAMKQFLMKHLHLPESSSSTNY-----KEWGAEDNS- 478

Query: 458 TVGRVAALDLVLL 470
              RV AL  +LL
Sbjct: 479 --NRVLALGYILL 489

>Smik_9.23 Chr9 complement(51874..53457) [1584 bp, 527 aa] {ON}
           YIL146C (REAL)
          Length = 527

 Score =  154 bits (390), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 114/400 (28%), Positives = 192/400 (48%), Gaps = 62/400 (15%)

Query: 19  SASGSMPFQKRSILDPHFSVLQLLERNGCEQEEDVNQASSQIPVELKSAFNRPLSPHKRY 78
           S S +   + R +LDPH SVL+LL + G         + S +   L ++ +  +S H+  
Sbjct: 29  SRSDAQAEEDRGLLDPHLSVLELLGKTG--------HSPSPMGQSLVTSID--ISGHQN- 77

Query: 79  PEALNQSISDSWQSIKMVDYSILNSLHDTSSSQAVG--IXXXXXXXXXXXXHLNSPSPSS 136
              +N SIS SWQ+I+ +D    + + +  SSQ     I             L +P+   
Sbjct: 78  ---VNDSISGSWQAIQPLDLGA-SFIPERCSSQTTNGSILSSSDTSEEEQELLQAPAADI 133

Query: 137 QQVFPNGPPISFQTQAG----VLTASATLPNP-----------------GVLEEDDNETV 175
             +   G   +  T +      L    +LP P                 G  EED + T+
Sbjct: 134 INIIKQGQEGTNVTSSSHPFRQLHKVISLPIPSREKTPYKEQDINDDEDGAYEED-SVTI 192

Query: 176 TVSLAASSNSFVMPQLSLSQRSHRFEILVVGKPARKFWNNVPKMYQKMFDIGDF-ESISA 234
           T SL +S+NSFVMP+LSLSQ++  F +L++G+    F+ ++PK YQ +F++  + +S + 
Sbjct: 193 TKSLTSSTNSFVMPKLSLSQKNPVFRLLILGRTGSNFYQSIPKEYQSLFELPKYHDSATF 252

Query: 235 PKVSHYTAVMIIFQDTKEVSFILDSLVTKLDGKAIIPICQRGQKQQLASLLEPFVKAKKI 294
           P+   YT ++IIFQ+ +E+  +L+ +V    GK IIPICQ GQ  Q+ ++L+ F++ K I
Sbjct: 253 PQ---YTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVLKSFLRNKLI 309

Query: 295 RLMFQPTVMSNHQEIHKLLRYLHRLSTEIDSGYETDETHLXXXXXXXXXXXXXXGTSNR- 353
           +L+F P V++N +++ K+ + L  LS E       +                    S R 
Sbjct: 310 KLLFPPVVVTNRKDLKKMFQRLQDLSLEYAEDENEEGDDDETTKSRSYYRYKKANNSKRK 369

Query: 354 ------------------WVIWGLSLTVGVGIGCCISFIL 375
                             W  WG+S+T+G+  GCC+++ +
Sbjct: 370 SPKSNKKPKKKKQRFFTSWFTWGISITIGISFGCCVTYFV 409

>Skud_9.22 Chr9 complement(51263..52876) [1614 bp, 537 aa] {ON}
           YIL146C (REAL)
          Length = 537

 Score =  145 bits (365), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 113/401 (28%), Positives = 186/401 (46%), Gaps = 72/401 (17%)

Query: 27  QKRSILDPHFSVLQLLERNGCEQEEDVNQASSQIPVELKSAFNRPLSPHKRYPEALNQSI 86
           + + +LDPH SVL+LL + G         + S +   L ++ +  +S H      +N SI
Sbjct: 37  EDKGLLDPHLSVLELLGKTG--------HSPSPMGHSLVTSID--ISSH----HYVNDSI 82

Query: 87  SDSWQSIKMVDY----------------SILNSLHDTSSSQ-------AVGIXXXXXXXX 123
           S SWQ+I  +D                 SIL+S  DTS  +       A  I        
Sbjct: 83  SGSWQAIHPLDLGASFVPERSSSQTTNGSILSS-SDTSEEEQELLQAPAADIINIIKQGQ 141

Query: 124 XXXXHLNSPSPSSQQV-------FPNGPPISFQTQAGVLTASATLPNPGVLEEDDNETVT 176
                + SPS   +Q+        P     S+  Q           + G  EED   T+T
Sbjct: 142 EGAS-VTSPSRPFRQLHKVISLPLPAKGRTSYGEQDDDDNNVDDDYDDGAYEEDSG-TIT 199

Query: 177 VSLAASSNSFVMPQLSLSQRSHRFEILVVGKPARKFWNNVPKMYQKMFDIGDFESISAPK 236
            SL +S+NSFVMP+LSLSQ++  F +L++G+    F+ ++PK +Q +F++  +   +A  
Sbjct: 200 KSLTSSTNSFVMPKLSLSQKNPVFRLLILGRTGSNFYQSIPKEHQSLFELPKYHDSTA-- 257

Query: 237 VSHYTAVMIIFQDTKEVSFILDSLVTKLDGKAIIPICQRGQKQQLASLLEPFVKAKKIRL 296
              YT ++IIFQ+ +E+  +L+ +V    GK IIPICQ GQ  Q+ ++L+ F++ K I+L
Sbjct: 258 FPQYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVLKSFLRNKLIKL 317

Query: 297 MFQPTVMSNHQEIHKLLRYLHRLSTEI--------------------DSGYETDETHLXX 336
           ++ P V++N +++ K+ + L  LS E                      S Y   + +   
Sbjct: 318 LYPPVVVTNRRDLKKMFQRLQDLSLEYAEDGDNDDEDNDDEIIHTNSRSYYRNKKANSSK 377

Query: 337 XXXXXXXXXXXXGTS---NRWVIWGLSLTVGVGIGCCISFI 374
                              RW  WG+S+T+G+  GCC+++ 
Sbjct: 378 KKSFKSNKKPKKKKQRSLTRWFTWGVSITIGISFGCCVTYF 418

>YIL146C Chr9 complement(74184..75773) [1590 bp, 529 aa] {ON}
           ATG32Mitochondrial outer membrane protein required to
           initiate mitophagy; recruits the autophagy adaptor
           protein Atg11p and the ubiquitin-like protein Atg8p to
           the mitochondrial surface to initiate mitophagy, the
           selective vacuolar degradation of mitochondria in
           response to starvation; can promote pexophagy when
           placed ectopically in the peroxisomal membrane
          Length = 529

 Score =  142 bits (358), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 117/424 (27%), Positives = 201/424 (47%), Gaps = 78/424 (18%)

Query: 7   KKSHSGSDIPDPSA------SGSMPFQKRSILDPHFSVLQLLERNGCEQEEDVNQASSQI 60
           K S S S  PD S+      S +   + + +LDPH SVL+LL + G         + S +
Sbjct: 11  KGSSSKSMPPDSSSTTIHTCSEAQTGEDKGLLDPHLSVLELLSKTG--------HSPSPM 62

Query: 61  PVELKSAFNRPLSPHKRYPEALNQSISDSWQSIKMVDYSILNSLHDTSSSQAVG--IXXX 118
              L ++ +  +S +      +N SIS SWQ+I+ +D    + + +  SSQ     I   
Sbjct: 63  GQNLVTSID--ISGNHN----VNDSISGSWQAIQPLDLGA-SFIPERCSSQTTNGSILSS 115

Query: 119 XXXXXXXXXHLNSPSPSSQQVFPNGPPISFQTQAGVLTAS---------ATLPNPGVLEE 169
                     L +P+     +   G     Q  A V++ S          +LP PG  + 
Sbjct: 116 SDTSEEEQELLQAPAADIINIIKQG-----QEGANVVSPSHPFKQLQKIISLPLPGKEKT 170

Query: 170 DDNE----------------TVTVSLAASSNSFVMPQLSLSQRSHRFEILVVGKPARKFW 213
             NE                T+T SL +S+NSFVMP+LSL+Q++  F +L++G+    F+
Sbjct: 171 PFNEQDDDGDEDEAFEEDSVTITKSLTSSTNSFVMPKLSLTQKNPVFRLLILGRTGSSFY 230

Query: 214 NNVPKMYQKMFDIGDF-ESISAPKVSHYTAVMIIFQDTKEVSFILDSLVTKLDGKAIIPI 272
            ++PK YQ +F++  + +S + P+   YT ++IIFQ+ +E+  +L+ +V    GK +IPI
Sbjct: 231 QSIPKEYQSLFELPKYHDSATFPQ---YTGIVIIFQELREMVSLLNRIVQYSQGKPVIPI 287

Query: 273 CQRGQKQQLASLLEPFVKAKKIRLMFQPTVMSNHQEIHKLLRYLHRLSTEI--DSGYETD 330
           CQ GQ  Q+ ++L+ F++ K ++L+F P V++N +++ K+ + L  LS E   D   E +
Sbjct: 288 CQPGQVIQVKNVLKSFLRNKLVKLLFPPVVVTNKRDLKKMFQRLQDLSLEYGEDVNEEDN 347

Query: 331 ETHLXXXXXXXXXXXXXXGTS-------------------NRWVIWGLSLTVGVGIGCCI 371
           +                   S                     W  WG+S+T+G+  GCC+
Sbjct: 348 DDEAIHTKSRSYCRNKKAENSKKKSPKSNKKPKRKKQKFFTSWFTWGISITIGISFGCCV 407

Query: 372 SFIL 375
           ++ +
Sbjct: 408 TYFV 411

>Suva_9.43 Chr9
           complement(68866..68940,68994..69068,69093..69122,
           69126..70484) [1539 bp, 513 aa] {ON} YIL146C (REAL)
          Length = 513

 Score =  135 bits (340), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 107/405 (26%), Positives = 184/405 (45%), Gaps = 77/405 (19%)

Query: 27  QKRSILDPHFSVLQLLERNGCEQEEDVNQASSQIPVELKSAFNRPLSPHKRYPEALNQSI 86
           + + +LDPH SVL+LL + G          SS  P+      +  +S H      +  +I
Sbjct: 37  EDKGLLDPHLSVLELLGKTG----------SSPSPLGQSLVTSIDISNHHN----VIDNI 82

Query: 87  SDSWQSIKMVDYSILNSLHDTSSSQAVG--IXXXXXXXXXXXXHLNSPSPSSQQVFPNG- 143
           S SWQ+I+ +D    + + +  SSQ     I             L +P+     +   G 
Sbjct: 83  SGSWQTIQPLDLGA-SFIPERCSSQTTNGSILSSSDTSEEEQDLLQAPAADIINIIKQGQ 141

Query: 144 -------PPISFQTQAGVLTASATLPNP---------------------GVLEEDDNETV 175
                  P   F+    V++    LP P                       + E+D+ T+
Sbjct: 142 DGTSVTSPSHPFKQLHTVIS----LPMPPRERTFYGEQEDVVCIDNDDDNGMYEEDSVTI 197

Query: 176 TVSLAASSNSFVMPQLSLSQRSHRFEILVVGKPARKFWNNVPKMYQKMFDIGDFESISAP 235
           T SL +S+NSFVMP+LSLS+++  F +L++G+    F+ + PK YQ +F++   +S  + 
Sbjct: 198 TKSLTSSTNSFVMPKLSLSRKNPVFRLLILGRTGTNFYQSTPKEYQSLFELP--KSHDST 255

Query: 236 KVSHYTAVMIIFQDTKEVSFILDSLVTKLDGKAIIPICQRGQKQQLASLLEPFVKAKKIR 295
               YT ++I+FQ+ +E+  +L+ +V    GK IIPICQ GQ  Q+ ++L+ F+K   I+
Sbjct: 256 IFPQYTGIVIVFQELREMVSLLNRIVEYAQGKPIIPICQPGQTIQVKNVLKSFLKNSLIK 315

Query: 296 LMFQPTVMSNHQEIHKLLRYLHRLSTEI----------------------DSGYETDETH 333
           L++ P V +N +++ K+ + L  LS E                        S Y + +  
Sbjct: 316 LLYPPVVATNRKDLKKMFQRLQDLSLEYVEDEKNEDEDEDNDDEIIQPYSRSYYRSKKGG 375

Query: 334 LXXXXXXXXXXXXXXG---TSNRWVIWGLSLTVGVGIGCCISFIL 375
                              +S RW  WG+S+T+G+  GCC+++ +
Sbjct: 376 SSKKKSSKSNKKSKKKKQRSSTRWFTWGVSITIGISFGCCVTYFV 420

>CAGL0H06545g Chr8 (643447..644925) [1479 bp, 492 aa] {ON} similar
           to uniprot|P40458 Saccharomyces cerevisiae YIL146c ECM37
          Length = 492

 Score =  109 bits (272), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 61/205 (29%), Positives = 112/205 (54%), Gaps = 19/205 (9%)

Query: 186 FVMPQLSLSQR-SHRFEILVVGKPARKFWNNVPKMYQKMFDIGDFESISAPKVSHYTAVM 244
           FVMP+LSL+ + S   ++LVVG+ +++F  ++P+ Y++ F I   +S    +  +Y  ++
Sbjct: 195 FVMPKLSLTYKPSQAKKLLVVGRLSKRFHQDIPREYRQYFHIS--QSSDPSEFQNYIGIV 252

Query: 245 IIFQDTKEVSFILDSLVTKLDGKAIIPICQRGQKQQLASLLEPFVKAKKIRLMFQPTVMS 304
           I+FQ+ KE   +L+ +V   D K IIPICQ GQ+ ++ ++L+ F+K   I L + P  ++
Sbjct: 253 IVFQELKEFVAMLNRIVQYTDKKPIIPICQPGQRIRVKNILKSFLKNDAITLWYPPVTIA 312

Query: 305 NHQEIHKLLRYLHRLSTEIDSGYETDETHLXXXXXXXXXXXXXXGTSNR----------- 353
           N + + KL ++  +L  ++++  E D   L                +NR           
Sbjct: 313 NEKSMEKLFKHTVKLVNKLEN--EEDVLSLSTSDKSLSDETSGYRKNNRRKKHGGKPSTN 370

Query: 354 ---WVIWGLSLTVGVGIGCCISFIL 375
              W+ WG+SLT+GV IG   ++++
Sbjct: 371 YSKWITWGISLTIGVSIGYYATYMI 395

>TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.699
           YIL146C
          Length = 749

 Score = 96.7 bits (239), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/166 (29%), Positives = 94/166 (56%), Gaps = 8/166 (4%)

Query: 163 NPGVLEEDDNETVTVSLAASSNSFVMPQLSLSQRSHRFEILVVGKPAR-KFWNNVPKMYQ 221
           N  +    +N  +T S+ +SSNSF+MP+LS +    +F IL++G      F+ N+P  Y+
Sbjct: 313 NSTITNSYNNLNLTKSMTSSSNSFIMPKLSWTNTFRKFRILILGSNQNLTFYQNIPTSYK 372

Query: 222 KMFDI--GDFESISAPKVSHYTAVMIIFQDTKEVSFILDSL-VTKLDGKAIIPICQRGQK 278
            +F++   +F+        HY  + I+  D  +   IL+ +    ++ K IIPIC++GQ 
Sbjct: 373 YLFELPPNNFDY----NFKHYAGIAIVIHDLTDFKSILNKIDKYSMNKKPIIPICEKGQI 428

Query: 279 QQLASLLEPFVKAKKIRLMFQPTVMSNHQEIHKLLRYLHRLSTEID 324
            ++ ++L+P++K K + L++ P V +N   ++ L  +L+ LS  ++
Sbjct: 429 NEVKNILKPYIKTKDLSLLYPPIVGTNRDGMNTLYLHLNDLSKNVE 474

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 54/98 (55%), Gaps = 14/98 (14%)

Query: 19  SASGSMPFQKRSILDPHFSVLQLLERNGCEQEEDVNQAS--------------SQIPVEL 64
           S+SGSM + KR  LDPHFS+++LLE      +E+ N+A+              ++I +EL
Sbjct: 15  SSSGSMDYDKRGFLDPHFSLIELLENAKYSLQENSNEATVTNVLQPDNPTSPLNEIRLEL 74

Query: 65  KSAFNRPLSPHKRYPEALNQSISDSWQSIKMVDYSILN 102
                  ++   +    L+QS+S+SWQ I+  DYS L+
Sbjct: 75  SGMNVDDINSENQESSELSQSLSNSWQRIQTPDYSPLD 112

>NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}
           Anc_5.699 YIL146C
          Length = 510

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 82/311 (26%), Positives = 144/311 (46%), Gaps = 49/311 (15%)

Query: 29  RSILDPHFSVLQLLERNGCEQEEDVNQASSQIPVELKSAFNRPLSPHKRYPEALNQSISD 88
           +S+LDPH SVL++LER   +  + V +ASS+I                          S 
Sbjct: 36  KSLLDPHLSVLEMLER---KDNDTVMEASSRI--------------------------SR 66

Query: 89  SWQSIKM-VDYSILNSLHDTSSSQAVGIXXXXXXXXXXX----XHLNSPSPSSQQVFPNG 143
           SWQ+I+   D   L S   +  S  V I                 LNS    S + + N 
Sbjct: 67  SWQNIESPADSKQLLSAKSSQVSNLVSILSSSSDTSDEEVDRINSLNSAGEGSSKNYNNP 126

Query: 144 PPISFQTQAGVLTASATLPNPGVLEEDDNETVTVSLAASS---NSFVMP---QLSLSQRS 197
            P+    Q  +     T    G  ++    T+T SL +SS   NSFVMP     S   + 
Sbjct: 127 SPL----QNPIYLPEFTDVTAGDNDDGIASTITKSLTSSSTISNSFVMPTLSLSSSQSQQ 182

Query: 198 HRFEILVVGKPARKFWNNVPKMYQKMFDI-GDFESISAPKVSHYTAVMIIFQDTKEVSFI 256
            +F+IL+ G+    F+  +PK YQ +F +     +++  ++ ++TA +IIF++ KE+  +
Sbjct: 183 RKFQILIFGRLGPSFYRTIPKQYQYLFHVPNQLNTLTRNEMDNFTAFLIIFEELKELVSL 242

Query: 257 LDSLVTKLDGKAIIPI----CQRGQKQQLASLLEPFVKAKKIRLMFQPTVMSNHQEIHKL 312
           L+ +  +L  K + P     CQ GQK ++ S+L+ F+K   + L+    ++++ + + K+
Sbjct: 243 LNRISEELSFKKVPPPIIPICQPGQKIKVKSILKYFLKNNFVTLLSPIIIINDERALLKM 302

Query: 313 LRYLHRLSTEI 323
            + +  +S  +
Sbjct: 303 FKTMQSISKTV 313

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 25/41 (60%), Gaps = 3/41 (7%)

Query: 352 NRWVIWGLSLTVGVGIGCCISFILXXXXXXV---QIPHASR 389
           N+WV+W +SLTVG G+G  IS+ +      +   +I H +R
Sbjct: 380 NKWVVWSISLTVGAGMGYIISYCVFNSSKRLPLEKIAHQTR 420

>KNAG0L02100 Chr12 (374542..375876) [1335 bp, 444 aa] {ON} Anc_5.699
           YIL146C
          Length = 444

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 87/379 (22%), Positives = 168/379 (44%), Gaps = 60/379 (15%)

Query: 24  MPFQKRSILDPHFSVLQLLERNGCEQEEDVNQASSQIPVELKSAFNRPLSPHKRYPEALN 83
           M     S+LDPH SVL+LLE++ CE+        S                  R   A  
Sbjct: 1   MSGHANSVLDPHLSVLELLEKS-CERGGHAEAPGS-----------------SRNKGAGQ 42

Query: 84  QSISDSWQSIKMVDYSILNSLHDTSSSQAV--GIXXXXXXXXXXXXHLNSPSPSSQQVFP 141
             +S+SW +++  + S +    + S+SQ    G+               SP         
Sbjct: 43  IQLSESWCTVERDELSAM----ERSASQQTNNGVLSSSDTSEEGEPEQGSPGDGEGGGVA 98

Query: 142 NG----PPISFQTQAGVLTASATLPNPGVLEEDDNETVTVSLAASSNSFVMPQL------ 191
           +     P +S Q+ +  L         GV  +DD+ TV+ SL +SSNSF+MP+L      
Sbjct: 99  DTRMARPAMSLQSTSSTLD--------GV--DDDSATVSKSLTSSSNSFIMPKLYTTVAG 148

Query: 192 -----SLSQRSHRFEILVVGKPARKFW-NNVPKMYQKMFDIGDFESISAPKVSHYTAVMI 245
                S + ++  F++ V+G+ A KF    VP+ ++  F++       A + +    ++I
Sbjct: 149 APSTVSTALQTRCFKVAVLGRGAVKFCQETVPEQFRHRFELTAGVHDLA-QCADRQGILI 207

Query: 246 IFQDTKEVSFILDSLVTKLDGKAIIPICQRGQKQQLASLLEPFVKAKKIRLMFQPTVMSN 305
           + Q+ +E+  +L+ +        ++ +  R ++ Q+ ++L  F + + + L+  P  +SN
Sbjct: 208 VVQEVRELISLLNRVHCACPEVPVVAVYDRDRQVQVKNVLRNFTRQRLVSLLHPPVPLSN 267

Query: 306 HQEIHKLLRYLHRLSTEIDSG-------YETDETHLXXXXXX-XXXXXXXXGTSNRWVIW 357
           ++ + K+  ++  L+ + +           T E H                GT  RW++W
Sbjct: 268 NEALDKMFHFVDNLARQQEPAGVIHNDPQTTQEQHPDHNEDDPHRGPSKPEGTFKRWLLW 327

Query: 358 GLSLTVGVGIG-CCISFIL 375
           G+S+++G+G G  C+S+++
Sbjct: 328 GVSISLGIGAGYYCVSYVV 346

>KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {ON}
           Anc_5.699 YIL146C
          Length = 556

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 86/142 (60%), Gaps = 9/142 (6%)

Query: 186 FVMPQLSLSQR------SHRFEILVVGKPARKFWNNVPKMYQKMFDIGDFESISAPKVSH 239
           F+MP+LSL+++      ++ F IL+VG+ + K +  +P  +Q +F +   +S    +   
Sbjct: 224 FIMPRLSLTKKERQQLNANEFRILIVGRLSSKLFKMIPHKFQNLFQLQ--KSYDINEYQK 281

Query: 240 YTAVMIIFQDTKEVSFILDSLV-TKLDGKAIIPICQRGQKQQLASLLEPFVKAKKIRLMF 298
           +TA++++ Q+T+E+  +L+ +  ++   + +I IC++    Q  ++L+ +++   I L++
Sbjct: 282 FTAILVVIQETRELISLLNRISRSEKVKRPLIAICEKDAFLQCKNVLKSYLRNDLITLLY 341

Query: 299 QPTVMSNHQEIHKLLRYLHRLS 320
           QP V+SN +E+ ++L +L   S
Sbjct: 342 QPFVISNTEELDRMLVFLKETS 363

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 21/23 (91%)

Query: 352 NRWVIWGLSLTVGVGIGCCISFI 374
           N+W+IWG+SL++GVGIG CIS+ 
Sbjct: 435 NKWIIWGISLSIGVGIGYCISYF 457

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 46/84 (54%), Gaps = 7/84 (8%)

Query: 30  SILDPHFSVLQLLER---NGCEQEEDVNQASSQ-IPVELKSAFNRPLSPHKRYPEALNQS 85
           SILDPH SVL+LLER   N  EQ++ +   + + I VE+ +      +     P ++   
Sbjct: 29  SILDPHLSVLELLERGFQNVHEQDDTIMSTTPRDIAVEMATVRLNSEASGVSTP-SVGDI 87

Query: 86  ISDSWQSIKMVDYSILNSLHDTSS 109
           IS SW +I+  D  +  SLH+ S+
Sbjct: 88  ISQSWHTIQRRD--LEESLHNNSN 109

>TPHA0D04580 Chr4 (1000005..1001417) [1413 bp, 470 aa] {ON} 
          Length = 470

 Score = 38.1 bits (87), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 71/143 (49%), Gaps = 21/143 (14%)

Query: 176 TVSLAASSNSFVMPQLSLSQRSHRFE-ILVVGKPARKFWNNVPKM----YQKMFDIGDFE 230
           + S  +SSN FVMP+LS S++    + I VVG  A  F+    ++    Y  M D+    
Sbjct: 110 SASDTSSSNQFVMPRLSYSKKEGSLKAISVVGSHADSFYQEYLQVSTGEYCFMLDVSTDN 169

Query: 231 SISAPKVSHYTAVMIIFQDTKEVSFILDSLVTKLDGK-----AIIPICQRGQKQQLASLL 285
           S+S   V ++  ++ I + +++++ +  ++V  LD +      II  C +     L+S+ 
Sbjct: 170 SVSLLVVQNHLELLDILRHSRDITVV--AIVLSLDHRRGDNLEIIKNCNK----VLSSM- 222

Query: 286 EPFVKAKKIRLMFQPTVMSNHQE 308
               K +K  +++ P ++  H+ 
Sbjct: 223 ----KERKWPMLYYPNLIIIHER 241

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 11/19 (57%), Positives = 17/19 (89%)

Query: 27 QKRSILDPHFSVLQLLERN 45
          ++RS+++PH+SVL LLE N
Sbjct: 13 ERRSVIEPHYSVLDLLEAN 31

>Kpol_2001.73 s2001 (199741..200976) [1236 bp, 411 aa] {ON}
           (199741..200976) [1236 nt, 412 aa]
          Length = 411

 Score = 37.4 bits (85), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 47/95 (49%), Gaps = 10/95 (10%)

Query: 353 RW--VIWGLSLTVGVGIGCCI-SFILXXXXXXVQ--IPHASRDDVVLVEEVPTLPDKAEG 407
           +W  V +G+S+T+GVG+G CI S ++      +Q  +P    +D++ +E      D    
Sbjct: 305 KWLFVYYGISITLGVGVGYCISSLVVSQNSNDIQSIVPSTPNNDIIALES----QDLNSH 360

Query: 408 NGPIGQVITLLRKTVKQFNLVLKQFIYEQVGSLSW 442
           NG        L+ ++K    +LK+FI   +  L +
Sbjct: 361 NGD-DYNWNFLKLSIKNVYSILKRFITTSINLLEY 394

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 21/31 (67%)

Query: 28 KRSILDPHFSVLQLLERNGCEQEEDVNQASS 58
          ++ +LDPH+SVL+LLE N     + +N + S
Sbjct: 2  EKHLLDPHYSVLKLLENNFNNPNDSMNLSES 32

>KLTH0G18898g Chr7 complement(1631048..1633873) [2826 bp, 941 aa]
           {ON} similar to uniprot|P32522 Saccharomyces cerevisiae
           YLR067C PET309 Specific translational activator for the
           COX1 mRNA also influences stability of intron-containing
           COX1 primary transcripts located in the mitochondrial
           inner membrane
          Length = 941

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 63/161 (39%), Gaps = 34/161 (21%)

Query: 194 SQRSHRFEILVVGKPARKFWNNVPKMYQKMFDIGDFESISAPKVSHYTAVMIIFQDTKEV 253
           +Q   +F+ L++     + W N+   +  +F IGD      P ++HY  VM       E 
Sbjct: 289 AQDDAQFDYLLIAHAKLQDWGNLQNQFNALFGIGDL-----PSINHYGIVMFSIAHLGER 343

Query: 254 SFILDSLVTKLDGKAIIPICQRGQKQQLASLLEPFVKAKKIRLMFQ-----------PT- 301
             + + L  +L  + +IP         L SLL+   K   +   FQ           PT 
Sbjct: 344 EMV-EKLYNQLLRRKMIPTL-----PVLQSLLQVCYKTGDMNGCFQHFELFKKYGIKPTP 397

Query: 302 --------VMSNHQEIHKLLRYLHRLSTEIDSGYETDETHL 334
                   +  N  +I   LR+L R++   ++G E  E H 
Sbjct: 398 STCNIMLRIFRNLSDIDGSLRFLKRMT---ENGIEVSEKHF 435

>SAKL0B00902g Chr2 (83877..86711) [2835 bp, 944 aa] {ON} similar to
           uniprot|P32522 Saccharomyces cerevisiae YLR067C PET309
           Specific translational activator for the COX1 mRNA also
           influences stability of intron-containing COX1 primary
           transcripts located in the mitochondrial inner membrane
          Length = 944

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 17/73 (23%), Positives = 37/73 (50%), Gaps = 6/73 (8%)

Query: 199 RFEILVVGKPARKFWNNVPKMYQKMFDIGDFESISAPKVSHYTAVMIIFQDTKEVSFILD 258
           +F+ +++    ++ W N+   +  +F IG+      P ++HY  VM    +  E S +++
Sbjct: 294 QFDYVLIAYAKQQNWQNLQDQFNALFGIGEL-----PSINHYGIVMYAIAELGE-SEMVE 347

Query: 259 SLVTKLDGKAIIP 271
            L  +L  + +IP
Sbjct: 348 KLYGQLLRRGMIP 360

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.132    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,449,228
Number of extensions: 1816053
Number of successful extensions: 5130
Number of sequences better than 10.0: 27
Number of HSP's gapped: 5241
Number of HSP's successfully gapped: 42
Length of query: 470
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 357
Effective length of database: 40,524,141
Effective search space: 14467118337
Effective search space used: 14467118337
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)