Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E14828g5.698ON59259231590.0
KLLA0E12915g5.698ON65458121830.0
Kpol_529.285.698ON61055121730.0
Suva_11.3295.698ON60158921300.0
TPHA0N01960singletonON59153421270.0
TPHA0O02000singletonON62054621020.0
KNAG0C065705.698ON59058120920.0
YKR093W (PTR2)5.698ON60157320920.0
ZYRO0G06688g5.698ON61355720910.0
Smik_11.3565.698ON60255520850.0
NDAI0E050205.698ON61956020860.0
TDEL0B022305.698ON57456520760.0
TBLA0A091205.698ON63353420690.0
CAGL0G02453g5.698ON59759020630.0
NCAS0A032205.698ON61159220380.0
TBLA0E01140singletonON61153519820.0
KAFR0H00230singletonON59657319700.0
KAFR0H002405.698ON59152619290.0
TBLA0B04710singletonON61555418990.0
Skud_11.3315.698ON39939515580.0
Kwal_47.16930na 1ON6115846891e-81
KLTH0D16544gna 1ON6265886445e-75
AGL365Cna 2ON5995436147e-71
Ecym_2823na 2ON6135735798e-66
AFR228WsingletonON5765735506e-62
ADL156Cna 3ON483137771.1
TBLA0F021307.309ON88087751.8
NDAI0F01930singletonON564114733.3
TBLA0F01600singletonON567114715.6
NDAI0B043902.138ON34856696.7
NDAI0F029202.138ON40443699.0
TDEL0A033305.469ON549120699.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E14828g
         (592 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E14828g Chr5 (1226652..1228430) [1779 bp, 592 aa] {ON} simi...  1221   0.0  
KLLA0E12915g Chr5 complement(1142167..1144131) [1965 bp, 654 aa]...   845   0.0  
Kpol_529.28 s529 complement(82303..84135) [1833 bp, 610 aa] {ON}...   841   0.0  
Suva_11.329 Chr11 (600372..602177) [1806 bp, 601 aa] {ON} YKR093...   825   0.0  
TPHA0N01960 Chr14 complement(418505..420280) [1776 bp, 591 aa] {...   823   0.0  
TPHA0O02000 Chr15 complement(404570..406432) [1863 bp, 620 aa] {...   814   0.0  
KNAG0C06570 Chr3 (1273605..1275377) [1773 bp, 590 aa] {ON} Anc_5...   810   0.0  
YKR093W Chr11 (615730..617535) [1806 bp, 601 aa] {ON}  PTR2Integ...   810   0.0  
ZYRO0G06688g Chr7 complement(535282..537123) [1842 bp, 613 aa] {...   810   0.0  
Smik_11.356 Chr11 (605836..607644) [1809 bp, 602 aa] {ON} YKR093...   807   0.0  
NDAI0E05020 Chr5 (1146336..1148195) [1860 bp, 619 aa] {ON} Anc_5...   808   0.0  
TDEL0B02230 Chr2 complement(402022..403746) [1725 bp, 574 aa] {O...   804   0.0  
TBLA0A09120 Chr1 complement(2259486..2261387) [1902 bp, 633 aa] ...   801   0.0  
CAGL0G02453g Chr7 (218003..219796) [1794 bp, 597 aa] {ON} highly...   799   0.0  
NCAS0A03220 Chr1 complement(635016..636851) [1836 bp, 611 aa] {O...   789   0.0  
TBLA0E01140 Chr5 complement(250628..252463) [1836 bp, 611 aa] {O...   768   0.0  
KAFR0H00230 Chr8 complement(33231..35021) [1791 bp, 596 aa] {ON}      763   0.0  
KAFR0H00240 Chr8 complement(36393..38168) [1776 bp, 591 aa] {ON}...   747   0.0  
TBLA0B04710 Chr2 (1104183..1106030) [1848 bp, 615 aa] {ON}            736   0.0  
Skud_11.331 Chr11 (597847..599046) [1200 bp, 399 aa] {ON} YKR093...   604   0.0  
Kwal_47.16930 s47 (176926..178761) [1836 bp, 611 aa] {ON} YKR093...   270   1e-81
KLTH0D16544g Chr4 complement(1366262..1368142) [1881 bp, 626 aa]...   252   5e-75
AGL365C Chr7 complement(13929..15728) [1800 bp, 599 aa] {ON} NOH...   241   7e-71
Ecym_2823 Chr2 (1599716..1601557) [1842 bp, 613 aa] {ON} similar...   227   8e-66
AFR228W Chr6 (850893..852623) [1731 bp, 576 aa] {ON} Non-synteni...   216   6e-62
ADL156C Chr4 complement(416054..417505) [1452 bp, 483 aa] {ON} S...    34   1.1  
TBLA0F02130 Chr6 complement(522486..525128) [2643 bp, 880 aa] {O...    33   1.8  
NDAI0F01930 Chr6 (467932..469626) [1695 bp, 564 aa] {ON}               33   3.3  
TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {O...    32   5.6  
NDAI0B04390 Chr2 (1100175..1101221) [1047 bp, 348 aa] {ON} Anc_2...    31   6.7  
NDAI0F02920 Chr6 (715012..716226) [1215 bp, 404 aa] {ON} Anc_2.1...    31   9.0  
TDEL0A03330 Chr1 complement(590772..592421) [1650 bp, 549 aa] {O...    31   9.2  

>SAKL0E14828g Chr5 (1226652..1228430) [1779 bp, 592 aa] {ON} similar
           to uniprot|P32901 Saccharomyces cerevisiae YKR093W PTR2
           Functions in transport of small peptides into the cell
           Peptide transporter
          Length = 592

 Score = 1221 bits (3159), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 592/592 (100%), Positives = 592/592 (100%)

Query: 1   MSTIKNLWNKTETEVVVTSSPENSVEKIARPESFVDVLDKNQYINADSDHGREPTDEEMK 60
           MSTIKNLWNKTETEVVVTSSPENSVEKIARPESFVDVLDKNQYINADSDHGREPTDEEMK
Sbjct: 1   MSTIKNLWNKTETEVVVTSSPENSVEKIARPESFVDVLDKNQYINADSDHGREPTDEEMK 60

Query: 61  TLRHVSEQIPVRCWLVAVVELAERFSYYGLSAPFQNYMQNGPNDTPKGILNLKNQGATAL 120
           TLRHVSEQIPVRCWLVAVVELAERFSYYGLSAPFQNYMQNGPNDTPKGILNLKNQGATAL
Sbjct: 61  TLRHVSEQIPVRCWLVAVVELAERFSYYGLSAPFQNYMQNGPNDTPKGILNLKNQGATAL 120

Query: 121 SYFFQFWCYVSPLLGGFVADTYWGKYKTICVGTGIYVVGIFILFITSVPSITYYSASLGG 180
           SYFFQFWCYVSPLLGGFVADTYWGKYKTICVGTGIYVVGIFILFITSVPSITYYSASLGG
Sbjct: 121 SYFFQFWCYVSPLLGGFVADTYWGKYKTICVGTGIYVVGIFILFITSVPSITYYSASLGG 180

Query: 181 FITSLILIGLATGMIKANISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQNIFMFFYL 240
           FITSLILIGLATGMIKANISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQNIFMFFYL
Sbjct: 181 FITSLILIGLATGMIKANISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQNIFMFFYL 240

Query: 241 MINIGSLSVIATTEMEAHIGFWAAYLLPFCFFFVAVFVLILGRNQYVKLPVGDKVISKSF 300
           MINIGSLSVIATTEMEAHIGFWAAYLLPFCFFFVAVFVLILGRNQYVKLPVGDKVISKSF
Sbjct: 241 MINIGSLSVIATTEMEAHIGFWAAYLLPFCFFFVAVFVLILGRNQYVKLPVGDKVISKSF 300

Query: 301 KVCWIVMRNKFRFDAARPSLNPELGYPWSDKFIDEIKRAIAACKVFVFYPIYWVCYGQML 360
           KVCWIVMRNKFRFDAARPSLNPELGYPWSDKFIDEIKRAIAACKVFVFYPIYWVCYGQML
Sbjct: 301 KVCWIVMRNKFRFDAARPSLNPELGYPWSDKFIDEIKRAIAACKVFVFYPIYWVCYGQML 360

Query: 361 SNFVSQAGMMELHGLPNDFLQAIDSIALIVFIPICERFLYPFIRRFTPFRPITKIFYGFI 420
           SNFVSQAGMMELHGLPNDFLQAIDSIALIVFIPICERFLYPFIRRFTPFRPITKIFYGFI
Sbjct: 361 SNFVSQAGMMELHGLPNDFLQAIDSIALIVFIPICERFLYPFIRRFTPFRPITKIFYGFI 420

Query: 421 FGALAMAWAAVLQHFIYKAGPCYYYPMACAPEYKNTPNRIHIAWQVPAYVLIAFSEIFAS 480
           FGALAMAWAAVLQHFIYKAGPCYYYPMACAPEYKNTPNRIHIAWQVPAYVLIAFSEIFAS
Sbjct: 421 FGALAMAWAAVLQHFIYKAGPCYYYPMACAPEYKNTPNRIHIAWQVPAYVLIAFSEIFAS 480

Query: 481 ITGLEYAYSKAPVSMRSFIMSIFLLTTAFGSALGIALSSVSVNPKFVWTFSGLAVSCFIA 540
           ITGLEYAYSKAPVSMRSFIMSIFLLTTAFGSALGIALSSVSVNPKFVWTFSGLAVSCFIA
Sbjct: 481 ITGLEYAYSKAPVSMRSFIMSIFLLTTAFGSALGIALSSVSVNPKFVWTFSGLAVSCFIA 540

Query: 541 GCLFWAFFHKYNDTEEAMNAIDYEEDDVLNYGVSIHYDLEPIASVNSDKRIT 592
           GCLFWAFFHKYNDTEEAMNAIDYEEDDVLNYGVSIHYDLEPIASVNSDKRIT
Sbjct: 541 GCLFWAFFHKYNDTEEAMNAIDYEEDDVLNYGVSIHYDLEPIASVNSDKRIT 592

>KLLA0E12915g Chr5 complement(1142167..1144131) [1965 bp, 654 aa]
           {ON} similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 654

 Score =  845 bits (2183), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/581 (69%), Positives = 484/581 (83%), Gaps = 9/581 (1%)

Query: 9   NKTETEVVVTSSPENSVEKIARPESFVDVLDKNQYINADSDHGREPTDEEMKTLRHVSEQ 68
           N T+ +V ++     S +KI     F+  +D++   N   ++GREPT+EE+ TLRHVSE+
Sbjct: 59  NNTDIKVYISKDHHASSDKI----DFIGAVDEDDNQN---ENGREPTEEELSTLRHVSER 111

Query: 69  IPVRCWLVAVVELAERFSYYGLSAPFQNYMQNGPNDTPKGILNLKNQGATALSYFFQFWC 128
           IP  CWL+A+VELAERFSYYGLSAPFQNYMQNGPNDTPKG+L LK+QGATALSYFFQFWC
Sbjct: 112 IPFTCWLIAIVELAERFSYYGLSAPFQNYMQNGPNDTPKGVLQLKSQGATALSYFFQFWC 171

Query: 129 YVSPLLGGFVADTYWGKYKTICVGTGIYVVGIFILFITSVPSITYYSASLGGFITSLILI 188
           YV+PLLGG++ADT+WGKY TICVG   YVVGI ILF+T++PSI   ++SLGGFI SLI+I
Sbjct: 172 YVTPLLGGYLADTFWGKYNTICVGASFYVVGILILFMTAIPSINDKNSSLGGFIVSLIII 231

Query: 189 GLATGMIKANISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQNIFMFFYLMINIGSLS 248
           G+ TG IKAN+SVLIADQIPK+RP +KVLK+GE+VIEDPN+T+QN+FMFFYLMINIGSLS
Sbjct: 232 GIGTGFIKANLSVLIADQIPKTRPRIKVLKNGEKVIEDPNVTMQNVFMFFYLMINIGSLS 291

Query: 249 VIATTEMEAHIGFWAAYLLPFCFFFVAVFVLILGRNQYVKLPVGDKVISKSFKVCWIVMR 308
           V+ATT +EA  GFWAAYLL FCFF+V + VL+ GR +YV+ P+GD VI++ FK+CWI + 
Sbjct: 292 VMATTHLEASYGFWAAYLLTFCFFWVGIVVLVFGRKKYVRRPIGDHVIARCFKICWIGLC 351

Query: 309 NKFRFDAARPSLNPELGYPWSDKFIDEIKRAIAACKVFVFYPIYWVCYGQMLSNFVSQAG 368
           N F  + A PSLNPE  YPW+D FIDEI+RA  ACKVF FYPIYWV YGQML+NFV+QAG
Sbjct: 352 NGFNLNRAVPSLNPEKEYPWNDLFIDEIRRAFKACKVFAFYPIYWVVYGQMLNNFVTQAG 411

Query: 369 MMELHGLPNDFLQAIDSIALIVFIPICERFLYPFIRRFTPFRPITKIFYGFIFGALAMAW 428
            MELHGLPNDFLQAI+SIALIVFIPI E+F+YPFIRRFTPFRP+TKIF GF FG+ AM +
Sbjct: 412 TMELHGLPNDFLQAINSIALIVFIPIMEQFIYPFIRRFTPFRPVTKIFIGFCFGSSAMVY 471

Query: 429 AAVLQHFIYKAGPCYYYPMACAPEYKNTPNRIHIAWQVPAYVLIAFSEIFASITGLEYAY 488
           AAVLQHFIYKAGPCY +PM+CAPEY NTPNR+HI WQVPAYVLI+ SEIFASITGLEYAY
Sbjct: 472 AAVLQHFIYKAGPCYDFPMSCAPEYANTPNRVHIGWQVPAYVLISLSEIFASITGLEYAY 531

Query: 489 SKAPVSMRSFIMSIFLLTTAFGSALGIALSSVSVNPKFVWTFSGLAVSCFIAGCLFWAFF 548
           SKAP +M++FIMSIFL+T A GSALGIALS  + NPK+VWTFSGLAV+CFIAGCLFW  F
Sbjct: 532 SKAPATMKAFIMSIFLVTNAVGSALGIALSPTAENPKYVWTFSGLAVACFIAGCLFWLCF 591

Query: 549 HKYNDTEEAMNAIDY--EEDDVLNYGVSIHYDLEPIASVNS 587
           H YN  EEA+NA+DY  EE + +  GV +  +   + SV+S
Sbjct: 592 HHYNKDEEALNALDYKTEEQEQMLSGVGVTGEGAALYSVSS 632

>Kpol_529.28 s529 complement(82303..84135) [1833 bp, 610 aa] {ON}
           complement(82303..84135) [1833 nt, 611 aa]
          Length = 610

 Score =  841 bits (2173), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/551 (69%), Positives = 471/551 (85%), Gaps = 1/551 (0%)

Query: 9   NKTETEVVVTSSPENSVEKIARPESFVDVLDKNQYINADSDHGREPTDEEMKTLRHVSEQ 68
           +K + EV + S  +++  + +       V D +   + + D   EPT+EEMKTL+HVS +
Sbjct: 24  SKQDHEVKIVSKFDSTSLQNSDQLEITKVGDDDIEYDDNQDF-VEPTEEEMKTLKHVSGK 82

Query: 69  IPVRCWLVAVVELAERFSYYGLSAPFQNYMQNGPNDTPKGILNLKNQGATALSYFFQFWC 128
           IP+RCWL+AVVEL+ERFSYYGL+APFQNYM NGPNDTPKG+L L  QGA+ALSYFFQFWC
Sbjct: 83  IPMRCWLIAVVELSERFSYYGLAAPFQNYMANGPNDTPKGVLMLDTQGASALSYFFQFWC 142

Query: 129 YVSPLLGGFVADTYWGKYKTICVGTGIYVVGIFILFITSVPSITYYSASLGGFITSLILI 188
           Y++P+ GG++ADTYWGKY TIC GTGIYVVGIF+LFITS+PSI     +LGG++T++ILI
Sbjct: 143 YITPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFITSLPSIDTRETALGGYVTAIILI 202

Query: 189 GLATGMIKANISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQNIFMFFYLMINIGSLS 248
           G+ATGMIKANISVLIA+QIP+++P V   K G+RVIEDPNIT QN+FMFFY+MIN+GSLS
Sbjct: 203 GIATGMIKANISVLIAEQIPRTKPRVITQKGGKRVIEDPNITTQNVFMFFYMMINVGSLS 262

Query: 249 VIATTEMEAHIGFWAAYLLPFCFFFVAVFVLILGRNQYVKLPVGDKVISKSFKVCWIVMR 308
           ++ATTE+E+H GFWAAYLLPFCFF++AV VL++GRNQY+ +PVGDK+ISKSFKV WI+++
Sbjct: 263 LMATTELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQYIMVPVGDKMISKSFKVMWILVK 322

Query: 309 NKFRFDAARPSLNPELGYPWSDKFIDEIKRAIAACKVFVFYPIYWVCYGQMLSNFVSQAG 368
           NK  FDAA+PS+NPE  YPW+DKF++EI+RA+ ACKVFVFYPIYW  YGQM++NFV+QAG
Sbjct: 323 NKLNFDAAKPSMNPEKNYPWNDKFVEEIRRALRACKVFVFYPIYWCVYGQMINNFVTQAG 382

Query: 369 MMELHGLPNDFLQAIDSIALIVFIPICERFLYPFIRRFTPFRPITKIFYGFIFGALAMAW 428
            MELH LPNDFLQA DSIA+IVFIPI ERF+YPF+RRFTPFRPITKIF+GF+FG+ AM W
Sbjct: 383 TMELHNLPNDFLQAFDSIAIIVFIPIFERFIYPFVRRFTPFRPITKIFWGFMFGSGAMIW 442

Query: 429 AAVLQHFIYKAGPCYYYPMACAPEYKNTPNRIHIAWQVPAYVLIAFSEIFASITGLEYAY 488
           AAVLQ FIYKAGPCY  PM CAPEY NTPN++H+AWQVPAYVLIA SEI AS+TGLEYAY
Sbjct: 443 AAVLQSFIYKAGPCYNMPMKCAPEYANTPNQVHVAWQVPAYVLIAISEILASVTGLEYAY 502

Query: 489 SKAPVSMRSFIMSIFLLTTAFGSALGIALSSVSVNPKFVWTFSGLAVSCFIAGCLFWAFF 548
           S AP SM+SFIMSIFL+T AFGSA+GIA+S  + +PK+ WTF+GLAV+CFIAGCLFW  F
Sbjct: 503 SNAPASMKSFIMSIFLVTNAFGSAIGIAISPTAQDPKYTWTFTGLAVACFIAGCLFWICF 562

Query: 549 HKYNDTEEAMN 559
             YN+TE+AMN
Sbjct: 563 RSYNNTEDAMN 573

>Suva_11.329 Chr11 (600372..602177) [1806 bp, 601 aa] {ON} YKR093W
           (REAL)
          Length = 601

 Score =  825 bits (2130), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/589 (65%), Positives = 480/589 (81%), Gaps = 21/589 (3%)

Query: 6   NLWNKTETEVVVTSSPENSVEKIARPESFV--DVLDKNQYIN----ADSDHGREPTDEEM 59
           ++ ++ + E  V    +N  + +   +S+V  D  +  +  N     + +    PTDEE+
Sbjct: 11  DIQDEKQGEFPVVEEEKN--QTVTLKDSYVSDDAANSTERFNLSPSPEDNEFEAPTDEEL 68

Query: 60  KTLRHVSEQIPVRCWLVAVVELAERFSYYGLSAPFQNYMQNGPNDTPKGILNLKNQGATA 119
           ++LRHV  +IP+RCWL+A+VEL+ERFSYYGLSAPFQNYM+ GPNDTPKG+L+L + GAT 
Sbjct: 69  RSLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDTPKGMLSLNSSGATG 128

Query: 120 LSYFFQFWCYVSPLLGGFVADTYWGKYKTICVGTGIYVVGIFILFITSVPSITYYSASLG 179
           LSYFFQFWCYV+P+ GG++ADT+WGKY TIC GT IY+ GIFILFITS+PS+    ++LG
Sbjct: 129 LSYFFQFWCYVTPVFGGYIADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSALG 188

Query: 180 GFITSLILIGLATGMIKANISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQNIFMFFY 239
           GFI S+ILIG+ATGMIKAN+SVLIADQ+PK +P +KVLKSGERVIED NIT+QN+FMFFY
Sbjct: 189 GFIASIILIGIATGMIKANLSVLIADQLPKRKPFIKVLKSGERVIEDGNITLQNVFMFFY 248

Query: 240 LMINIGSLSVIATTEMEAHIGFWAAYLLPFCFFFVAVFVLILGRNQYVKLPVGDKVISKS 299
            MIN+GSLS++ATTE+E H GFWAAYLLPFCFF+VAV  L+ G+ QY++ P+GDKVI+KS
Sbjct: 249 FMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQYIQRPIGDKVIAKS 308

Query: 300 FKVCWIVMRNKFRFDAARPSLNPELGYPWSDKFIDEIKRAIAACKVFVFYPIYWVCYGQM 359
           FKVCWI+ +NKF F+AA+PS++PE  YPW+DKF+DEIKRA+AACKVFVFYPIYW  YG M
Sbjct: 309 FKVCWILTKNKFDFNAAKPSVHPEKDYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGTM 368

Query: 360 LSNFVSQAGMMELHGLPNDFLQAIDSIALIVFIPICERFLYPFIRRFTPFRPITKIFYGF 419
           +S+F++QA MMELHG+PNDFLQA DSIALI+FIPI E+F YPFIRR+TPF+PITKIF+GF
Sbjct: 369 ISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRYTPFKPITKIFFGF 428

Query: 420 IFGALAMAWAAVLQHFIYKAGPCYYYPMACAPEYKNTPNRIHIAWQVPAYVLIAFSEIFA 479
           +FG+ AM WAAVLQ F+YKAGP Y  P+       NTPN +H+ WQ+PAYVLI+FSEIFA
Sbjct: 429 MFGSFAMTWAAVLQSFVYKAGPWYSEPLG-----HNTPNHVHVCWQIPAYVLISFSEIFA 483

Query: 480 SITGLEYAYSKAPVSMRSFIMSIFLLTTAFGSALGIALSSVSVNPKFVWTFSGLAVSCFI 539
           SITGLEYAYSKAP +M+SFIMSIFLLT AFGSA+G ALS V+V+PKF W F+GLAV+CFI
Sbjct: 484 SITGLEYAYSKAPANMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFI 543

Query: 540 AGCLFWAFFHKYNDTEEAMNAIDYEEDDVLNYGVSIHYDLEPIASVNSD 588
           +GCLFW  F KYNDTEE MNA+DYEE+D         +DL PI+   ++
Sbjct: 544 SGCLFWLCFRKYNDTEEEMNAMDYEEED--------EFDLNPISQPKAN 584

>TPHA0N01960 Chr14 complement(418505..420280) [1776 bp, 591 aa] {ON}
           
          Length = 591

 Score =  823 bits (2127), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/534 (72%), Positives = 459/534 (85%)

Query: 54  PTDEEMKTLRHVSEQIPVRCWLVAVVELAERFSYYGLSAPFQNYMQNGPNDTPKGILNLK 113
           PT+EE+KTLRHVS  IP+RCWL+A+VELAERFSYYGLSAPFQNYM NGPNDTPKG+L L 
Sbjct: 57  PTEEELKTLRHVSGYIPLRCWLIAIVELAERFSYYGLSAPFQNYMANGPNDTPKGLLQLN 116

Query: 114 NQGATALSYFFQFWCYVSPLLGGFVADTYWGKYKTICVGTGIYVVGIFILFITSVPSITY 173
           + GATA+SYFFQFWCYV+P+ GG++ADT+WGKY TIC GTGIYV GIFILF+TS+ SIT 
Sbjct: 117 SSGATAISYFFQFWCYVTPIFGGYMADTHWGKYNTICTGTGIYVSGIFILFMTSIESITT 176

Query: 174 YSASLGGFITSLILIGLATGMIKANISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQN 233
            +A+ GG+I ++ILIG+ATGMIK+NISVLIA+Q+PK +  V     GERVIEDP +TVQN
Sbjct: 177 QNAARGGYIAAIILIGIATGMIKSNISVLIAEQVPKRKIRVITTSKGERVIEDPKLTVQN 236

Query: 234 IFMFFYLMINIGSLSVIATTEMEAHIGFWAAYLLPFCFFFVAVFVLILGRNQYVKLPVGD 293
           IFMFFYLMINIGSLSVIATTE+EAH GFWAAYLLPFCFF++AV VLI+G+ QYV+ PVGD
Sbjct: 237 IFMFFYLMINIGSLSVIATTELEAHKGFWAAYLLPFCFFWIAVVVLIVGKKQYVRKPVGD 296

Query: 294 KVISKSFKVCWIVMRNKFRFDAARPSLNPELGYPWSDKFIDEIKRAIAACKVFVFYPIYW 353
           KVISK F + WI  +NK  FD+A+PS +PE  YPW+DKF++E++RAI ACKVF+FYPIYW
Sbjct: 297 KVISKCFTITWIAFKNKLDFDSAKPSCHPEANYPWTDKFVEEVRRAIRACKVFLFYPIYW 356

Query: 354 VCYGQMLSNFVSQAGMMELHGLPNDFLQAIDSIALIVFIPICERFLYPFIRRFTPFRPIT 413
             YGQML+NFV+QAG MELHGLPNDFLQAIDSIA+IVFIPICE+FLYPFIR+FTPFR IT
Sbjct: 357 CVYGQMLNNFVTQAGTMELHGLPNDFLQAIDSIAIIVFIPICEKFLYPFIRKFTPFRSIT 416

Query: 414 KIFYGFIFGALAMAWAAVLQHFIYKAGPCYYYPMACAPEYKNTPNRIHIAWQVPAYVLIA 473
           KIF+GF+FG+ AM WAAVLQ FIYKAGPC+  P+ACA +Y +TPN++HIAWQVPAYVLIA
Sbjct: 417 KIFWGFMFGSAAMIWAAVLQSFIYKAGPCFDKPLACAAQYAHTPNQVHIAWQVPAYVLIA 476

Query: 474 FSEIFASITGLEYAYSKAPVSMRSFIMSIFLLTTAFGSALGIALSSVSVNPKFVWTFSGL 533
           FSEIFASITGLEYAYS AP SM+SFIMSIFLLTTAFGSALGIA+S  SV+PKF W F+GL
Sbjct: 477 FSEIFASITGLEYAYSNAPESMKSFIMSIFLLTTAFGSALGIAISPTSVDPKFTWAFTGL 536

Query: 534 AVSCFIAGCLFWAFFHKYNDTEEAMNAIDYEEDDVLNYGVSIHYDLEPIASVNS 587
           AVSCFIAGCLFW  F KYN+TE++M+ ID+ ++ V +        + P+ S  S
Sbjct: 537 AVSCFIAGCLFWICFRKYNNTEDSMDEIDFIDEKVTDMANKASSFISPVLSTKS 590

>TPHA0O02000 Chr15 complement(404570..406432) [1863 bp, 620 aa] {ON}
           
          Length = 620

 Score =  814 bits (2102), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/546 (68%), Positives = 451/546 (82%), Gaps = 7/546 (1%)

Query: 53  EPTDEEMKTLRHVSEQIPVRCWLVAVVELAERFSYYGLSAPFQNYMQNGPNDTPKGILNL 112
           EPT+EEM TL+HV+  IP RCWL+AVVEL+ERFSYYGLSAPFQNYM NGPNDTPKGIL L
Sbjct: 75  EPTEEEMATLKHVAGHIPYRCWLIAVVELSERFSYYGLSAPFQNYMANGPNDTPKGILQL 134

Query: 113 KNQGATALSYFFQFWCYVSPLLGGFVADTYWGKYKTICVGTGIYVVGIFILFITSVPSIT 172
              GAT LSYFFQFWCY++P+ GG++ADTYW KY TI VGT IY++GIFILFIT++PSI 
Sbjct: 135 NTNGATGLSYFFQFWCYITPIFGGYMADTYWNKYNTIAVGTVIYIIGIFILFITAIPSIA 194

Query: 173 YYSASLGGFITSLILIGLATGMIKANISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQ 232
               + GGF+T++ILIG+ TGMIKAN+SVL+A+QIPK +  V   K GERVIEDP+IT+Q
Sbjct: 195 TKETATGGFVTAIILIGIGTGMIKANLSVLVAEQIPKRKHRVITTKKGERVIEDPDITMQ 254

Query: 233 NIFMFFYLMINIGSLSVIATTEMEAHIGFWAAYLLPFCFFFVAVFVLILGRNQYVKLPVG 292
           N+FMFFYLMINIG+LSV+ATTE+E+H GFWAAYLLPFCFF++AV +L++GRN Y+  PVG
Sbjct: 255 NVFMFFYLMINIGALSVLATTELESHKGFWAAYLLPFCFFWIAVVILVMGRNSYIIKPVG 314

Query: 293 DKVISKSFKVCWIVMRNKFRFDAARPSLNPELGYPWSDKFIDEIKRAIAACKVFVFYPIY 352
           DKVISK FKV +IV +NKF FD+A+PSLNPE+ YPWSDKF+DEI R+I ACKVF+FYPIY
Sbjct: 315 DKVISKCFKVTFIVCKNKFNFDSAKPSLNPEMQYPWSDKFVDEINRSIKACKVFIFYPIY 374

Query: 353 WVCYGQMLSNFVSQAGMMELHGLPNDFLQAIDSIALIVFIPICERFLYPFIRRFTPFRPI 412
           W  YGQM++NF++QAG MELH +PNDFLQ  DSI +IVFIPI ERF+YP IRRFTP +PI
Sbjct: 375 WCVYGQMINNFITQAGTMELHNIPNDFLQVFDSIGIIVFIPIFERFVYPTIRRFTPLKPI 434

Query: 413 TKIFYGFIFGALAMAWAAVLQHFIYKAGPCYYYPMACAPEYKNTPNRIHIAWQVPAYVLI 472
           TKIF GF+ G+ AM WAAVLQ FIYKAGPCY +PMAC PEY N PNR+H+AWQ+PAYV+I
Sbjct: 435 TKIFLGFMCGSCAMVWAAVLQSFIYKAGPCYDHPMACGPEYTNIPNRVHVAWQIPAYVII 494

Query: 473 AFSEIFASITGLEYAYSKAPVSMRSFIMSIFLLTTAFGSALGIALSSVSVNPKFVWTFSG 532
           A+SEIFAS+TGLE+AYS AP SM++FIMSIFL T A G+ALG+A+S  SV+PK+ W F+G
Sbjct: 495 AWSEIFASVTGLEFAYSNAPDSMKAFIMSIFLFTNAIGAALGVAISPTSVDPKYTWVFTG 554

Query: 533 LAVSCFIAGCLFWAFFHKYNDTEEAMNAIDYEEDDVLNYGVSIHY-------DLEPIASV 585
           LAVSCF+AGCLFW  FH YND +  M AID+ EDD++N    +          +EPI S+
Sbjct: 555 LAVSCFVAGCLFWICFHHYNDIDADMKAIDFVEDDMINASGDVEKTASSGFSTVEPIISM 614

Query: 586 NSDKRI 591
            S K +
Sbjct: 615 RSAKSL 620

>KNAG0C06570 Chr3 (1273605..1275377) [1773 bp, 590 aa] {ON}
           Anc_5.698 YKR093W
          Length = 590

 Score =  810 bits (2092), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/581 (65%), Positives = 470/581 (80%), Gaps = 9/581 (1%)

Query: 12  ETEVVVTSSPENSVEKIARPESFVDVLDKNQYINADSDHGREPTDEEMKTLRHVSEQIPV 71
           + ++V+T    +++E+ +R    VD L  +QY +   +    PT+EE++TL+HV   IP+
Sbjct: 18  KNDLVLTKENSHTIEEDSR---IVDDL-ASQYEDDIPEGYEVPTEEELRTLKHVGGHIPM 73

Query: 72  RCWLVAVVELAERFSYYGLSAPFQNYMQNGPNDTPKGILNLKNQGATALSYFFQFWCYVS 131
           RCWL+AVVEL+ERFSYYGLSAPFQNYM NGP+D P G+L L + GAT LSYFFQFWCYV+
Sbjct: 74  RCWLIAVVELSERFSYYGLSAPFQNYMANGPHDKPPGLLQLNSDGATGLSYFFQFWCYVT 133

Query: 132 PLLGGFVADTYWGKYKTICVGTGIYVVGIFILFITSVPSITYYSASLGGFITSLILIGLA 191
           P+ GG++ADT+WGKY TI VGTGIY+ GIFILF+TS+PSIT  +A LGGFI ++ILIG+A
Sbjct: 134 PIFGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSIPSITTKNAGLGGFIVAIILIGIA 193

Query: 192 TGMIKANISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQNIFMFFYLMINIGSLSVIA 251
           TGMIK+N+SVLIADQ+PK +P VK  K+GERVIED N+T+QN+FMFFYLMINIGSLSVIA
Sbjct: 194 TGMIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMFFYLMINIGSLSVIA 253

Query: 252 TTEMEAHIGFWAAYLLPFCFFFVAVFVLILGRNQYVKLPVGDKVISKSFKVCWIVMRNKF 311
           T+E+E H GFWAAYLLPFCFF++AV VL+LG+NQYVK P+GDKVISK FKV WI+ +N+F
Sbjct: 254 TSELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIGDKVISKCFKVLWILTKNRF 313

Query: 312 RFDAARPSLNPELGYPWSDKFIDEIKRAIAACKVFVFYPIYWVCYGQMLSNFVSQAGMME 371
            FDA +PSLNP   YPWSDKF+DEI+RA+ ACKVF+FYPIYW CYGQM+S FV+Q  MME
Sbjct: 314 NFDAPKPSLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIYWTCYGQMMSGFVTQGSMME 373

Query: 372 LHGLPNDFLQAIDSIALIVFIPICERFLYPFIRRFTPFRPITKIFYGFIFGALAMAWAAV 431
           LHGLPNDF Q IDSIA+IVFIP+CE  LYPFIR++TPFRPITKI++GF+F +  M WAAV
Sbjct: 374 LHGLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPITKIYFGFMFASGCMIWAAV 433

Query: 432 LQHFIYKAGPCYYYPMACAPEYKNTPNRIHIAWQVPAYVLIAFSEIFASITGLEYAYSKA 491
           LQ +IYKAGP Y +P+       + PNRIH+A QVPAYVL+AFSEIFASITGLEYAYSKA
Sbjct: 434 LQSYIYKAGPHYKWPLE-----HDGPNRIHVALQVPAYVLLAFSEIFASITGLEYAYSKA 488

Query: 492 PVSMRSFIMSIFLLTTAFGSALGIALSSVSVNPKFVWTFSGLAVSCFIAGCLFWAFFHKY 551
           P SM+SFIMSIFL+T AFGSA+G ALS VS +P + W ++GLAV+CFI+GCLFW  F KY
Sbjct: 489 PASMKSFIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAVACFISGCLFWVCFRKY 548

Query: 552 NDTEEAMNAIDYEEDDVLNYGVSIHYDLEPIASVNSDKRIT 592
           ND EE MNA+DYE D  +   V I  D   +   +S+  ++
Sbjct: 549 NDIEEEMNAMDYEVDATMLKKVPIETDTVALEKGSSESVVS 589

>YKR093W Chr11 (615730..617535) [1806 bp, 601 aa] {ON}  PTR2Integral
           membrane peptide transporter, mediates transport of di-
           and tri-peptides; conserved protein that contains 12
           transmembrane domains; PTR2 expression is regulated by
           the N-end rule pathway via repression by Cup9p
          Length = 601

 Score =  810 bits (2092), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/573 (66%), Positives = 475/573 (82%), Gaps = 19/573 (3%)

Query: 22  ENSVEKIARPESFV--DVLDKNQYIN----ADSDHGREPTDEEMKTLRHVSEQIPVRCWL 75
           E   + +   +S+V  DV +  +  N     + +    PT+EEM+TLRHV  +IP+RCWL
Sbjct: 25  EEKTQAVTLKDSYVSDDVANSTERYNLSPSPEDEDFEGPTEEEMQTLRHVGGKIPMRCWL 84

Query: 76  VAVVELAERFSYYGLSAPFQNYMQNGPNDTPKGILNLKNQGATALSYFFQFWCYVSPLLG 135
           +A+VEL+ERFSYYGLSAPFQNYM+ GPND+PKG+L+L +QGAT LSYFFQFWCYV+P+ G
Sbjct: 85  IAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLSLNSQGATGLSYFFQFWCYVTPVFG 144

Query: 136 GFVADTYWGKYKTICVGTGIYVVGIFILFITSVPSITYYSASLGGFITSLILIGLATGMI 195
           G+VADT+WGKY TIC GT IY+ GIFILFITS+PS+    +++GGFI ++ILIG+ATGMI
Sbjct: 145 GYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSAIGGFIAAIILIGIATGMI 204

Query: 196 KANISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQNIFMFFYLMINIGSLSVIATTEM 255
           KAN+SVLIADQ+PK +P++KVLKSGERVI D NIT+QN+FMFFY MIN+GSLS++ATTE+
Sbjct: 205 KANLSVLIADQLPKRKPSIKVLKSGERVIVDSNITLQNVFMFFYFMINVGSLSLMATTEL 264

Query: 256 EAHIGFWAAYLLPFCFFFVAVFVLILGRNQYVKLPVGDKVISKSFKVCWIVMRNKFRFDA 315
           E H GFWAAYLLPFCFF++AV  LI G+ QY++ P+GDKVI+KSFKVCWI+ +NKF F+A
Sbjct: 265 EYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVIAKSFKVCWILTKNKFDFNA 324

Query: 316 ARPSLNPELGYPWSDKFIDEIKRAIAACKVFVFYPIYWVCYGQMLSNFVSQAGMMELHGL 375
           A+PS++PE  YPW+DKF+DEIKRA+AACKVF+FYPIYW  YG M+S+F++QA MMELHG+
Sbjct: 325 AKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELHGI 384

Query: 376 PNDFLQAIDSIALIVFIPICERFLYPFIRRFTPFRPITKIFYGFIFGALAMAWAAVLQHF 435
           PNDFLQA DSIALI+FIPI E+F+YPFIRR+TP +PITKIF+GF+FG+ AM WAAVLQ F
Sbjct: 385 PNDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLKPITKIFFGFMFGSFAMTWAAVLQSF 444

Query: 436 IYKAGPCYYYPMACAPEYKNTPNRIHIAWQVPAYVLIAFSEIFASITGLEYAYSKAPVSM 495
           +YKAGP Y  P+       NTPN +H+ WQ+PAYVLI+FSEIFASITGLEYAYSKAP SM
Sbjct: 445 VYKAGPWYNEPLG-----HNTPNHVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASM 499

Query: 496 RSFIMSIFLLTTAFGSALGIALSSVSVNPKFVWTFSGLAVSCFIAGCLFWAFFHKYNDTE 555
           +SFIMSIFLLT AFGSA+G ALS V+V+PKF W F+GLAV+CFI+GCLFW  F KYNDTE
Sbjct: 500 KSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKYNDTE 559

Query: 556 EAMNAIDYEEDDVLNYGVSIHYDLEPIASVNSD 588
           E MNA+DYEE+D         +DL PI++  ++
Sbjct: 560 EEMNAMDYEEED--------EFDLNPISAPKAN 584

>ZYRO0G06688g Chr7 complement(535282..537123) [1842 bp, 613 aa] {ON}
           similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 613

 Score =  810 bits (2091), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/557 (69%), Positives = 461/557 (82%), Gaps = 15/557 (2%)

Query: 38  LDKNQYINADSDHGREPTDEEMKTLRHVSEQIPVRCWLVAVVELAERFSYYGLSAPFQNY 97
           LD ++Y   + D   EPT+EE+++LRHV   IP RCWL+A+VEL+ERFSYYGLSAPFQNY
Sbjct: 34  LDFDEYEVPNDD---EPTEEELRSLRHVGGHIPFRCWLIAIVELSERFSYYGLSAPFQNY 90

Query: 98  MQNGPNDTPKGILNLKNQGATALSYFFQFWCYVSPLLGGFVADTYWGKYKTICVGTGIYV 157
           MQNG +D P G+L+LK+QGAT L+YFFQFWCYV+P+ GG++ADTYWGKY+TICVGTG+YV
Sbjct: 91  MQNGKHDNPAGVLDLKSQGATGLAYFFQFWCYVTPVFGGWLADTYWGKYETICVGTGVYV 150

Query: 158 VGIFILFITSVPSITYYSASLGGFITSLILIGLATGMIKANISVLIADQIPKSRPTVKVL 217
           VGIFILFITS+PS+   + +LGGFIT+++LIG+ATGMIKAN+SVLIADQ PK +P +K  
Sbjct: 151 VGIFILFITSLPSVDSKNTALGGFITAIVLIGIATGMIKANLSVLIADQFPKRKPRIKTT 210

Query: 218 KSGERVIEDPNITVQNIFMFFYLMINIGSLSVIATTEMEAHIGFWAAYLLPFCFFFVAVF 277
           K GERVIEDPNIT+QN+FMFFYLMINIGSLSVIATTE+E H GFWAAYLLPFCFF++AV 
Sbjct: 211 KRGERVIEDPNITIQNVFMFFYLMINIGSLSVIATTELEEHKGFWAAYLLPFCFFWIAVI 270

Query: 278 VLILGRNQYVKLPVGDKVISKSFKVCWIVMRNKFRFDAARPSLNPELGYPWSDKFIDEIK 337
           VL +GR  YV+ PVGDKVI+KSF+V   +++++F ++A +PS++PE  YPW+D F++EIK
Sbjct: 271 VLFVGRKSYVRPPVGDKVIAKSFRVLGQLIKHRFDYEAVKPSVHPERDYPWNDHFVEEIK 330

Query: 338 RAIAACKVFVFYPIYWVCYGQMLSNFVSQAGMMELHGLPNDFLQAIDSIALIVFIPICER 397
           RA+ ACKVF+FYPIYWV YGQM S FVS  G M+LHGLPNDF QAIDSIALIVFIPICE 
Sbjct: 331 RALKACKVFMFYPIYWVPYGQMTSTFVSVGGEMQLHGLPNDFFQAIDSIALIVFIPICEY 390

Query: 398 FLYPFIRRFTPFRPITKIFYGFIFGALAMAWAAVLQHFIYKAGPCYYYPMACAPEYKNTP 457
           +LYPFIRR+TPF+PITKIF+GF++ + +M WAAVLQHFIYK GPCY +PM C     N P
Sbjct: 391 WLYPFIRRYTPFKPITKIFFGFMWCSASMIWAAVLQHFIYKTGPCYDHPMDCP----NGP 446

Query: 458 NRIHIAWQVPAYVLIAFSEIFASITGLEYAYSKAPVSMRSFIMSIFLLTTAFGSALGIAL 517
           N IHI WQVPAYVLIAFSEIFASITGLEYAYSKAP SM+SFIMSIFLLT AFGSA+G AL
Sbjct: 447 NNIHIGWQVPAYVLIAFSEIFASITGLEYAYSKAPTSMKSFIMSIFLLTNAFGSAIGCAL 506

Query: 518 SSVSVNPKFVWTFSGLAVSCFIAGCLFWAFFHKYNDTEEAMNAIDYEE-----DDVLNYG 572
           S V  +PK++W F+GLAV+ FI+GCLFW  FH  NDTEE MNA+DYEE     DD L  G
Sbjct: 507 SPVDTDPKYLWMFTGLAVASFISGCLFWLTFHHLNDTEEEMNAMDYEENQEKIDDGLQKG 566

Query: 573 VSIHYDLEPIASVNSDK 589
            S   DLE   +   DK
Sbjct: 567 TS---DLEFEPAGADDK 580

>Smik_11.356 Chr11 (605836..607644) [1809 bp, 602 aa] {ON} YKR093W
           (REAL)
          Length = 602

 Score =  807 bits (2085), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/555 (68%), Positives = 463/555 (83%), Gaps = 11/555 (1%)

Query: 22  ENSVEKIARPESFV--DVLDKNQYIN----ADSDHGREPTDEEMKTLRHVSEQIPVRCWL 75
           E     +   +S+V  DV +  +  N     + +    PT+EE KTLRHV  +IP+RCWL
Sbjct: 25  EEKTHAVTLKDSYVSDDVANSTEQYNLSHSPEDEDFEAPTEEETKTLRHVGGKIPMRCWL 84

Query: 76  VAVVELAERFSYYGLSAPFQNYMQNGPNDTPKGILNLKNQGATALSYFFQFWCYVSPLLG 135
           +A+VEL+ERFSYYGLSAPFQNYM+ GPND+PKG+L L +QGAT LSYFFQFWCYV+P+ G
Sbjct: 85  IAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLGLNSQGATGLSYFFQFWCYVTPVFG 144

Query: 136 GFVADTYWGKYKTICVGTGIYVVGIFILFITSVPSITYYSASLGGFITSLILIGLATGMI 195
           G+VADT+WGKY TIC GT IY+ GIFILFITS+PS+    +++GGFI ++ILIG+ATGMI
Sbjct: 145 GYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSAIGGFIAAIILIGIATGMI 204

Query: 196 KANISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQNIFMFFYLMINIGSLSVIATTEM 255
           KANISVLIADQ+PK +P +KVLKSGERVI D NIT+QN+FMFFY MIN+GSLS++ATTE+
Sbjct: 205 KANISVLIADQLPKRKPFIKVLKSGERVIVDSNITLQNVFMFFYFMINVGSLSLMATTEL 264

Query: 256 EAHIGFWAAYLLPFCFFFVAVFVLILGRNQYVKLPVGDKVISKSFKVCWIVMRNKFRFDA 315
           E H GFWAAYLLPFCFF++AV  LI G+ QY++ P+GDKV++KSF+VCWI+ +NKF F+A
Sbjct: 265 EYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVVAKSFRVCWILTKNKFDFNA 324

Query: 316 ARPSLNPELGYPWSDKFIDEIKRAIAACKVFVFYPIYWVCYGQMLSNFVSQAGMMELHGL 375
           A+PS++PE  YPW+DKF+DEIKRA+AACKVFVFYPIYW  YG M+S+F++QA MMELHG+
Sbjct: 325 AKPSVHPEENYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGTMISSFITQASMMELHGI 384

Query: 376 PNDFLQAIDSIALIVFIPICERFLYPFIRRFTPFRPITKIFYGFIFGALAMAWAAVLQHF 435
           PNDFLQA DSIALIVFIPI E+F+YPFIRR+TP +PITKIF+GF+FG+ AM WAAVLQ F
Sbjct: 385 PNDFLQAFDSIALIVFIPIFEKFVYPFIRRYTPLKPITKIFFGFMFGSFAMTWAAVLQSF 444

Query: 436 IYKAGPCYYYPMACAPEYKNTPNRIHIAWQVPAYVLIAFSEIFASITGLEYAYSKAPVSM 495
           +YKAGP Y  P+       NTPN IH+ WQ+PAYVLI+FSEIFASITGLEYAYSKAP SM
Sbjct: 445 VYKAGPWYNEPLG-----HNTPNHIHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASM 499

Query: 496 RSFIMSIFLLTTAFGSALGIALSSVSVNPKFVWTFSGLAVSCFIAGCLFWAFFHKYNDTE 555
           +SFIMSIFLLT AFGSA+G ALS V+V+PKF W F+GLAV+CFI+GCLFW  F KYNDTE
Sbjct: 500 KSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKYNDTE 559

Query: 556 EAMNAIDYEEDDVLN 570
           E MNA+DYEEDD  +
Sbjct: 560 EEMNAMDYEEDDEFD 574

>NDAI0E05020 Chr5 (1146336..1148195) [1860 bp, 619 aa] {ON}
           Anc_5.698
          Length = 619

 Score =  808 bits (2086), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/560 (68%), Positives = 452/560 (80%), Gaps = 10/560 (1%)

Query: 10  KTETEVVVTSSPE--NSVEKIARPESFVDVLDKNQYINADSDHG-REPTDEEMKTLRHVS 66
           K ET    +S+ E  + VE      S  D    N + + + + G  EPTDEE+ TL+ V 
Sbjct: 30  KKETNATTSSTEEKLHDVETYNLSNSAND--STNDFDDDEMEEGYEEPTDEELNTLKRVG 87

Query: 67  EQIPVRCWLVAVVELAERFSYYGLSAPFQNYMQNGPNDTPKGILNLKNQGATALSYFFQF 126
            +IP+RCWL+ VVELAERFSYYGLSAPFQNYMQNGPND+PKG+L L + GAT LSYFFQF
Sbjct: 88  GKIPLRCWLIGVVELAERFSYYGLSAPFQNYMQNGPNDSPKGVLMLNSSGATGLSYFFQF 147

Query: 127 WCYVSPLLGGFVADTYWGKYKTICVGTGIYVVGIFILFITSVPSITYYSASLGGFITSLI 186
           WCYV+P+ GGFVADTYWGKY +I VGTG Y+VGIFILFIT++PSI   +ASLGGFI S+I
Sbjct: 148 WCYVTPVFGGFVADTYWGKYNSISVGTGFYIVGIFILFITAIPSIASQNASLGGFIVSII 207

Query: 187 LIGLATGMIKANISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQNIFMFFYLMINIGS 246
           LIG+ TG IKAN+SVLIADQ+PK +P VK+LKSGERVIEDPNIT+QN+FM FYLMINIGS
Sbjct: 208 LIGIGTGFIKANLSVLIADQLPKRKPRVKILKSGERVIEDPNITLQNVFMVFYLMINIGS 267

Query: 247 LSVIATTEMEAHIGFWAAYLLPFCFFFVAVFVLILGRNQYVKLPVGDKVISKSFKVCWIV 306
           +SV+ATTE+E+H GFWAAYLLPFCFF++AV +L+ GR  YVK  +GD V+ KSFKVCWIV
Sbjct: 268 MSVMATTELESHKGFWAAYLLPFCFFWIAVVILVFGRKYYVKEKMGDNVVQKSFKVCWIV 327

Query: 307 MRNKFRFDAARPSLNPELGYPWSDKFIDEIKRAIAACKVFVFYPIYWVCYGQMLSNFVSQ 366
            +NK  ++AA+PS +PE  YPW+D+F+DE+KR IAACKVFVFYPIYWV YG M+S FV+Q
Sbjct: 328 AKNKLDYNAAKPSYHPERNYPWNDRFVDEMKRTIAACKVFVFYPIYWVQYGSMISTFVTQ 387

Query: 367 AGMMELHGLPNDFLQAIDSIALIVFIPICERFLYPFIRRFTPFRPITKIFYGFIFGALAM 426
              MELHG+PNDFLQ  DSIALI+FIPI E F+YPFIRRFTP RPITKI  GF  G  AM
Sbjct: 388 GSTMELHGIPNDFLQVFDSIALIIFIPIFENFVYPFIRRFTPIRPITKITIGFFVGGCAM 447

Query: 427 AWAAVLQHFIYKAGPCYYYPMACAPEYKNTPNRIHIAWQVPAYVLIAFSEIFASITGLEY 486
            WAAVLQHFIY  GPCY +P++C     +TPN+IH+AWQ+PAYVLIAFSEIFASITGLEY
Sbjct: 448 TWAAVLQHFIYNTGPCYDHPLSC-----DTPNKIHVAWQIPAYVLIAFSEIFASITGLEY 502

Query: 487 AYSKAPVSMRSFIMSIFLLTTAFGSALGIALSSVSVNPKFVWTFSGLAVSCFIAGCLFWA 546
           AYSKAP SM+SF+MSIFLLT AFGS LGIALSSV+V+PKFVW F GLAVSC + G LFW 
Sbjct: 503 AYSKAPPSMKSFVMSIFLLTNAFGSILGIALSSVTVDPKFVWLFGGLAVSCGVTGILFWL 562

Query: 547 FFHKYNDTEEAMNAIDYEED 566
            F   N TEE MNA+DY+ +
Sbjct: 563 CFRGLNATEEEMNAMDYDAE 582

>TDEL0B02230 Chr2 complement(402022..403746) [1725 bp, 574 aa] {ON}
           Anc_5.698 YKR093W
          Length = 574

 Score =  804 bits (2076), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/565 (69%), Positives = 469/565 (83%), Gaps = 13/565 (2%)

Query: 9   NKTETEVVVTSSPENSVEKIARPE----SFVDVLDKNQYINADSDHGREPTDEEMKTLRH 64
            +TET    ++   +SVEK    E      V+V+  +  +  +S +  EPT+EEMKTL+H
Sbjct: 2   KRTETS---STDGVDSVEKQKAVEVVDDKLVEVISSHNGLEVES-YDDEPTEEEMKTLKH 57

Query: 65  VSEQIPVRCWLVAVVELAERFSYYGLSAPFQNYMQNGPNDTPKGILNLKNQGATALSYFF 124
           V+  IP RCWL+AVVEL+ERF+YYGLS PFQNYMQNGP+DTP G+LNLK+QGAT LSYFF
Sbjct: 58  VAGTIPFRCWLIAVVELSERFAYYGLSTPFQNYMQNGPDDTPAGLLNLKSQGATGLSYFF 117

Query: 125 QFWCYVSPLLGGFVADTYWGKYKTICVGTGIYVVGIFILFITSVPSITYYSASLGGFITS 184
           QFWCYV+P+ GG+++DTY GKY TIC GTG+YV+GI ILF+TS+PSIT  +A+ GGFI +
Sbjct: 118 QFWCYVTPIFGGWLSDTYIGKYNTICWGTGVYVIGILILFVTSIPSITTQNAATGGFIAA 177

Query: 185 LILIGLATGMIKANISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQNIFMFFYLMINI 244
           +ILIG+ATGMIK+NISVLIADQ PK R  V   K G RVIEDPNIT+QN+FM FYLMINI
Sbjct: 178 IILIGIATGMIKSNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQNVFMIFYLMINI 237

Query: 245 GSLSVIATTEMEAHIGFWAAYLLPFCFFFVAVFVLILGRNQYVKLPVGDKVISKSFKVCW 304
           GSLSVIATTE+EAH+GFWAAYLLPFCFF++AV VL +G+N YVK PVGDKVISK FKV  
Sbjct: 238 GSLSVIATTELEAHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVGDKVISKCFKVVG 297

Query: 305 IVMRNKFRFDAARPSLNPELGYPWSDKFIDEIKRAIAACKVFVFYPIYWVCYGQMLSNFV 364
           I ++NKF F+AA+PS++P+  +PW+DKF+DEI R+++ACKVF+FYP+YWVCYGQML+ FV
Sbjct: 298 IAIKNKFNFEAAKPSVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVYWVCYGQMLNTFV 357

Query: 365 SQAGMMELHGLPNDFLQAIDSIALIVFIPICERFLYPFIRRFTPFRPITKIFYGFIFGAL 424
           S  G MELHGLPNDF QAIDSIALIVFIPICE FLYP+IR+FTPFRPITKIF+GF+FGA 
Sbjct: 358 SVGGTMELHGLPNDFFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPITKIFWGFMFGAA 417

Query: 425 AMAWAAVLQHFIYKAGPCYYYPMACAPEYKNTPNRIHIAWQVPAYVLIAFSEIFASITGL 484
           AM WAAVLQHFIYK+GP Y YPMA     +NTPN IHIAWQVPAYVLIAFSEIFASITGL
Sbjct: 418 AMVWAAVLQHFIYKSGPWYKYPMA-----ENTPNHIHIAWQVPAYVLIAFSEIFASITGL 472

Query: 485 EYAYSKAPVSMRSFIMSIFLLTTAFGSALGIALSSVSVNPKFVWTFSGLAVSCFIAGCLF 544
           EYAYSKAPV+M+SFIM+IFLLT AFGSA+G ALS V+ +P +VW + GL V+CF AG LF
Sbjct: 473 EYAYSKAPVTMKSFIMAIFLLTNAFGSAIGCALSPVTKDPDYVWLYVGLGVACFAAGWLF 532

Query: 545 WAFFHKYNDTEEAMNAIDYEEDDVL 569
           W  F  YNDTEEAMNA+DY+ED  +
Sbjct: 533 WFCFKHYNDTEEAMNALDYDEDPTM 557

>TBLA0A09120 Chr1 complement(2259486..2261387) [1902 bp, 633 aa]
           {ON} Anc_5.698 YKR093W
          Length = 633

 Score =  801 bits (2069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/534 (69%), Positives = 449/534 (84%), Gaps = 6/534 (1%)

Query: 59  MKTLRHVSEQIPVRCWLVAVVELAERFSYYGLSAPFQNYMQNGPNDTPKGILNLKNQGAT 118
           ++TL+HV  +IP+RCWL+AV+ELAERFSYYGLSAPFQNYMQNGPND+P G L+L + GAT
Sbjct: 88  LRTLKHVGGKIPLRCWLMAVIELAERFSYYGLSAPFQNYMQNGPNDSPPGALSLDSSGAT 147

Query: 119 ALSYFFQFWCYVSPLLGGFVADTYWGKYKTICVGTGIYVVGIFILFITSVPSITYYSASL 178
            LSYFFQFWCY++P+  G++ADTYWGK+ TIC+GTGIY+VGIFILFITS+PSIT ++ ++
Sbjct: 148 GLSYFFQFWCYLTPVFAGYMADTYWGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAM 207

Query: 179 GGFITSLILIGLATGMIKANISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQNIFMFF 238
           GGFI +LIL+G+ATGMIKAN+SV+IA+QIPK +  V   K+G RVIEDP+IT+QN+FM F
Sbjct: 208 GGFIVTLILVGIATGMIKANLSVMIAEQIPKRKRRVITKKNGTRVIEDPDITIQNVFMTF 267

Query: 239 YLMINIGSLSVIATTEMEAHIGFWAAYLLPFCFFFVAVFVLILGRNQYVKLPVGDKVISK 298
           Y MINIGSLSVIATTE+EAH GFWAAYLLPFCFF+VAV VLI+G   Y+K PVGDKVISK
Sbjct: 268 YFMINIGSLSVIATTELEAHKGFWAAYLLPFCFFWVAVIVLIVGNKTYIKTPVGDKVISK 327

Query: 299 SFKVCWIVMRNKFRFDAARPSLNPELGYPWSDKFIDEIKRAIAACKVFVFYPIYWVCYGQ 358
            FKV  I+MRN+F  D+A+P+ NP+  YPWSDKF+DEI RA+ ACKVFVFYPIYWVCYGQ
Sbjct: 328 CFKVLRILMRNRFNPDSAKPAFNPDKNYPWSDKFVDEIMRALQACKVFVFYPIYWVCYGQ 387

Query: 359 MLSNFVSQAGMMELHGLPNDFLQAIDSIALIVFIPICERFLYPFIRRFTPFRPITKIFYG 418
           ML+NFVSQ G MELHGLPNDF QAIDSIALIVFIPICERF+YPFIR++TPF+PITKIF+G
Sbjct: 388 MLNNFVSQGGTMELHGLPNDFFQAIDSIALIVFIPICERFVYPFIRKYTPFKPITKIFWG 447

Query: 419 FIFGALAMAWAAVLQHFIYKAGPCYYYPMACAPEYKNTPNRIHIAWQVPAYVLIAFSEIF 478
           F FGAL+M WA VLQHFIYKA PCY +P  C     N PN IH+A QVPAY L+A SEIF
Sbjct: 448 FTFGALSMTWACVLQHFIYKAAPCYDHPSKC----DNGPNHIHVALQVPAYCLLALSEIF 503

Query: 479 ASITGLEYAYSKAPVSMRSFIMSIFLLTTAFGSALGIALSSVSVNPKFVWTFSGLAVSCF 538
           ASITGLEYAYSKAP SM++FIMSIFL+T AFG+A+G ALS VS +PK+VW + GLAV+CF
Sbjct: 504 ASITGLEYAYSKAPASMKAFIMSIFLVTNAFGAAIGCALSPVSKDPKYVWLYGGLAVACF 563

Query: 539 IAGCLFWAFFHKYNDTEEAMNAIDYEE-DDVLNYGVSIHYDL-EPIASVNSDKR 590
           + GCLFW  F KYND EE +N +D+EE DD+L    +   ++ +PI+S  S  +
Sbjct: 564 VGGCLFWIIFKKYNDMEEELNNLDFEEGDDMLETKHAGDIEMIQPISSRRSSLK 617

>CAGL0G02453g Chr7 (218003..219796) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093w PTR2
          Length = 597

 Score =  799 bits (2063), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/590 (66%), Positives = 474/590 (80%), Gaps = 15/590 (2%)

Query: 9   NKTETEVVVTSSPENSVEKIARPESF-VDVLDKNQYINADS-------DHGREPTDEEMK 60
           N  E +  V+S  +NS +++   E   +  LD+++  NA+S       D    PT+EE+K
Sbjct: 13  NAVEVQKDVSSIDDNSSKEVYEIEDQEIHHLDRDKS-NAESNFALGEDDDFEAPTEEELK 71

Query: 61  TLRHVSEQIPVRCWLVAVVELAERFSYYGLSAPFQNYMQNGPNDTPKGILNLKNQGATAL 120
           TLRHV+  IP+RCWL+A+VEL+ERFSYYGLSAPFQNYMQNGPND PKG+L LK+QGAT L
Sbjct: 72  TLRHVAGHIPLRCWLIAIVELSERFSYYGLSAPFQNYMQNGPNDNPKGLLGLKSQGATGL 131

Query: 121 SYFFQFWCYVSPLLGGFVADTYWGKYKTICVGTGIYVVGIFILFITSVPSITYYSASLGG 180
           SYFFQFWCYV+P+ GG+V+DTYWGKY TICVGT IYV GIFILFITS+P +T    +LGG
Sbjct: 132 SYFFQFWCYVTPVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFITSIPGVTNSDGALGG 191

Query: 181 FITSLILIGLATGMIKANISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQNIFMFFYL 240
           FI ++ILIG+ATGMIK+N+SVLIADQ+P  +P V + K GERVIEDPN+T+QN+FMFFY 
Sbjct: 192 FIAAIILIGIATGMIKSNLSVLIADQLPNKKPRVVITKKGERVIEDPNLTLQNVFMFFYF 251

Query: 241 MINIGSLSVIATTEMEAHIGFWAAYLLPFCFFFVAVFVLILGRNQYVKLPVGDKVISKSF 300
            IN+GSLSV+ATTE+E H GFWAAYLLPFCFF+VAV VL+ GRNQY+K PVGDKVISKSF
Sbjct: 252 TINVGSLSVMATTELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQYIKPPVGDKVISKSF 311

Query: 301 KVCWIVMRNKFRFDAARPSLNPELGYPWSDKFIDEIKRAIAACKVFVFYPIYWVCYGQML 360
           KV +I+ +NKF  +AA+PS NP+  +PWSDKF+DEIKRA+ ACKVFVFYP+YWVCYG ML
Sbjct: 312 KVLYILSKNKFNAEAAKPSFNPDKNFPWSDKFVDEIKRALQACKVFVFYPVYWVCYGTML 371

Query: 361 SNFVSQAGMMELHGLPNDFLQAIDSIALIVFIPICERFLYPFIRRFTPFRPITKIFYGFI 420
           +NFV+Q G MELH LPNDFLQA DSIALI+FIPI ERF+YPFIRR+TP RPITKIF+GF+
Sbjct: 372 NNFVTQGGTMELHNLPNDFLQAFDSIALIIFIPIFERFVYPFIRRYTPLRPITKIFFGFM 431

Query: 421 FGALAMAWAAVLQHFIYKAGPCYYYPMACAPEYKNTPNRIHIAWQVPAYVLIAFSEIFAS 480
            G+ AM WAAVLQHFIY  GP Y +P+       +TPN IH+AWQ+PAYVLIA SEIFAS
Sbjct: 432 VGSGAMVWAAVLQHFIYTKGPWYDHPLD-----HDTPNHIHVAWQIPAYVLIAISEIFAS 486

Query: 481 ITGLEYAYSKAPVSMRSFIMSIFLLTTAFGSALGIALSSVSVNPKFVWTFSGLAVSCFIA 540
           ITGLEYAYSKAP SM+SFIMSIFLLT AFGSA+G ALS VSV+PKFVW ++GLA +CFIA
Sbjct: 487 ITGLEYAYSKAPESMKSFIMSIFLLTNAFGSAIGCALSPVSVDPKFVWFYTGLACACFIA 546

Query: 541 GCLFWAFFHKYNDTEEAMNAIDYEEDDVL-NYGVSIHYDLEPIASVNSDK 589
           G +FW  +   ND EEAMNA+DYE D+ +  +        E + S+ S+K
Sbjct: 547 GWVFWFIYSGLNDEEEAMNALDYEHDEFMYKHHSDDEEAAEHVRSIKSEK 596

>NCAS0A03220 Chr1 complement(635016..636851) [1836 bp, 611 aa] {ON}
           Anc_5.698
          Length = 611

 Score =  789 bits (2038), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/592 (65%), Positives = 465/592 (78%), Gaps = 19/592 (3%)

Query: 11  TETEVV-VTSSPENSVEKIARPE---SFVDVLDKNQYINADSDHGREP-----TDEEMKT 61
           TE E V ++   +   ++I   E   S  +V D+ +  +   D   EP     T+E+M+T
Sbjct: 16  TEKETVDISEKAQEKTQEITLKETTGSSEEVHDELETYHIHHDEECEPGYEIPTEEDMET 75

Query: 62  LRHVSEQIPVRCWLVAVVELAERFSYYGLSAPFQNYMQNGPNDTPKGILNLKNQGATALS 121
           LRHVS +IP+RCWL+A+VELAERFSYYGLSAPFQNYM+NGPNDTP G+L L + GAT LS
Sbjct: 76  LRHVSGKIPLRCWLIALVELAERFSYYGLSAPFQNYMENGPNDTPAGVLELNSSGATGLS 135

Query: 122 YFFQFWCYVSPLLGGFVADTYWGKYKTICVGTGIYVVGIFILFITSVPSITYYSASLGGF 181
           YFFQFWCYV+P+ GGF+ADTYWGKY TICVGTGIY+ GIFILFITS+PSI     SLGGF
Sbjct: 136 YFFQFWCYVTPVFGGFMADTYWGKYNTICVGTGIYLAGIFILFITSIPSIASKDTSLGGF 195

Query: 182 ITSLILIGLATGMIKANISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQNIFMFFYLM 241
           I ++ILIG+ATGMIKAN+SVLIADQ+PK +P VK LKSGERV+EDPNIT+QN+FM+FYLM
Sbjct: 196 IAAIILIGIATGMIKANLSVLIADQLPKRKPRVKTLKSGERVVEDPNITLQNVFMWFYLM 255

Query: 242 INIGSLSVIATTEMEAHIGFWAAYLLPFCFFFVAVFVLILGRNQYVKLPVGDKVISKSFK 301
           +N+GSLSVIATTE+E H  FWAA+LLPFCFF++AV VL+ GRNQYVK    +K I KSFK
Sbjct: 256 VNVGSLSVIATTELEEHKNFWAAFLLPFCFFWIAVVVLVGGRNQYVKEGKREKSIQKSFK 315

Query: 302 VCWIVMRNKFRFDAARPSLNPELGYPWSDKFIDEIKRAIAACKVFVFYPIYWVCYGQMLS 361
           + WIV +NKF   +A+PS +PE  YPW+DKF+DE  RA++ACKVF+FYPIYWV YG M+S
Sbjct: 316 ILWIVSKNKFDLTSAKPSYHPEKNYPWTDKFVDECSRALSACKVFLFYPIYWVIYGTMIS 375

Query: 362 NFVSQAGMMELHGLPNDFLQAIDSIALIVFIPICERFLYPFIRRFTPFRPITKIFYGFIF 421
            FV+Q  MMELHGLPND  QAIDS ALI+FIPICERF+YPFIRRFTPF+PITKIF+GF+F
Sbjct: 376 TFVTQGSMMELHGLPNDIFQAIDSFALIIFIPICERFIYPFIRRFTPFKPITKIFFGFMF 435

Query: 422 GALAMAWAAVLQHFIYKAGPCYYYPMACAPEYKNTPNRIHIAWQVPAYVLIAFSEIFASI 481
              AM W+ VLQ FIYKAGP Y +P+         PNRIH+ WQVPAYVLIAFSEI ASI
Sbjct: 436 ATGAMVWSCVLQSFIYKAGPYYDHPLNGG-----GPNRIHVGWQVPAYVLIAFSEILASI 490

Query: 482 TGLEYAYSKAPVSMRSFIMSIFLLTTAFGSALGIALSSVSVNPKFVWTFSGLAVSCFIAG 541
           TGLEYAYSKAP+SM+SFIMS+FL + A GS LGIALS VSV+PKF W F GL V+CFI G
Sbjct: 491 TGLEYAYSKAPMSMKSFIMSLFLFSNAGGSILGIALSPVSVDPKFTWLFGGLGVACFIGG 550

Query: 542 CLFWAFFHKYNDTEEAMNAIDYE-EDDVLNYGVSIHYDLEPIASVNSDKRIT 592
           C+FW  F KYNDTEE MNA+DYE E+D+     +   DLE    +NS + +T
Sbjct: 551 CIFWIIFRKYNDTEEEMNAMDYEDEEDLREMESAGANDLE----LNSTQSLT 598

>TBLA0E01140 Chr5 complement(250628..252463) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  768 bits (1982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/535 (66%), Positives = 433/535 (80%), Gaps = 4/535 (0%)

Query: 53  EPTDEEMKTLRHVSEQIPVRCWLVAVVELAERFSYYGLSAPFQNYMQNGPNDTPKGILNL 112
           EPT+EEM+TL+ V   IP RCWL+AV+EL+ERFSYYGLSAPFQNYMQNGP DTP G L+L
Sbjct: 70  EPTEEEMRTLKRVGGYIPARCWLMAVIELSERFSYYGLSAPFQNYMQNGPYDTPPGALSL 129

Query: 113 KNQGATALSYFFQFWCYVSPLLGGFVADTYWGKYKTICVGTGIYVVGIFILFITSVPSIT 172
             QGAT LSYFFQFWCY++P+ GG++ADTYWGKY TI VG   Y+ GIFILF+TS+P +T
Sbjct: 130 NTQGATGLSYFFQFWCYITPIFGGYMADTYWGKYNTIWVGVISYICGIFILFMTSLPKLT 189

Query: 173 YYSASLGGFITSLILIGLATGMIKANISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQ 232
            YSA++GGFI S+I+IGL TGMIKAN+SV+IA+Q+PK +  +   K G RVIEDP+IT+Q
Sbjct: 190 SYSAAMGGFIVSIIIIGLGTGMIKANLSVMIAEQVPKRKRRIITRKDGTRVIEDPDITLQ 249

Query: 233 NIFMFFYLMINIGSLSVIATTEMEAHIGFWAAYLLPFCFFFVAVFVLILGRNQYVKLPVG 292
           N+FM FY MIN+GSLSV+ATTE+EA  GFWAAYLLPFCFF+VAV VL++G  +++K+P+G
Sbjct: 250 NVFMAFYFMINVGSLSVMATTELEARKGFWAAYLLPFCFFWVAVVVLMIGNKRFIKVPIG 309

Query: 293 DKVISKSFKVCWIVMRNKFRFDAARPSLNPELGYPWSDKFIDEIKRAIAACKVFVFYPIY 352
           DK ISKSFKV  I+++NKF +++A+PS++PE  YPW+DKF++EI+RAI AC VF FYPIY
Sbjct: 310 DKTISKSFKVVGILIKNKFNYESAKPSIHPECNYPWTDKFVEEIRRAIKACNVFYFYPIY 369

Query: 353 WVCYGQMLSNFVSQAGMMELHGLPNDFLQAIDSIALIVFIPICERFLYPFIRRFTPFRPI 412
           WVCYGQML+NFV+Q G MELH LPNDFLQ IDSIALIVFIPICER +YPF+RRFTP RPI
Sbjct: 370 WVCYGQMLNNFVTQGGQMELHDLPNDFLQVIDSIALIVFIPICERLIYPFVRRFTPLRPI 429

Query: 413 TKIFYGFIFGALAMAWAAVLQHFIYKAGPCYYYPMACAPEYKNTPNRIHIAWQVPAYVLI 472
           TKI  GF FG+ +M WAAVLQ F+Y+  PCYY+P  C     N PN IH+ WQVPAY LI
Sbjct: 430 TKITIGFFFGSFSMVWAAVLQWFVYQKPPCYYHPTNCP----NGPNHIHVCWQVPAYCLI 485

Query: 473 AFSEIFASITGLEYAYSKAPVSMRSFIMSIFLLTTAFGSALGIALSSVSVNPKFVWTFSG 532
           A SEIFASITGLEYAYSKAP SM+SFIMSIFL TTA GSALG ALS VS++PKF W + G
Sbjct: 486 ALSEIFASITGLEYAYSKAPASMKSFIMSIFLFTTAIGSALGAALSPVSIDPKFTWQYVG 545

Query: 533 LAVSCFIAGCLFWAFFHKYNDTEEAMNAIDYEEDDVLNYGVSIHYDLEPIASVNS 587
           LAVSCFIAG  FW  F +YND E+ +N ID + D +     + + DLE   S+ S
Sbjct: 546 LAVSCFIAGIAFWLCFSRYNDEEDELNNIDDQPDVIQISSENENDDLEAKNSIRS 600

>KAFR0H00230 Chr8 complement(33231..35021) [1791 bp, 596 aa] {ON} 
          Length = 596

 Score =  763 bits (1970), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/573 (62%), Positives = 446/573 (77%), Gaps = 11/573 (1%)

Query: 23  NSVEKIARPESFVDVLDKNQYINADSDHGRE----PTDEEMKTLRHVSEQIPVRCWLVAV 78
           +S ++I   ES+  + + N++     D+  E    PT+EE++TLRHVS +IP RC+L+AV
Sbjct: 31  SSEDQILDTESY-KLQNDNEFDPEHPDYQEEGYEMPTEEELRTLRHVSGRIPFRCFLIAV 89

Query: 79  VELAERFSYYGLSAPFQNYMQNGPNDTPKGILNLKNQGATALSYFFQFWCYVSPLLGGFV 138
           VEL+ERFSYYGLSAPFQNYM N P+D+P G+L L + GAT LSYFFQFWCY++P+LGG++
Sbjct: 90  VELSERFSYYGLSAPFQNYMANTPSDSPPGVLQLNSDGATGLSYFFQFWCYITPVLGGYL 149

Query: 139 ADTYWGKYKTICVGTGIYVVGIFILFITSVPSITYYSASLGGFITSLILIGLATGMIKAN 198
           ADT WG+Y TI VGTGIY+VGIF+LFITS  SI   + +LGGFI +LILIG+ TG IKAN
Sbjct: 150 ADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIAGKNGALGGFIVALILIGIGTGFIKAN 209

Query: 199 ISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQNIFMFFYLMINIGSLSVIATTEMEAH 258
           +SVLIADQIP  RP VK LKSGERVIED +IT+QN+FMFFYLMINIGSLSVIATTE+E H
Sbjct: 210 LSVLIADQIPAKRPRVKTLKSGERVIEDHDITIQNVFMFFYLMINIGSLSVIATTELEQH 269

Query: 259 IGFWAAYLLPFCFFFVAVFVLILGRNQYVKLPVGDKVISKSFKVCWIVMRNKFRFDAARP 318
           +GFWAAYLLPFCFF++AV VL+LGR  Y   P  D+VI KSFK CW + +NKF + A  P
Sbjct: 270 VGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKPTSDRVIEKSFKFCWALTKNKFNWSAVTP 329

Query: 319 SLNPELGYPWSDKFIDEIKRAIAACKVFVFYPIYWVCYGQMLSNFVSQAGMMELHGLPND 378
           + NPE+ + W DKF++EI+ A+AACKVF+FYPIYW CYGQM +NFV+   M++LHGLPND
Sbjct: 330 AENPEVTFSWDDKFVEEIRVALAACKVFLFYPIYWTCYGQMTNNFVTMGSMLQLHGLPND 389

Query: 379 FLQAIDSIALIVFIPICERFLYPFIRRFTPFRPITKIFYGFIFGALAMAWAAVLQHFIYK 438
             QAIDSIALIVFIPICE+F YPFIRRFTPFRPITKI YGF   + +M WA VLQ+FIYK
Sbjct: 390 IFQAIDSIALIVFIPICEKFFYPFIRRFTPFRPITKITYGFWLASASMVWACVLQYFIYK 449

Query: 439 AGPCYYYPMACAPEYKNTPNRIHIAWQVPAYVLIAFSEIFASITGLEYAYSKAPVSMRSF 498
            GP Y +P+A      + PN +H+AWQVPAYVLIAFSEIFASITGLEYAYSKAP SM+SF
Sbjct: 450 TGPNYKHPLA------DGPNNVHVAWQVPAYVLIAFSEIFASITGLEYAYSKAPASMKSF 503

Query: 499 IMSIFLLTTAFGSALGIALSSVSVNPKFVWTFSGLAVSCFIAGCLFWAFFHKYNDTEEAM 558
           IM++FL   AFGSA+G ALS VS +P + W + GLAV+ FI GC FW  F  YND E+ M
Sbjct: 504 IMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTAFITGCAFWFCFRHYNDIEDEM 563

Query: 559 NAIDYEEDDVLNYGVSIHYDLEPIASVNSDKRI 591
           NA++YE++D++         + P+++  S K +
Sbjct: 564 NALNYEDEDIITENNQDIEMVHPLSAYTSPKSL 596

>KAFR0H00240 Chr8 complement(36393..38168) [1776 bp, 591 aa] {ON}
           Anc_5.698 YKR093W
          Length = 591

 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/526 (65%), Positives = 425/526 (80%), Gaps = 10/526 (1%)

Query: 48  SDHGRE-PTDEEMKTLRHVSEQIPVRCWLVAVVELAERFSYYGLSAPFQNYMQNGPNDTP 106
            + G E PT +EMKTLR V  +IP RC+LVA+VELAERFSYYGLSAPFQNYMQNGP D+P
Sbjct: 58  QEEGYEIPTQDEMKTLRRVGGRIPFRCFLVALVELAERFSYYGLSAPFQNYMQNGPTDSP 117

Query: 107 KGILNLKNQGATALSYFFQFWCYVSPLLGGFVADTYWGKYKTICVGTGIYVVGIFILFIT 166
            G+L L + GAT LSYFFQFWCY++P+ GG++ADT WG+Y TI VGT IY++GIFILFIT
Sbjct: 118 PGVLQLNSSGATGLSYFFQFWCYITPIFGGYLADTKWGRYNTIGVGTVIYIIGIFILFIT 177

Query: 167 SVPSITYYSASLGGFITSLILIGLATGMIKANISVLIADQIPKSRPTVKVLKSGERVIED 226
           S  ++     +L GFI +LILIG ATG+IK+N+SVLIADQIP  RP VK LKSGERVIED
Sbjct: 178 SFKTVAGRDGALAGFILALILIGFATGLIKSNLSVLIADQIPAKRPRVKTLKSGERVIED 237

Query: 227 PNITVQNIFMFFYLMINIGSLSVIATTEMEAHIGFWAAYLLPFCFFFVAVFVLILGRNQY 286
            ++T+QN+FMFFYLMINIGSLSVIATTE+E ++GFWAAYLLPFCFF++AV V++ G+ QY
Sbjct: 238 HDVTIQNVFMFFYLMINIGSLSVIATTELELNVGFWAAYLLPFCFFWIAVIVIVAGKRQY 297

Query: 287 VKLPVGDKVISKSFKVCWIVMRNKFRFDAARPSLNPELGYPWSDKFIDEIKRAIAACKVF 346
           +  P GD+VI+KSFKVCWI+ +NKF   +A+PS +PE  +PW DKF+DEI+RA+AACKVF
Sbjct: 298 IIKPTGDRVIAKSFKVCWILCKNKFDITSAKPSYHPESEFPWEDKFVDEIQRALAACKVF 357

Query: 347 VFYPIYWVCYGQMLSNFVSQAGMMELHGLPNDFLQAIDSIALIVFIPICERFLYPFIRRF 406
           +FYPIYW CYGQM++NF++   MM+LHGLPND  QAI+SI+LI+FIPICE+FLYPFIRRF
Sbjct: 358 LFYPIYWTCYGQMVNNFITMGSMMQLHGLPNDIFQAINSISLIIFIPICEKFLYPFIRRF 417

Query: 407 TPFRPITKIFYGFIFGALAMAWAAVLQHFIYKAGPCYYYPMACAPEYKNTPNRIHIAWQV 466
           TP RP+T+IF GFIF A+AM W+ VLQHFIY  GP Y  P+          N IH+ WQV
Sbjct: 418 TPLRPVTRIFCGFIFAAMAMVWSCVLQHFIYSTGPNYNRPLELG------ANDIHVGWQV 471

Query: 467 PAYVLIAFSEIFASITGLEYAYSKAPVSMRSFIMSIFLLTTAFGSALGIALSSVSVNPKF 526
           PAYV IAFSEIFASITGLEYAYSKAP +M+SFIM++FL   AFGSA+G ALS VS +P +
Sbjct: 472 PAYVFIAFSEIFASITGLEYAYSKAPANMKSFIMALFLFMNAFGSAIGCALSPVSKDPDY 531

Query: 527 VWTFSGLAVSCFIAGCLFWAFFHKYNDTEEAMNAIDY---EEDDVL 569
            W +  LAV+CF++G +FW  F KYN  E+ MNA+D+   EED++L
Sbjct: 532 TWLYGSLAVACFLSGLIFWLCFRKYNKIEDEMNALDFTDSEEDEIL 577

>TBLA0B04710 Chr2 (1104183..1106030) [1848 bp, 615 aa] {ON} 
          Length = 615

 Score =  736 bits (1899), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/554 (64%), Positives = 445/554 (80%), Gaps = 23/554 (4%)

Query: 53  EPTDEEMKTLRHVSEQIPVRCWLVAVVELAERFSYYGLSAPFQNYMQNGPNDTPKGILNL 112
           EPT+EE+KTL   +  IP  CWL+A++ELAERFSYYGLSAPFQNYMQN P+D P G L+L
Sbjct: 66  EPTEEELKTLPREAGHIPFNCWLLAIIELAERFSYYGLSAPFQNYMQNNPSDNPPGALSL 125

Query: 113 KNQGATALSYFFQFWCYVSPLLGGFVADTYWGKYKTICVGTGIYVVGIFILFITSVPSIT 172
            + GAT LSYFFQFWCYV+P+  GF+ADTYWGK+ T+C+GT IY++GIFILFITS+P+IT
Sbjct: 126 NSTGATGLSYFFQFWCYVTPIFAGFMADTYWGKFNTLCIGTIIYIIGIFILFITSLPAIT 185

Query: 173 YYSASLGGFITSLILIGLATGMIKANISVLIADQIPKSR-PTVKVLKSGERVIEDPNITV 231
            Y+ +LGGFI ++ILIG+ATGMIKAN+SV+IADQ+PK +   V   KSG+RVIEDP +T+
Sbjct: 186 SYNTALGGFIVAIILIGIATGMIKANLSVMIADQLPKKKLRVVTKKKSGKRVIEDPQLTI 245

Query: 232 QNIFMFFYLMINIGSLSVIATTEMEAHIGFWAAYLLPFCFFFVAVFVLILGRNQYVKLPV 291
           QN+FM FY MIN+GSLSVIATTE+E H+GFWAAYLLPFCFF++AV VL  G  ++VK P+
Sbjct: 246 QNVFMAFYFMINVGSLSVIATTELELHVGFWAAYLLPFCFFWIAVLVLAFGNRKFVKKPI 305

Query: 292 GDKVISKSFKVCWIVMRNKFRFDAARPSLNPELGYPWSDKFIDEIKRAIAACKVFVFYPI 351
           GD+VISK F +  I+++N F F  A+P+ NPE  YPWSDKF+DEI+R++ ACKVF+FYPI
Sbjct: 306 GDRVISKCFTIIGILIKNNFNFQKAKPTYNPEKNYPWSDKFVDEIQRSLKACKVFLFYPI 365

Query: 352 YWVCYGQMLSNFVSQAGMMELHGLPNDFLQAIDSIALIVFIPICERFLYPFIRRFTPFRP 411
           YWVCYGQML+NFV+Q   M+LHGLPNDF QAI+SIALIVFIPI E+F+YPFIR+FTP +P
Sbjct: 366 YWVCYGQMLNNFVTQGSTMQLHGLPNDFFQAINSIALIVFIPIVEKFVYPFIRKFTPLKP 425

Query: 412 ITKIFYGFIFGALAMAWAAVLQHFIYKAGPCYYYPMACAPEYKNTPNRIHIAWQVPAYVL 471
           ITK+  GF+FG+LAM WAAVLQHFIY+AGPCY +P+ C     N PN +H+AWQVPAY L
Sbjct: 426 ITKVTIGFVFGSLAMVWAAVLQHFIYQAGPCYDHPVKCP----NGPNHVHVAWQVPAYCL 481

Query: 472 IAFSEIFASITGLEYAYSKAPVSMRSFIMSIFLLTTAFGSALGIALSSVSVNPKFVWTFS 531
           I+ SEIFASITGLE AYSKAP SM+SFIMS+FL+T AFG+A+G ALSSVS +PK+VW ++
Sbjct: 482 ISLSEIFASITGLEIAYSKAPESMKSFIMSMFLVTNAFGAAIGCALSSVSEDPKYVWLYT 541

Query: 532 GLAVSCFIAGCLFWAFFHKYNDTEEAMNAIDYEEDD---------VLNYGVS-------- 574
           GLAV+CF AG  FW  F  YND E+AMN ID+E D+         + N  +S        
Sbjct: 542 GLAVTCFCAGIAFWFTFKHYNDEEDAMNNIDFESDNENEKNEYSQIENLELSQTKTTDKD 601

Query: 575 -IHYDLEPIASVNS 587
            +H D+E I+S++S
Sbjct: 602 DVHTDIERISSLSS 615

>Skud_11.331 Chr11 (597847..599046) [1200 bp, 399 aa] {ON} YKR093W
           (REAL)
          Length = 399

 Score =  604 bits (1558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/395 (70%), Positives = 341/395 (86%), Gaps = 13/395 (3%)

Query: 194 MIKANISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQNIFMFFYLMINIGSLSVIATT 253
           MIKAN+SVLIADQ+PK +P++KVLKSGERV+ DPNIT+QN+FMFFY MIN+GSLS++ATT
Sbjct: 1   MIKANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATT 60

Query: 254 EMEAHIGFWAAYLLPFCFFFVAVFVLILGRNQYVKLPVGDKVISKSFKVCWIVMRNKFRF 313
           E+E H GFWAAYLLPFCFF++AV  LILG+ QY++ P+GDKVI+KSF+VCWI+ +NKF F
Sbjct: 61  ELEYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDF 120

Query: 314 DAARPSLNPELGYPWSDKFIDEIKRAIAACKVFVFYPIYWVCYGQMLSNFVSQAGMMELH 373
           +AA+PS++PE  YPW+DKF+DEIKRA+AACKVF+FYPIYW  YG M+S+F++QA MMELH
Sbjct: 121 NAAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELH 180

Query: 374 GLPNDFLQAIDSIALIVFIPICERFLYPFIRRFTPFRPITKIFYGFIFGALAMAWAAVLQ 433
           G+PNDFLQA DSIALI+FIPI E+F+YPFIRR+TPF+PITKIF+GF+FG+ AM WAAVLQ
Sbjct: 181 GIPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQ 240

Query: 434 HFIYKAGPCYYYPMACAPEYKNTPNRIHIAWQVPAYVLIAFSEIFASITGLEYAYSKAPV 493
            FIYKAGP Y  P+       NTPNR+H+ WQ+PAYVLI+FSEIFASITGLEYAYSKAP 
Sbjct: 241 SFIYKAGPWYDEPLG-----HNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPA 295

Query: 494 SMRSFIMSIFLLTTAFGSALGIALSSVSVNPKFVWTFSGLAVSCFIAGCLFWAFFHKYND 553
           SM+SFIMSIFLLTTAFGSA+G ALS V+V+PKF W F+GLAV+CFI+GCLFW  F KYND
Sbjct: 296 SMKSFIMSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYND 355

Query: 554 TEEAMNAIDYEEDDVLNYGVSIHYDLEPIASVNSD 588
           TEE MNA+DYEE+D         +DL PI++  ++
Sbjct: 356 TEEEMNAMDYEEED--------EFDLNPISAPKAN 382

>Kwal_47.16930 s47 (176926..178761) [1836 bp, 611 aa] {ON} YKR093W
           (PTR2) - Peptide transporter [contig 219] FULL
          Length = 611

 Score =  270 bits (689), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 185/584 (31%), Positives = 291/584 (49%), Gaps = 61/584 (10%)

Query: 40  KNQYINADSD-HGR-----------EPTDEEMKTLRHVSEQIPVRCWLVAVVELAERFSY 87
           KNQY  A+ D H             EPT+ E   LR V        + + ++E +ER SY
Sbjct: 6   KNQYAVAEIDGHSEDFDELDTQTFPEPTERERSELRRVLGHPKWYVYFICLIEFSERASY 65

Query: 88  YGLSAPFQNYMQN-------------GPNDTPKGILNLKNQGATALSYFFQFWCYVSPLL 134
           YG      N++Q                ++   G L +  Q ATAL+    F  Y  PL+
Sbjct: 66  YGTGDRLNNFIQKPLPAGGNGAGAPAPGSEATAGALGMGLQVATALNLLLTFLAYCFPLI 125

Query: 135 GGFVADTYWGKYKTICVGTGIYVVGIFILFITSVPSITYY-SASLGGFITSLILIGLATG 193
            G+VAD YWG+ + + +G  + +V   +  I S+P +  + SA+L   I  +I + +AT 
Sbjct: 126 TGYVADRYWGRMRMLWIGVFVGIVSHVVFIIGSLPVVLGHGSAALAPCIIGIITLAIATA 185

Query: 194 MIKANISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQNIFMFFYLMINIGSLSVIATT 253
            +K  +   +  Q P +   VK L SGERVI D + ++Q + M FY  IN+GS   +AT+
Sbjct: 186 FVKPILLPTLLSQYPHATDVVKTLPSGERVIIDRDASLQRMTMTFYWSINVGSFLSVATS 245

Query: 254 EMEAHIGFWAAYLLPFCFFFVAVFVLILGRNQYVK--LPVGDKVIS---KSFKVC----- 303
                +G+W A+L+P   F +   VL++ R +Y+K   P G  +I+   K  KVC     
Sbjct: 246 YSARDVGYWLAFLIPLALFMIMPAVLLVLR-RYIKDEPPSGRSLIADCLKVLKVCFERNW 304

Query: 304 WIVMRNKFRFDAARPSLNPELG-----------YPWSDKFIDEIKRAIAACKVFVFYPIY 352
           W   R    +D A+PS    LG           YP  +  + + +  I+AC +F++Y IY
Sbjct: 305 WSRYRAGTFWDYAKPSNLRSLGRQGWRKSKPGFYP--ESLVQDARVTISACTIFLYYVIY 362

Query: 353 WVCYGQMLSNFVSQAGMMELHGLPNDFLQAIDSIALIVFIPICERFLYPFIRRFT-PFRP 411
            +  G + S   SQ   +   G+PND +   + + +IVF+PI +R +YP +R+    FRP
Sbjct: 363 NINDGGIGSIMNSQTASLTSKGVPNDLMSNFNPLCIIVFMPILDRVVYPLLRKLRWNFRP 422

Query: 412 ITKIFYGFIFGALAMAWAAVLQHFIYKAGPCYYYPMACAPEYKNTPNRIHIAWQVP-AYV 470
           + +IF GF+  ALA A  A++QH IY+  PC  Y   C  E   +P  +   W V   Y 
Sbjct: 423 VFRIFAGFMVAALASAVGAIIQHAIYQTSPCGNYATEC--EKGVSPISM---WVVAIEYA 477

Query: 471 LIAFSEIFASITGLEYAYSKAPVSMRSFIMSIFLLTTAFGSALGIALSSVSVNPKFVWTF 530
           L  FSE  A  TG E A+ ++P  M++F+M++FL  +A  +ALG  ++   V+P  V  F
Sbjct: 478 LTGFSECLAMTTGYEIAFERSPPHMKTFVMALFLFMSALSAALGEIVTPSLVDPHLVIPF 537

Query: 531 SGLA-VSCFIAGCLFWAFFHKYNDTEE---AMNAIDYEEDDVLN 570
             LA +   +A    W +++ ++  E+      A+  +E+  LN
Sbjct: 538 GVLAGLGAAVAFAFLWRYWNLHHVMEQERIEREALAKQEEPALN 581

>KLTH0D16544g Chr4 complement(1366262..1368142) [1881 bp, 626 aa]
           {ON} similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 626

 Score =  252 bits (644), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 175/588 (29%), Positives = 286/588 (48%), Gaps = 55/588 (9%)

Query: 23  NSVEKIARPESFVDVLDKNQYINADSDHGR---EPTDEEMKTLRHVSEQIPVRCWLVAVV 79
           +SVEK     S V VL+ + Y    S       EPT+ E  TLR V E      + + ++
Sbjct: 8   SSVEK-----SQVAVLETDTYSEGGSGTPLSLPEPTEHERTTLRRVLEHPKWYVYFICLI 62

Query: 80  ELAERFSYYGLSAPFQNYMQN----------------GPNDTPKGILNLKNQGATALSYF 123
           E +ER SYYG      N++Q                   +    G L +  Q ATAL+  
Sbjct: 63  EFSERASYYGTGDRLNNFIQQPLPAGGNGAGAPAHGAAGDSATAGALGMGLQTATALNLL 122

Query: 124 FQFWCYVSPLLGGFVADTYWGKYKTICVGTGIYVVGIFILFITSVPSI-TYYSASLGGFI 182
             F  Y  PL+ G++AD YW + + + +G  + ++   I  I ++P +     A+L   +
Sbjct: 123 LTFLAYCFPLVTGYIADRYWSRMRMLWIGVFVGIISHVIFIIGALPPVLGNGQAALAPCV 182

Query: 183 TSLILIGLATGMIKANISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQNIFMFFYLMI 242
             +I + +AT  +K  +   +  Q P     V+ L SGERV+ D + ++Q + M FY  I
Sbjct: 183 IGIITLAIATSFVKPVLLPTLLSQYPHETDVVRTLASGERVLVDRDASLQRMTMTFYWSI 242

Query: 243 NIGSLSVIATTEMEAHIGFWAAYLLPFCFFFVA-VFVLILGRNQYVKLPVGDKVIS---K 298
           NIGS   +AT+     IG+W A+L+P   + +    +L+LGR    + P G  +++   K
Sbjct: 243 NIGSFLSVATSYAARDIGYWLAFLIPLILYLIMPAVLLVLGRYLRDEPPSGRSMLADCCK 302

Query: 299 SFKVC-----WIVMRNKFRFDAARPSLNPELGYP----------WSDKFIDEIKRAIAAC 343
             +VC     W   R+   ++ ARPS   + G            +++  + + +  ++A 
Sbjct: 303 VLRVCFERGWWRRYRSGDFWNYARPSRLRQAGRAGWRRKGAGGFYAESLVQDTRVTLSAS 362

Query: 344 KVFVFYPIYWVCYGQMLSNFVSQAGMMELHGLPNDFLQAIDSIALIVFIPICERFLYPFI 403
            +F++Y IY +  G + S   SQ   +  +G+PND +   + + +IVF+P+ +  LYP +
Sbjct: 363 AIFLYYVIYNINDGGIGSIMNSQTASLTSNGVPNDLISNFNPLCIIVFMPVLDHVLYPVL 422

Query: 404 RRFT-PFRPITKIFYGFIFGALAMAWAAVLQHFIYKAGPCYYYPMACAPEYKNTPNRIHI 462
           R+    F+P+ +IF GF+  ALA A  A++Q  IY   PC  Y   C  +   +P  +  
Sbjct: 423 RKMRWNFKPVYRIFCGFMIAALASAVGAIIQTVIYNTSPCGRYATEC--DKGVSPVSM-- 478

Query: 463 AWQVPA-YVLIAFSEIFASITGLEYAYSKAPVSMRSFIMSIFLLTTAFGSALGIALSSVS 521
            W V   Y L   SE  A  TG E A+ ++P  M+SF+M++FL T+A  +ALG  ++   
Sbjct: 479 -WVVAVEYALTGLSECLAMTTGYEIAFERSPAHMKSFVMALFLFTSALSAALGEIVTPSL 537

Query: 522 VNPKFVWTFSGLA-VSCFIAGCLFWAF--FHKYNDTEEA-MNAIDYEE 565
           V+P  V  F  LA +  F+A    W +    K  + E A   A++ EE
Sbjct: 538 VDPHLVIPFGVLAGLGAFMAFVFLWRYWSLDKTMELERAERRALEAEE 585

>AGL365C Chr7 complement(13929..15728) [1800 bp, 599 aa] {ON}
           NOHBY725; No homolog in Saccharomyces cerevisiae
          Length = 599

 Score =  241 bits (614), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 164/543 (30%), Positives = 270/543 (49%), Gaps = 39/543 (7%)

Query: 60  KTLRHVSEQIPVRCWLVAVVELAERFSYYGLSAPFQNYMQ-----------NGPNDTPKG 108
           K LRHV        +++ ++ELAER SYYG      N+ Q            GP+D   G
Sbjct: 44  KRLRHVVAAPKWTVYMICLIELAERASYYGTGDRLYNFFQYPLPQGGNGAGAGPDDQNPG 103

Query: 109 ILNLKNQGATALSYFFQFWCYVSPLLGGFVADTYWGKYKTICVGTGIYVVGIFILFITSV 168
            L    Q AT+L+   +F  Y  PL+ G+VAD Y G+ K + +G    VV   I  I ++
Sbjct: 104 ALGRGLQVATSLNLVLKFTSYFFPLVTGYVADMYVGELKMLWLGIWTGVVSHVIFVIAAL 163

Query: 169 PS-ITYYSASLGGFITSLILIGLATGMIKANISVLIADQIPKSRPTVKVLKSGERVIEDP 227
           P+ I + +  +   +  L+ + L T  +K  +  ++  Q P     VK L +GERVI + 
Sbjct: 164 PAVIKHNNLCMALAVLGLLTLSLCTAFVKPVLLPMLLRQYPHETNVVKTLPTGERVILNR 223

Query: 228 NITVQNIFMFFYLMINIGSLSVIATTEMEAHIGFWAAYLLPFCFFFVAVFVLILGRNQYV 287
           + ++Q + M FY  IN+GS   +AT      +G+W ++L+P   F +   +L+  +N  V
Sbjct: 224 DASLQRMSMTFYWCINVGSFVSLATGYSAQRVGYWLSFLIPLVLFLIMPAILLTLKNVKV 283

Query: 288 KLPVGDKVISKSFKVCWIVMR----NKFRFDA----ARPSLNPELGYP---------WSD 330
             P+G+ + ++  KV  +        ++R  +    A+PS    LG           + +
Sbjct: 284 TPPLGESLFAECLKVIKVCFEPGWFKRYRSGSFWRYAKPSNLRALGRTGWRRSKEGFYKE 343

Query: 331 KFIDEIKRAIAACKVFVFYPIYWVCYGQMLSNFVSQAGMMELHGLPNDFLQAIDSIALIV 390
             +++ +  +AAC +F++Y IY +   Q+ S   +QAG M   G+PND +   + +A+I+
Sbjct: 344 SLVEDTRITLAACVIFLYYVIYNMNDNQLSSIINNQAGSMTGEGVPNDVISNFNPLAIII 403

Query: 391 FIPICERFLYPFIRRFT-PFRPITKIFYGFIFGALAMAWAAVLQHFIYKAGPCYYYPMAC 449
            +PI +  L P +RR    F+P+ +IF+GF+   LA    A++Q  IY   PC  +   C
Sbjct: 404 TMPIIDYGLNPLLRRLRINFKPVYRIFFGFMLAVLASVAGAIIQAAIYNTSPCGKHASTC 463

Query: 450 APEYKNTPNRIHIAWQVPA-YVLIAFSEIFASITGLEYAYSKAPVSMRSFIMSIFLLTTA 508
           +   +         W V   YVL   SE FA  TG E A+ ++P  M++F+MS+FL+TTA
Sbjct: 464 SETIRQVSPLSR--WLVGVEYVLSGVSECFAMPTGYEIAFERSPKDMKAFVMSLFLVTTA 521

Query: 509 FGSALGIALSSVSVNPKFVWTFSGLAVSCFIAGCLFW-AFFHKYNDTEEAMNAIDYEEDD 567
             S L    + +  +P  V  F   AV     G LF   F ++Y + ++ M A +  E  
Sbjct: 522 LSSILTQIFNGIMTDPYLVIPFILFAV----LGTLFAILFLYRYWNLDKVMEA-ERRERA 576

Query: 568 VLN 570
           +L+
Sbjct: 577 ILD 579

>Ecym_2823 Chr2 (1599716..1601557) [1842 bp, 613 aa] {ON} similar to
           Ashbya gossypii AGL365C
          Length = 613

 Score =  227 bits (579), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 172/573 (30%), Positives = 272/573 (47%), Gaps = 46/573 (8%)

Query: 17  VTSSP-----ENSVEKIARPESFVDVLDKNQYINADSD-HGREPTDEEMKTLRHVSEQIP 70
           +TSSP     E+ V  +    +   V +  Q +   SD     PT+EE +TLR +     
Sbjct: 1   MTSSPARQSWESDVSTLGSGSNAATVQEAPQEVKERSDIEIGLPTEEEERTLRRIVVHPS 60

Query: 71  VRCWLVAVVELAERFSYYGLSAPFQNYMQ-------NGPNDTPKGILNLKNQGA------ 117
              +L+  +ELAER SYYG      NY         NG   T  G  +  N GA      
Sbjct: 61  WYVYLICFIELAERASYYGTGDRLNNYYTYPLPEGGNGAGATAHG--SEANSGALGKGLA 118

Query: 118 --TALSYFFQFWCYVSPLLGGFVADTYWGKYKTICVGTGIYVVGIFILFITSVPSITYY- 174
             T+L    +F  Y  PL+ G++ D Y G  +T+  G    V    I  ++++P +  + 
Sbjct: 119 TATSLGLLLKFTSYFFPLVTGYLCDMYMGHVRTLWYGIWTGVASHIIFILSALPVVLKHP 178

Query: 175 SASLGGFITSLILIGLATGMIKANISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQNI 234
            A++   +  LI + + T  +K  +  L+  Q P     VK L++GERVI D + ++Q +
Sbjct: 179 DAAMALSLIGLITLSVCTAFVKPVLLPLLLQQYPHETNVVKTLETGERVIIDRDASLQRM 238

Query: 235 FMFFYLMINIGSLSVIATTEMEAHIGFWAAYLLPFCFFFV--AVFVLI------LGRNQY 286
            M FY  INIG+   +AT+     +GFW A+L+P   +     VF L+         + Y
Sbjct: 239 TMTFYWAINIGAFMSLATSYAAKEVGFWLAFLIPLIIYMAMPVVFSLVQPHIKDRAPSGY 298

Query: 287 VKLPVGDKVISKSFKVCWIVMRNKFRF-DAARPSLNPELG-YPWSDK-------FIDEIK 337
             L    KV+  +F   W   R +  F D A PS   ++G   W  K        + + K
Sbjct: 299 SLLADCMKVLYVAFGKGWNARRKEGVFWDYALPSNQRQMGKVGWRKKSPFYKESLVQDTK 358

Query: 338 RAIAACKVFVFYPIYWVCYGQMLSNFVSQAGMMELHGLPNDFLQAIDSIALIVFIPICER 397
             ++AC +F +Y IY +   Q+ +   SQ G M  +G+PND +   + +++IV IPI + 
Sbjct: 359 ITLSACFIFCYYIIYNMNDNQLTTIINSQTGSMTKNGVPNDVISNFNPLSIIVLIPILDY 418

Query: 398 FLYPFIRRFT-PFRPITKIFYGFIFGALAMAWAAVLQHFIYKAGPCYYYPMACAPEYKNT 456
            LYP +RR    F+P+ +IF GF+    +    A++Q  IY+   C Y+   C+   K  
Sbjct: 419 GLYPLLRRLRINFKPVYRIFTGFMLAVASSVAGALIQWRIYETSSCGYHATTCSE--KGL 476

Query: 457 PNRIHIAWQVPA-YVLIAFSEIFASITGLEYAYSKAPVSMRSFIMSIFLLTTAFGSALGI 515
                 +W V   Y L   SE  A  T  E AY ++P  M+SF++++FL T+A  +A+  
Sbjct: 477 GVSPLSSWIVAVEYTLSGASECLAMTTAYEIAYDRSPEHMKSFVLALFLFTSAVSAAITQ 536

Query: 516 ALSSVSVNPKFVWTFSGLAVSCFIAGCLF-WAF 547
            ++ +  +P  +  F+  A   FI+GC F W F
Sbjct: 537 IVNPILKDPLLIVPFALFAGIGFISGCHFLWKF 569

>AFR228W Chr6 (850893..852623) [1731 bp, 576 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YKR093W (PTR2)
          Length = 576

 Score =  216 bits (550), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 165/573 (28%), Positives = 278/573 (48%), Gaps = 51/573 (8%)

Query: 26  EKIARPESFVDVLDKNQYINADSDHGREPTDEEMKTLRHVSEQIPVRCWLVAVVELAERF 85
           EK     +FV  L+K +YI  +++  + PT+ E  TLR +     +  + + ++E AER 
Sbjct: 4   EKETAKVNFVQDLEKEKYIT-ETETLQIPTEHEELTLRRIVTSPKIHLYFICLIEFAERG 62

Query: 86  SYYGLSAPFQNYMQ------------NGPNDTPKGILNLKNQGATALSYFFQFWCYVSPL 133
           S+YG      N+ Q             GP +   G L      ATA+    +F  Y   +
Sbjct: 63  SFYGTGNRMGNFYQYPLPIGGNGAGAPGPGEQDPGALGKGLAVATAMGLLLKFTSYTFSI 122

Query: 134 LGGFVADTYWGKYKTICVGTGIYVVGIFILFITSVPSI-TYYSASLGGFITSLILIGLAT 192
           + G+++D Y G+ K + +G  + V    +  I ++PS+  + + +    + +L+ + L T
Sbjct: 123 ITGYISDVYIGQIKMLWIGVWLGVGSHILFIIAALPSVLAHTNVAYALSVVALLSLSLCT 182

Query: 193 GMIKANISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQNIFMFFYLMINIGSLSVIAT 252
             +K  +  L+  Q P     VK L SGERVI D + ++Q + M FY  IN+G+   +AT
Sbjct: 183 SFVKPVLLPLLLQQYPYKTNIVKTLLSGERVIVDRDASLQRMTMVFYWAINVGAFLSLAT 242

Query: 253 TEMEAHIGFWAAYLLPFCFFFVAVFVL-ILGRNQYVKLPVGDKVISKSFKVC-------W 304
                 +G+W A+ +P   + +   VL  L  +     P  + V+++S KV        W
Sbjct: 243 AYSAQRVGYWLAFTVPLIIYLLMPIVLWKLQEDIKTNEPSRESVLAESLKVLKVCYEWGW 302

Query: 305 IVMRNKFRF-DAARPS---LNPELGYP------WSDKFIDEIKRAIAACKVFVFYPIYWV 354
           I      +F D A+P+       +G+       + +K++ + K  I+AC +F++Y IY  
Sbjct: 303 IKRYWSGQFWDYAKPTNLIQQGRIGWRKKKAGFYDEKYVYDTKLTISACTIFLYYVIY-- 360

Query: 355 CYGQMLSNF----VSQAGMMELHGLPNDFLQAIDSIALIVFIPICERFLYPFIRRFT-PF 409
              QM SN      SQAG ME  G+PND     + I++IV +PI +  LYP +RR+   F
Sbjct: 361 ---QMHSNLDEPMRSQAGSMEGEGVPNDLFSNFNPISIIVVMPILDYVLYPLLRRYRINF 417

Query: 410 RPITKIFYGFIFGALAMAWAAVLQHFIYKAGPCYYYPMACAPE--YKNTP-NRIHIAWQV 466
           +P+ +IF GF+ G L     A++Q  +Y   PC Y      PE  +K +P +R  +A + 
Sbjct: 418 KPVYRIFCGFMIGCLGSTVGAIIQWRVYNTSPCGYMGATTCPELHHKKSPLSRWLVAIE- 476

Query: 467 PAYVLIAFSEIFASITGLEYAYSKAPVSMRSFIMSIFLLTTAFGSALGIALSSVSVNPKF 526
             Y L   SE  A  TG E A+ ++P  M+ F++++F+ T A  SA+ + ++    +P  
Sbjct: 477 --YALGGTSECLAMTTGYEIAFERSPKKMKGFVLALFMFTVAISSAIILPITPFFKDPYL 534

Query: 527 VWTFSGLAVSCFIAGCLFWAFFHKYNDTEEAMN 559
           +  F   AV   +       F  +Y D ++ M 
Sbjct: 535 IQPF---AVCAGVGALTAIIFLWRYWDLDKQMK 564

>ADL156C Chr4 complement(416054..417505) [1452 bp, 483 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL119C
           (MCH4); Tandem gene duplication in this genome
          Length = 483

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 55/137 (40%), Gaps = 24/137 (17%)

Query: 36  DVLDKNQYINADSDHGREPTDEEMKTLRHVSEQIP---VRCWLVAVVELAERFSYYGLS- 91
           D     + + AD     E T+E       V E+ P    R WL  +      F  +G + 
Sbjct: 43  DEDGAEEVLAADEKAATEATNE-----LDVEEEYPDGGYRAWLTVLGSFVGIFPIWGTAN 97

Query: 92  --APFQNYMQNGPNDTPKGILNLKNQGATALSYFFQFW---CYVSPLLGGFVADTYWGKY 146
               ++ Y+ N           L + GA  +S+ F      C+V  +  G   D   G+ 
Sbjct: 98  ALGAYEGYISNH---------QLASSGAGEVSWIFALHMIACFVGCVFSGSYFDRNGGQ- 147

Query: 147 KTICVGTGIYVVGIFIL 163
           K I VG+ +YV GIF++
Sbjct: 148 KAIIVGSVLYVFGIFMM 164

>TBLA0F02130 Chr6 complement(522486..525128) [2643 bp, 880 aa] {ON}
           Anc_7.309 YDL194W
          Length = 880

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 38/87 (43%), Gaps = 9/87 (10%)

Query: 123 FFQFWCYVSPLLGGFVADTYWGKYKTICVGTGIYVVGIFILFITSVPSITYYSASLGGFI 182
           F     ++  L+  F+AD Y  K   I   T I+ +G          S+   S  +G F+
Sbjct: 179 FLSLGTFLGALIAPFIADRYGRKITIILSSTLIFFLG---------NSLQVGSHGIGLFV 229

Query: 183 TSLILIGLATGMIKANISVLIADQIPK 209
               + G+A GM+ A + +  A+  PK
Sbjct: 230 AGRFISGVAIGMVSAVVPLYQAEAAPK 256

>NDAI0F01930 Chr6 (467932..469626) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 48/114 (42%), Gaps = 9/114 (7%)

Query: 96  NYMQNGPNDTPKGILNLKNQGATALSYFFQFWCYVSPLLGGFVADTYWGKYKTICVGTGI 155
           +Y+    +  P G   +       L   F   C +  +  G + D+  G+ K I VG  I
Sbjct: 88  DYINRFGSTHPSGTKYMSKVRTGLLVSIFNVGCAIGSVFLGRLGDSI-GRRKGIVVGASI 146

Query: 156 YVVGIFILFITSVPSITYYSASLGGFITSLILIGLATGMIKANISVLIADQIPK 209
           Y+VGI I     + SI  +      +    I+ GL +G I     +LI++  PK
Sbjct: 147 YIVGIVI----QIASIDKWFQ----YFIGRIIGGLGSGAIAVLSPMLISEVSPK 192

>TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 46/114 (40%), Gaps = 9/114 (7%)

Query: 96  NYMQNGPNDTPKGILNLKNQGATALSYFFQFWCYVSPLLGGFVADTYWGKYKTICVGTGI 155
           +++Q        G+L L       L   F   C +  +  G + D Y G+   +  GT I
Sbjct: 102 DFIQRFGTKNEDGVLYLSTIRMGLLVSIFNIGCAIGSVFLGKLGDLY-GRRWGLIFGTSI 160

Query: 156 YVVGIFILFITSVPSITYYSASLGGFITSLILIGLATGMIKANISVLIADQIPK 209
           +VVG+ I   +      Y+           I+ G+  G+I     +LI++  PK
Sbjct: 161 FVVGVIIQIASVSKWFQYFIGR--------IIAGIGMGVIAVLSPMLISEVAPK 206

>NDAI0B04390 Chr2 (1100175..1101221) [1047 bp, 348 aa] {ON}
           Anc_2.138 YHR123W
          Length = 348

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%), Gaps = 8/56 (14%)

Query: 253 TEMEAHIGFWAAYLLPFCFFFVAVFVLILGRNQYVKLPVGDKVISKSFKVCWIVMR 308
           TE +A  G     LLPF  ++++VFVLI+   ++V  P+    IS  F V ++V R
Sbjct: 215 TEYDALKG-----LLPFFIYYISVFVLIMIDTEFVSFPL---FISIGFSVAFVVGR 262

>NDAI0F02920 Chr6 (715012..716226) [1215 bp, 404 aa] {ON} Anc_2.138
           YHR123W
          Length = 404

 Score = 31.2 bits (69), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 26/43 (60%), Gaps = 3/43 (6%)

Query: 266 LLPFCFFFVAVFVLILGRNQYVKLPVGDKVISKSFKVCWIVMR 308
           LLPF F+F++V VLI     ++ LP+   V+S    + ++V R
Sbjct: 277 LLPFLFYFISVIVLITVNENFINLPL---VLSIGLTMAFVVGR 316

>TDEL0A03330 Chr1 complement(590772..592421) [1650 bp, 549 aa] {ON}
           Anc_5.469 YDR387C
          Length = 549

 Score = 31.2 bits (69), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 58/120 (48%), Gaps = 15/120 (12%)

Query: 102 PNDTPKGIL-NLKNQGATALSYFFQFWCYVSPLLGGFVADTYWGKYKTICVGTGIYVVGI 160
           P D  + ++ N   +  T+++    F+     +LG  ++DTY G+ KT+   + I++VG 
Sbjct: 81  PEDISREVITNFDKELITSVTCLGSFF---GSILGFPLSDTY-GRRKTLAFCSAIFIVGG 136

Query: 161 FILFITSVPSITYYSASLGGFITSLILIGLATGMIKANISVLIADQIPKS-RPTVKVLKS 219
             + +         S SL   I   +++G+A G+    + V +++  P S R TV  L S
Sbjct: 137 IWMAL---------SKSLSLLIMGRLVVGVAIGIAAQCVPVFLSEVSPASIRGTVLTLNS 187

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.140    0.440 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,113,086
Number of extensions: 2713219
Number of successful extensions: 9304
Number of sequences better than 10.0: 51
Number of HSP's gapped: 9474
Number of HSP's successfully gapped: 51
Length of query: 592
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 477
Effective length of database: 40,294,809
Effective search space: 19220623893
Effective search space used: 19220623893
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 69 (31.2 bits)