Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E14806gna 1ON57857828870.0
Kwal_55.19721na 1ON57757723010.0
KLTH0E01144gna 1ON57256422620.0
KLLA0E12959gna 1ON57957122540.0
ZYRO0G01474gsingletonON57256615130.0
SAKL0G14762gsingletonON56556214820.0
SAKL0G15136g5.112ON56955614800.0
Suva_4.38na 2ON57157214700.0
NDAI0C031505.112ON57457314700.0
KLTH0G10736gsingletonON56856514540.0
KLLA0E14675gsingletonON57355114470.0
KLTH0B08140gna 3ON56855314400.0
YDL210W (UGA4)na 2ON57157214330.0
NCAS0D016005.112ON57657514320.0
Smik_4.30na 2ON57157214230.0
Kwal_23.4458na 3ON56556114200.0
TDEL0G013705.112ON56954414080.0
KNAG0E008205.112ON57153814080.0
SAKL0D01232gna 4ON57456114070.0
Kwal_0.16singletonON56454714000.0
KLLA0E24993gsingletonON56857213940.0
Skud_4.46na 2ON57157213830.0
KNAG0K01030singletonON58154313830.0
ZYRO0B15048gsingletonON58256413820.0
ABL116Cna 4ON54451412161e-161
Ecym_4621na 4ON57255512021e-159
Skud_7.2056.205ON5625584003e-41
Suva_7.1936.205ON5635533961e-40
TPHA0E029206.205ON5865313934e-40
YGL077C (HNM1)6.205ON5635853862e-39
SAKL0A04730g6.205ON5415073801e-38
AFL081W6.205ON5424763801e-38
Ecym_22126.205ON5455003731e-37
Smik_7.2066.205ON5635213731e-37
TDEL0G014106.205ON5534913704e-37
NCAS0D037506.205ON5694833686e-37
Kpol_1033.416.205ON5865033688e-37
CAGL0H03399g6.205ON5565153624e-36
KNAG0D051406.205ON5435053591e-35
KLTH0H04444g6.205ON5325353581e-35
ZYRO0G08602g6.205ON5695213563e-35
NDAI0I011406.205ON6004723555e-35
TBLA0A019606.205ON5945343475e-34
KLLA0C15521g6.205ON5474783465e-34
KAFR0K003606.205ON5385403244e-31
Kwal_56.240096.205ON3423152741e-25
Kwal_33.138061.173ON5495332454e-21
KLTH0F04576g1.173ON5495032365e-20
TBLA0C057401.173ON6595272295e-19
CAGL0M08272g1.173ON6215132171e-17
SAKL0C05126g1.173ON5685182081e-16
TPHA0E033501.173ON6475332082e-16
KLLA0A06666g1.173ON5605121992e-15
ZYRO0F00242gsingletonON5355101902e-14
NCAS0B083501.173ON6125241822e-13
ZYRO0G18700g1.173ON5915481796e-13
KNAG0C009801.173ON7145361788e-13
Kpol_2002.701.173ON6224981761e-12
Ecym_81051.173ON5833871714e-12
KAFR0G003901.173ON6075241707e-12
NDAI0A008901.173ON6415281672e-11
SAKL0H11484gna 5ON5605601617e-11
TDEL0G021201.173ON5935311592e-10
TDEL0G04830singletonON5434051563e-10
Kthe_YGOB_SAKL0H11484gna 5ON5563041538e-10
YNR056C (BIO5)na 5ON5615351511e-09
Smik_14.390na 5ON5545351502e-09
Suva_11.491.173ON6195011483e-09
Kwal_55.19602na 5ON5585191457e-09
AEL125C1.173ON5753811449e-09
Skud_11.511.173ON6165021422e-08
Suva_14.415na 5ON5325181402e-08
Skud_14.392na 5ON5315221402e-08
YKL174C (TPO5)1.173ON6185121394e-08
Smik_11.551.173ON6194671376e-08
KLLA0B00385gna 5ON5644091135e-05
NCAS0J011804.195ON585155880.047
ZYRO0G07172gna 6ON56793870.056
Skud_7.3534.195ON574156860.070
ABL003C4.195ON561128860.080
YGR055W (MUP1)4.195ON574368830.18
ZYRO0B08030g4.195ON578309820.24
NDAI0J019304.195ON590156810.34
NDAI0J008708.342ON837141810.35
NDAI0A01340singletonON554123800.36
Suva_13.517singletonON547159800.45
Smik_6.482na 7ON558148790.54
ZYRO0D03762g1.244ON60035780.73
Ecym_10561.50ON606139780.74
KNAG0D040704.195ON604156780.77
Suva_7.3374.195ON575156780.79
Smik_6.1394.195ON574156761.2
KLTH0A00308gsingletonON541111761.3
KLLA0A06930g1.244ON58774751.5
CAGL0K04367g4.195ON582156751.6
Kpol_543.791.244ON60536751.6
Kpol_543.78singletonON60536742.0
KAFR0D039401.83ON597114742.0
TPHA0G03770singletonON604126742.1
KNAG0B058204.195ON576159742.4
CAGL0B02838g4.195ON569156742.5
Kpol_1042.144.195ON586157732.6
Ecym_24504.195ON562147732.7
Skud_16.2na 7ON496124732.9
NCAS0J00140na 8ON558123723.6
KNAG0L00110na 8ON571150723.8
KAFR0A062504.195ON575156724.0
Ecym_60211.244ON60093724.1
KAFR0D007001.83ON574100714.8
Ecym_7299na 9ON54962715.0
Kpol_2000.641.84ON610132715.1
KLLA0A06886gsingletonON58785706.0
TPHA0B010604.195ON586152706.2
CAGL0M00154gsingletonON550170707.1
Suva_15.1481.368ON592147707.2
TBLA0B077605.158ON65887707.6
KLTH0B02046g5.158ON589105698.7
Suva_2.716singletonON60336699.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E14806g
         (578 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E14806g Chr5 (1222639..1224375) [1737 bp, 578 aa] {ON} simi...  1116   0.0  
Kwal_55.19721 s55 complement(95893..97626) [1734 bp, 577 aa] {ON...   890   0.0  
KLTH0E01144g Chr5 complement(113309..115027) [1719 bp, 572 aa] {...   875   0.0  
KLLA0E12959g Chr5 complement(1146299..1148038) [1740 bp, 579 aa]...   872   0.0  
ZYRO0G01474g Chr7 complement(113623..115341) [1719 bp, 572 aa] {...   587   0.0  
SAKL0G14762g Chr7 complement(1265378..1267075) [1698 bp, 565 aa]...   575   0.0  
SAKL0G15136g Chr7 complement(1303874..1305583) [1710 bp, 569 aa]...   574   0.0  
Suva_4.38 Chr4 (72470..74185) [1716 bp, 571 aa] {ON} YDL210W (REAL)   570   0.0  
NDAI0C03150 Chr3 complement(717726..719450) [1725 bp, 574 aa] {O...   570   0.0  
KLTH0G10736g Chr7 complement(902899..904605) [1707 bp, 568 aa] {...   564   0.0  
KLLA0E14675g Chr5 (1312581..1314302) [1722 bp, 573 aa] {ON} simi...   561   0.0  
KLTH0B08140g Chr2 complement(659691..661397) [1707 bp, 568 aa] {...   559   0.0  
YDL210W Chr4 (84270..85985) [1716 bp, 571 aa] {ON}  UGA4Permease...   556   0.0  
NCAS0D01600 Chr4 (299803..301533) [1731 bp, 576 aa] {ON} Anc_5.112    556   0.0  
Smik_4.30 Chr4 (62468..64183) [1716 bp, 571 aa] {ON} YDL210W (REAL)   552   0.0  
Kwal_23.4458 s23 (729606..731303) [1698 bp, 565 aa] {ON} YDL210W...   551   0.0  
TDEL0G01370 Chr7 (274664..276373) [1710 bp, 569 aa] {ON} Anc_5.112    546   0.0  
KNAG0E00820 Chr5 (152560..154275) [1716 bp, 571 aa] {ON} Anc_5.112    546   0.0  
SAKL0D01232g Chr4 complement(90918..92642) [1725 bp, 574 aa] {ON...   546   0.0  
Kwal_0.16 s0 complement(7307..9001) [1695 bp, 564 aa] {ON} YDL21...   543   0.0  
KLLA0E24993g Chr5 complement(2214864..2216570) [1707 bp, 568 aa]...   541   0.0  
Skud_4.46 Chr4 (81451..83166) [1716 bp, 571 aa] {ON} YDL210W (REAL)   537   0.0  
KNAG0K01030 Chr11 (202385..204130) [1746 bp, 581 aa] {ON} Anc_8....   537   0.0  
ZYRO0B15048g Chr2 complement(1226178..1227926) [1749 bp, 582 aa]...   536   0.0  
ABL116C Chr2 complement(181138..181889,181944..182826) [1635 bp,...   473   e-161
Ecym_4621 Chr4 complement(1216034..1217752) [1719 bp, 572 aa] {O...   467   e-159
Skud_7.205 Chr7 complement(365478..367166) [1689 bp, 562 aa] {ON...   158   3e-41
Suva_7.193 Chr7 complement(355063..356754) [1692 bp, 563 aa] {ON...   157   1e-40
TPHA0E02920 Chr5 (612901..614661) [1761 bp, 586 aa] {ON} Anc_6.2...   155   4e-40
YGL077C Chr7 complement(362225..363916) [1692 bp, 563 aa] {ON}  ...   153   2e-39
SAKL0A04730g Chr1 (432222..433847) [1626 bp, 541 aa] {ON} simila...   150   1e-38
AFL081W Chr6 (286339..287967) [1629 bp, 542 aa] {ON} Syntenic ho...   150   1e-38
Ecym_2212 Chr2 (417948..419585) [1638 bp, 545 aa] {ON} similar t...   148   1e-37
Smik_7.206 Chr7 complement(356650..358341) [1692 bp, 563 aa] {ON...   148   1e-37
TDEL0G01410 Chr7 (285255..286916) [1662 bp, 553 aa] {ON} Anc_6.2...   147   4e-37
NCAS0D03750 Chr4 complement(696686..698395) [1710 bp, 569 aa] {O...   146   6e-37
Kpol_1033.41 s1033 complement(106505..108265) [1761 bp, 586 aa] ...   146   8e-37
CAGL0H03399g Chr8 complement(316110..317780) [1671 bp, 556 aa] {...   144   4e-36
KNAG0D05140 Chr4 complement(937630..939261) [1632 bp, 543 aa] {O...   142   1e-35
KLTH0H04444g Chr8 (397467..399065) [1599 bp, 532 aa] {ON} simila...   142   1e-35
ZYRO0G08602g Chr7 complement(697178..698887) [1710 bp, 569 aa] {...   141   3e-35
NDAI0I01140 Chr9 (276535..278337) [1803 bp, 600 aa] {ON} Anc_6.205    141   5e-35
TBLA0A01960 Chr1 complement(473787..475571) [1785 bp, 594 aa] {O...   138   5e-34
KLLA0C15521g Chr3 complement(1347098..1348741) [1644 bp, 547 aa]...   137   5e-34
KAFR0K00360 Chr11 (79233..80849) [1617 bp, 538 aa] {ON} Anc_6.20...   129   4e-31
Kwal_56.24009 s56 complement(812371..813399) [1029 bp, 342 aa] {...   110   1e-25
Kwal_33.13806 s33 complement(401429..403078) [1650 bp, 549 aa] {...    99   4e-21
KLTH0F04576g Chr6 complement(404994..406643) [1650 bp, 549 aa] {...    96   5e-20
TBLA0C05740 Chr3 complement(1391698..1393677) [1980 bp, 659 aa] ...    93   5e-19
CAGL0M08272g Chr13 complement(823019..824884) [1866 bp, 621 aa] ...    88   1e-17
SAKL0C05126g Chr3 complement(488745..490451) [1707 bp, 568 aa] {...    85   1e-16
TPHA0E03350 Chr5 (709592..711535) [1944 bp, 647 aa] {ON} Anc_1.1...    85   2e-16
KLLA0A06666g Chr1 complement(603169..604851) [1683 bp, 560 aa] {...    81   2e-15
ZYRO0F00242g Chr6 (26301..27908) [1608 bp, 535 aa] {ON} similar ...    78   2e-14
NCAS0B08350 Chr2 (1593557..1595395) [1839 bp, 612 aa] {ON} Anc_1...    75   2e-13
ZYRO0G18700g Chr7 (1542876..1544651) [1776 bp, 591 aa] {ON} simi...    74   6e-13
KNAG0C00980 Chr3 complement(191133..193277) [2145 bp, 714 aa] {O...    73   8e-13
Kpol_2002.70 s2002 complement(159457..161325) [1869 bp, 622 aa] ...    72   1e-12
Ecym_8105 Chr8 (224611..226362) [1752 bp, 583 aa] {ON} similar t...    70   4e-12
KAFR0G00390 Chr7 complement(115188..117011) [1824 bp, 607 aa] {O...    70   7e-12
NDAI0A00890 Chr1 complement(181903..183828) [1926 bp, 641 aa] {O...    69   2e-11
SAKL0H11484g Chr8 complement(983765..985447) [1683 bp, 560 aa] {...    67   7e-11
TDEL0G02120 Chr7 complement(415216..416997) [1782 bp, 593 aa] {O...    66   2e-10
TDEL0G04830 Chr7 complement(891989..893620) [1632 bp, 543 aa] {O...    65   3e-10
Kthe_YGOB_SAKL0H11484g Chr5 complement(59674..60886,60889..61346...    64   8e-10
YNR056C Chr14 complement(731618..733303) [1686 bp, 561 aa] {ON} ...    63   1e-09
Smik_14.390 Chr14 complement(688421..690085) [1665 bp, 554 aa] {...    62   2e-09
Suva_11.49 Chr11 complement(105256..107115) [1860 bp, 619 aa] {O...    62   3e-09
Kwal_55.19602 s55 (43521..45197) [1677 bp, 558 aa] {ON} YNR056C ...    60   7e-09
AEL125C Chr5 complement(387763..389490) [1728 bp, 575 aa] {ON} S...    60   9e-09
Skud_11.51 Chr11 complement(106683..108533) [1851 bp, 616 aa] {O...    59   2e-08
Suva_14.415 Chr14 complement(716463..718061) [1599 bp, 532 aa] {...    59   2e-08
Skud_14.392 Chr14 complement(699671..701266) [1596 bp, 531 aa] {...    59   2e-08
YKL174C Chr11 complement(120380..122236) [1857 bp, 618 aa] {ON} ...    58   4e-08
Smik_11.55 Chr11 complement(105857..107716) [1860 bp, 619 aa] {O...    57   6e-08
KLLA0B00385g Chr2 complement(25847..27541) [1695 bp, 564 aa] {ON...    48   5e-05
NCAS0J01180 Chr10 (204451..206208) [1758 bp, 585 aa] {ON} Anc_4....    39   0.047
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...    38   0.056
Skud_7.353 Chr7 (586707..588431) [1725 bp, 574 aa] {ON} YGR055W ...    38   0.070
ABL003C Chr2 complement(390865..392550) [1686 bp, 561 aa] {ON} S...    38   0.080
YGR055W Chr7 (599417..601141) [1725 bp, 574 aa] {ON}  MUP1High a...    37   0.18 
ZYRO0B08030g Chr2 complement(626820..628556) [1737 bp, 578 aa] {...    36   0.24 
NDAI0J01930 Chr10 (480261..482033) [1773 bp, 590 aa] {ON} Anc_4....    36   0.34 
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...    36   0.35 
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}               35   0.36 
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...    35   0.45 
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...    35   0.54 
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...    35   0.73 
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...    35   0.74 
KNAG0D04070 Chr4 (733476..735290) [1815 bp, 604 aa] {ON} Anc_4.1...    35   0.77 
Suva_7.337 Chr7 (574716..576443) [1728 bp, 575 aa] {ON} YGR055W ...    35   0.79 
Smik_6.139 Chr6 (225355..227079) [1725 bp, 574 aa] {ON} YGR055W ...    34   1.2  
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...    34   1.3  
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...    33   1.5  
CAGL0K04367g Chr11 (413033..414781) [1749 bp, 582 aa] {ON} highl...    33   1.6  
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...    33   1.6  
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...    33   2.0  
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...    33   2.0  
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...    33   2.1  
KNAG0B05820 Chr2 (1144434..1146164) [1731 bp, 576 aa] {ON} Anc_4...    33   2.4  
CAGL0B02838g Chr2 complement(274984..276693) [1710 bp, 569 aa] {...    33   2.5  
Kpol_1042.14 s1042 (34979..36739) [1761 bp, 586 aa] {ON} (34979....    33   2.6  
Ecym_2450 Chr2 (875875..877563) [1689 bp, 562 aa] {ON} similar t...    33   2.7  
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...    33   2.9  
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}       32   3.6  
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...    32   3.8  
KAFR0A06250 Chr1 complement(1262105..1263832) [1728 bp, 575 aa] ...    32   4.0  
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...    32   4.1  
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...    32   4.8  
Ecym_7299 Chr7 (630846..632495) [1650 bp, 549 aa] {ON} similar t...    32   5.0  
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...    32   5.1  
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...    32   6.0  
TPHA0B01060 Chr2 complement(241062..242822) [1761 bp, 586 aa] {O...    32   6.2  
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...    32   7.1  
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...    32   7.2  
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...    32   7.6  
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...    31   8.7  
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...    31   9.3  

>SAKL0E14806g Chr5 (1222639..1224375) [1737 bp, 578 aa] {ON} similar
           to uniprot|P32837 Saccharomyces cerevisiae YDL210W UGA4
           Permease that serves as a gamma-aminobutyrate (GABA)
           transport protein involved in the utilization of GABA as
           a nitrogen source catalyzes the transport of putrescine
           and delta-aminolevulinic acid (ALA) localized to the
           vacuolar membrane
          Length = 578

 Score = 1116 bits (2887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/578 (95%), Positives = 552/578 (95%)

Query: 1   MATGYMSTSSSTKDMISARKSNVDIGVGNVAELRSITSAHGAPIRYIDAKNATSDQQVLA 60
           MATGYMSTSSSTKDMISARKSNVDIGVGNVAELRSITSAHGAPIRYIDAKNATSDQQVLA
Sbjct: 1   MATGYMSTSSSTKDMISARKSNVDIGVGNVAELRSITSAHGAPIRYIDAKNATSDQQVLA 60

Query: 61  EIGYKEELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAGPVGLSWGWFVAGGLILTV 120
           EIGYKEELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAGPVGLSWGWFVAGGLILTV
Sbjct: 61  EIGYKEELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAGPVGLSWGWFVAGGLILTV 120

Query: 121 GIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQQI 180
           GIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQQI
Sbjct: 121 GIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQQI 180

Query: 181 LSAVVVSNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCXXXXXXXX 240
           LSAVVVSNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNC        
Sbjct: 181 LSAVVVSNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCFLIILFFI 240

Query: 241 XXPIGVSRSDKLNHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMA 300
             PIGVSRSDKLNHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMA
Sbjct: 241 ALPIGVSRSDKLNHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMA 300

Query: 301 EEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDAL 360
           EEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDAL
Sbjct: 301 EEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDAL 360

Query: 361 GKRWTLAFLSFMIICQFLMGASTVVANSRQFWAFARDDALPFSNFFKKVNGSVAVPIRAV 420
           GKRWTLAFLSFMIICQFLMGASTVVANSRQFWAFARDDALPFSNFFKKVNGSVAVPIRAV
Sbjct: 361 GKRWTLAFLSFMIICQFLMGASTVVANSRQFWAFARDDALPFSNFFKKVNGSVAVPIRAV 420

Query: 421 WXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFYMGD 480
           W                EVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFYMGD
Sbjct: 421 WGSSILSLALGCLCLAGEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFYMGD 480

Query: 481 FWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQSKF 540
           FWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQSKF
Sbjct: 481 FWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQSKF 540

Query: 541 YEGPKSNLSDEEFAERVGDDVLDAILSSNVEVNNDRLS 578
           YEGPKSNLSDEEFAERVGDDVLDAILSSNVEVNNDRLS
Sbjct: 541 YEGPKSNLSDEEFAERVGDDVLDAILSSNVEVNNDRLS 578

>Kwal_55.19721 s55 complement(95893..97626) [1734 bp, 577 aa] {ON}
           YDL210W (UGA4) - GABA-specific transport protein [contig
           159] FULL
          Length = 577

 Score =  890 bits (2301), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/577 (73%), Positives = 484/577 (83%), Gaps = 1/577 (0%)

Query: 1   MATGYMSTSSSTKDMISARKSNVDIGVGNVAELRSITSAHGAPIRYIDAKNATSDQQVLA 60
           M    MS SSS  D I  RKSNV++ VG V ELR+ITSAHGAPIR++DA++ATSD+QVLA
Sbjct: 1   MDGNLMSASSSAMDTIKNRKSNVEVEVGQVRELRTITSAHGAPIRFVDARSATSDKQVLA 60

Query: 61  EIGYKEELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAGPVGLSWGWFVAGGLILTV 120
           E+GYKEELKREFS++QIFGVAFSIMGLLPSIAST+DGGL AGPVGL WGWF+AGGL+LT+
Sbjct: 61  ELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTI 120

Query: 121 GIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQQI 180
           GIALAELSSSIPTAGAVYVSCYQWAP R RK ISYSVGFLDTLSLCASVCSIVYGLAQQI
Sbjct: 121 GIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQI 180

Query: 181 LSAVVVSNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCXXXXXXXX 240
           LSAV+VSNP F VT+PITYGVFAAC+IAM +LTS+ + FTS++QTISIVSN         
Sbjct: 181 LSAVLVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIILFFI 240

Query: 241 XXPIGVSRSDKLNHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMA 300
             PIGVSRSDKL   FN+  FIFGK++N + WN GW+WCI G+ PAIWTIGAYDSCLHMA
Sbjct: 241 AVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMA 300

Query: 301 EEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDAL 360
           EEARDAVRAVP GIVGSI+ CWI+GWLICIVLLACMDP+++N++NS +GQG+TQ+ YDAL
Sbjct: 301 EEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDAL 360

Query: 361 GKRWTLAFLSFMIICQFLMGASTVVANSRQFWAFARDDALPFSNFFKKVNGSVAVPIRAV 420
           GKRWTL FLS  IICQFLMGASTVVANSRQFWAFARDD +PFSNFFKKV+ +  VP+RAV
Sbjct: 361 GKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVPVRAV 420

Query: 421 WXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFYMGD 480
           W                E A+ ALFSLS+AGMYMALIFPITLRLTYGK+DFRPGPFY+GD
Sbjct: 421 WGSSALSLALGCLCLVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYLGD 480

Query: 481 FWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQSKF 540
            WSPIINWI+V  Q F IIM+MFP     +D  TMNYTVVIGPGFWVLSLIYY+ WQ KF
Sbjct: 481 VWSPIINWIAVFAQAFMIIMMMFP-SDATVDPSTMNYTVVIGPGFWVLSLIYYFVWQRKF 539

Query: 541 YEGPKSNLSDEEFAERVGDDVLDAILSSNVEVNNDRL 577
           Y+GPKSNL+DEEF E VG+DV+DAI+S+NV    DR+
Sbjct: 540 YQGPKSNLTDEEFQEYVGEDVIDAIISNNVATQKDRM 576

>KLTH0E01144g Chr5 complement(113309..115027) [1719 bp, 572 aa] {ON}
           similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W Permease that serves as a gamma- aminobutyrate
           (GABA) transport protein involved in the utilization of
           GABA as a nitrogen source; catalyzes the transport of
           putrescine and delta-aminolevulinic acid (ALA);
           localized to the vacuolar membrane
          Length = 572

 Score =  875 bits (2262), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/564 (75%), Positives = 473/564 (83%), Gaps = 1/564 (0%)

Query: 6   MSTSSSTKDMISARKSNVDIGVGNVAELRSITSAHGAPIRYIDAKNATSDQQVLAEIGYK 65
           MS SSS K  I  RKS+VD+ VG + EL +ITSAHGAPIR++DA++ATSDQQVLAE+GYK
Sbjct: 1   MSASSSNKGTIKNRKSHVDVEVGQMRELGTITSAHGAPIRFVDARSATSDQQVLAELGYK 60

Query: 66  EELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAGPVGLSWGWFVAGGLILTVGIALA 125
           EELKREFS++QIFGVAFSIMGLLPSIAST+DGGL AGPVGL WGWF+AGGLILT+GIAL 
Sbjct: 61  EELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLILTIGIALG 120

Query: 126 ELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVV 185
           ELSS++PTAGAVYVSCYQWAP R RK ISYSVGFLDTLSL ASVCSIVYGLAQQILSAV+
Sbjct: 121 ELSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAVL 180

Query: 186 VSNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCXXXXXXXXXXPIG 245
           VSNPDF  TDPITYGVFAAC++ MA+LTSL S  TSKLQTISI+SNC          PIG
Sbjct: 181 VSNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIAIPIG 240

Query: 246 VSRSDKLNHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEARD 305
           VSRSD LN SFN   FIFG+ +N + WN GW+WCI GL PAIWTIGAYDSCLHMAEEARD
Sbjct: 241 VSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEARD 300

Query: 306 AVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKRWT 365
           AVRAVP GIVGSI  CWILGWL+CIV+LACM+PD++++++S +GQ +TQ+ YDALGKRWT
Sbjct: 301 AVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKRWT 360

Query: 366 LAFLSFMIICQFLMGASTVVANSRQFWAFARDDALPFSNFFKKVNGSVAVPIRAVWXXXX 425
           L FLS  IICQFLMGASTVVANSRQFWAFARDD  PFSNFFKKV+G   VP+RAVW    
Sbjct: 361 LGFLSIFIICQFLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAVWGSSA 420

Query: 426 XXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFYMGDFWSPI 485
                       E A+ ALFSLS+AGMYMALIFPITLRLTYGKKDFRPGPFY+GDFWSPI
Sbjct: 421 LSLALGCLCLVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFWSPI 480

Query: 486 INWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQSKFYEGPK 545
           INWISV FQ F IIM+MFP     +   TMNYTVVIGPGFWVLSLIYY+ WQ KFY+GPK
Sbjct: 481 INWISVFFQAFVIIMMMFP-SDSTVTPTTMNYTVVIGPGFWVLSLIYYFVWQRKFYKGPK 539

Query: 546 SNLSDEEFAERVGDDVLDAILSSN 569
           SNL+DEEF E VGDDV+DAI+S+N
Sbjct: 540 SNLTDEEFQEYVGDDVIDAIMSNN 563

>KLLA0E12959g Chr5 complement(1146299..1148038) [1740 bp, 579 aa]
           {ON} similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 579

 Score =  872 bits (2254), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/571 (73%), Positives = 478/571 (83%), Gaps = 2/571 (0%)

Query: 8   TSSSTKDMISARKSNVDIGVGNVAELRSITSAHGAPIRYIDAKNATSDQQVLAEIGYKEE 67
           +S + + +I+   SN +IG G+V+ELR +TSAHGAPIRYIDA +ATSD QVLAEIGYKEE
Sbjct: 11  SSGAVEHLINRNNSNDEIGFGSVSELRVVTSAHGAPIRYIDALSATSDTQVLAEIGYKEE 70

Query: 68  LKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAGPVGLSWGWFVAGGLILTVGIALAEL 127
           LKRE+ST+QIFGVAFSIMGLLPSIASTMDGGL AG VGL+WGWFVAGGLIL+VGIAL EL
Sbjct: 71  LKREYSTVQIFGVAFSIMGLLPSIASTMDGGLAAGAVGLNWGWFVAGGLILSVGIALGEL 130

Query: 128 SSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVS 187
           SSSIPTAGAVYV+CYQWAP +WRK ISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVV 
Sbjct: 131 SSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVG 190

Query: 188 NPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCXXXXXXXXXXPIGVS 247
           NPDF VTDPITYGVF AC++A+ VLTS+ S  T++LQT SI++N           PIGVS
Sbjct: 191 NPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSIIANVFLIILFFIVLPIGVS 250

Query: 248 RSDKLNHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEARDAV 307
           RSDK+  SFN A +IFG  +N TDWN GWSWCINGLTPAIWTIGAYDSCLHMAEEA+DA 
Sbjct: 251 RSDKV--SFNKASYIFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEAKDAR 308

Query: 308 RAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKRWTLA 367
           RAVPIGIV SI+SCWILGWLICIV+LACM+PD+N I+NSPYGQGITQVF DALGKRWTL 
Sbjct: 309 RAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLT 368

Query: 368 FLSFMIICQFLMGASTVVANSRQFWAFARDDALPFSNFFKKVNGSVAVPIRAVWXXXXXX 427
           FLS +IICQFLMGASTV+ANSRQFWAFARDD +PFS FFKKV+    VP+R++W      
Sbjct: 369 FLSLIIICQFLMGASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPMRSIWGSSFFS 428

Query: 428 XXXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFYMGDFWSPIIN 487
                     + AADALFSLSIAGMYMAL+FPI LRLTYG+KDFRPGPFY+G FWS    
Sbjct: 429 IALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYLGHFWSTANG 488

Query: 488 WISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQSKFYEGPKSN 547
           W++V FQLF ++MVMFPY +  I K+TMNYTVVIGPGFWVLSLIYY+ WQ KFYEGPKSN
Sbjct: 489 WLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIYYFVWQRKFYEGPKSN 548

Query: 548 LSDEEFAERVGDDVLDAILSSNVEVNNDRLS 578
           L+DEEF E VG+D +DA+LS+  + + D+LS
Sbjct: 549 LTDEEFVEAVGEDAIDAMLSNYSQAHQDKLS 579

>ZYRO0G01474g Chr7 complement(113623..115341) [1719 bp, 572 aa] {ON}
           similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 572

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/566 (52%), Positives = 393/566 (69%), Gaps = 14/566 (2%)

Query: 14  DMISARKSNV-DIGVGNV------AELRSITSAHGA-PIRYIDAKNATSDQQVLAEIGYK 65
           D  S R S V  +G G+V        +RSI S  GA  + YI+A  +  D Q+LAEIGYK
Sbjct: 3   DSKSLRISPVPSLGKGDVQVYTSAGRIRSIRSRTGAGEVNYINAATSNDDNQLLAEIGYK 62

Query: 66  EELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAGPVGLSWGWFVAGGLILTVGIALA 125
            EL+R+FSTLQ+FG+AFSIMGLLPSIAS +D GL  GPV   WGWF+AG  I  VG+ +A
Sbjct: 63  PELERKFSTLQVFGIAFSIMGLLPSIASELDDGLAGGPVSTVWGWFIAGIFIFLVGVTMA 122

Query: 126 ELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVV 185
           E SS+IPTAG +Y   Y +AP  ++ +IS+ +G  ++L+L A VCSI YG A+++L+AVV
Sbjct: 123 ENSSAIPTAGGLYFWTYHYAPEGYKAAISFVIGIGNSLALAAGVCSIDYGFAEEVLAAVV 182

Query: 186 VS-NPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCXXXXXXXXXXPI 244
           VS + ++ +T    YGV+A CVI   ++T +ASG+ +K+Q+ISI SN           PI
Sbjct: 183 VSKDGNWDITQGKLYGVYAGCVILTIMVTCVASGWLAKMQSISIYSNLFIIVLFLIALPI 242

Query: 245 GVSRSDKLNHS-FNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEA 303
           G     K+N   FN+  FIFGK EN +DW+ GW + + G TP +WTI ++DSC+H AEEA
Sbjct: 243 GT----KVNRGGFNDGSFIFGKFENLSDWSNGWQFFLAGFTPIVWTISSFDSCVHQAEEA 298

Query: 304 RDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKR 363
           +DA +AVPIGI+GSI  CWILGW+I IVL+AC+D D+N ++NSPY  G+ Q+ +D+LGK 
Sbjct: 299 KDASKAVPIGIMGSIFVCWILGWVINIVLMACIDKDMNRVMNSPYQLGMAQIIFDSLGKN 358

Query: 364 WTLAFLSFMIICQFLMGASTVVANSRQFWAFARDDALPFSNFFKKVNGSVAVPIRAVWXX 423
           WT+AFL+ M  CQFLMGAS++ A SRQ WAFARDD +P SN  KKV+    VP  A    
Sbjct: 359 WTIAFLALMAFCQFLMGASSMTAASRQIWAFARDDGMPLSNILKKVDSKFHVPFYASICS 418

Query: 424 XXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFYMGDFWS 483
                         + AA+ALFSL+IAG Y+A + P  LRLT+G+  FRPGPFY+G FWS
Sbjct: 419 GLMSLVLGLLILIDDAAAEALFSLAIAGNYLAWVTPNFLRLTWGRDVFRPGPFYLGKFWS 478

Query: 484 PIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQSKFYEG 543
           P++NW +V F  F IIMVMFP Q++ I+K+ MNY  VIGPG W+LSLIYY+ ++ K Y G
Sbjct: 479 PVVNWTTVVFMAFIIIMVMFPTQKNGINKENMNYACVIGPGTWLLSLIYYWVYKKKEYHG 538

Query: 544 PKSNLSDEEFAERVGDDVLDAILSSN 569
           PKSNL DEE+A+ VG +VLDAILS++
Sbjct: 539 PKSNLDDEEYADAVGPEVLDAILSTD 564

>SAKL0G14762g Chr7 complement(1265378..1267075) [1698 bp, 565 aa]
           {ON} similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 565

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/562 (54%), Positives = 395/562 (70%), Gaps = 5/562 (0%)

Query: 16  ISARKSNVDIGVGNVAELRSITSAHGA-PIRYIDAKNATSDQQVLAEIGYKEELKREFST 74
           +S  K    + +  +A LRS+ S  GA  + YI+A  A  D Q+LAEIGYK+ELKR+FST
Sbjct: 1   MSTDKLANSLSIQEIAALRSVRSRTGAGEVNYINAATANDDNQLLAEIGYKQELKRQFST 60

Query: 75  LQIFGVAFSIMGLLPSIASTMDGGLYAGPVGLSWGWFVAGGLILTVGIALAELSSSIPTA 134
           LQ+FG+AFSIMGLLPSIAS M GGL  GPV L WGWF+AG  IL +G+++AE +S+IPTA
Sbjct: 61  LQVFGIAFSIMGLLPSIASVMAGGLSGGPVTLVWGWFIAGFFILLIGLSMAESASAIPTA 120

Query: 135 GAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVS-NPDFVV 193
           G ++   + +AP  ++  IS+ +G  ++L+L + +CSI YGLAQ+IL+AVV+S + DF V
Sbjct: 121 GGLFYWTHYYAPEGYKNVISFIIGCSNSLALVSGLCSIDYGLAQEILAAVVISKDGDFEV 180

Query: 194 TDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCXXXXXXXXXXPIGVSRSDKLN 253
           T   TYGVFAA V+   + T LAS   S+LQT SIV+NC          PIG  R+    
Sbjct: 181 TSGKTYGVFAAAVVVTVLCTCLASSAISRLQTASIVANCFIIILLFIALPIGTKRN---M 237

Query: 254 HSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEARDAVRAVPIG 313
             FN+A +IFGK ENF+DWN GWS+C+ G  P IWTIGA+DSC+H +EEA+DA +AVPIG
Sbjct: 238 GGFNDASYIFGKFENFSDWNDGWSFCLQGFMPVIWTIGAFDSCVHQSEEAKDAKKAVPIG 297

Query: 314 IVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKRWTLAFLSFMI 373
           I+GSI  CWILGWLI IVL+AC+DPDL  ++++PYG  + Q+ Y++LGK W +AF+S + 
Sbjct: 298 IIGSITVCWILGWLILIVLMACVDPDLEKVLDNPYGFVLAQIVYESLGKSWAIAFMSLIA 357

Query: 374 ICQFLMGASTVVANSRQFWAFARDDALPFSNFFKKVNGSVAVPIRAVWXXXXXXXXXXXX 433
           +CQFLMGAS + A SRQ WAFARDD LP S + K V+ + +VPI AVW            
Sbjct: 358 VCQFLMGASVLTALSRQVWAFARDDGLPLSKYIKMVHTNWSVPIVAVWVAGCAGLVLGLL 417

Query: 434 XXXXEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFYMGDFWSPIINWISVAF 493
                 AA ALFSL++AG Y++   P  LRLT+GK  FRPGPFY+G FWSPIINW SV F
Sbjct: 418 CLIDAAAASALFSLAVAGNYLSWGTPTLLRLTFGKDIFRPGPFYLGKFWSPIINWTSVIF 477

Query: 494 QLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQSKFYEGPKSNLSDEEF 553
           Q F II+VMFP  QH +DK TMNY  VIGPG W+L+ IYY  ++ K+Y GPKSNL+DEE+
Sbjct: 478 QAFIIILVMFPASQHGVDKSTMNYACVIGPGIWILAWIYYMIYKKKYYHGPKSNLTDEEY 537

Query: 554 AERVGDDVLDAILSSNVEVNND 575
            E VG +V+D ILS+    + D
Sbjct: 538 VEAVGSNVIDEILSNTERTSKD 559

>SAKL0G15136g Chr7 complement(1303874..1305583) [1710 bp, 569 aa]
           {ON} similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 569

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/556 (53%), Positives = 388/556 (69%), Gaps = 5/556 (0%)

Query: 16  ISARKSNVDIGVGNVAELRSITSAHGA-PIRYIDAKNATSDQQVLAEIGYKEELKREFST 74
           I +R       + N+  +RS+ S  GA  + YI+A  A  D Q+LAEIGYK+ELKR+FST
Sbjct: 13  IVSRDKGTTSDLQNLHSVRSVRSRTGAGEVNYINAATANDDNQLLAEIGYKQELKRQFST 72

Query: 75  LQIFGVAFSIMGLLPSIASTMDGGLYAGPVGLSWGWFVAGGLILTVGIALAELSSSIPTA 134
           LQ+FG+AFSIMGLLPSIAS M GGL  GPV L WGWF+AG  IL +G+++AE +S+IPTA
Sbjct: 73  LQVFGIAFSIMGLLPSIASVMAGGLSGGPVTLVWGWFIAGFFILLIGLSMAENASAIPTA 132

Query: 135 GAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVS-NPDFVV 193
           G +Y   + +AP  ++  IS+ +G  ++L+L + VCSI YGLA++IL+AVV+S + DF V
Sbjct: 133 GGLYYWTHYYAPEGYKNVISFVIGCSNSLALVSGVCSIDYGLAEEILAAVVISKDGDFEV 192

Query: 194 TDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCXXXXXXXXXXPIGVSRSDKLN 253
           T   TYGVF A V AM + T LAS   S+LQT SIV+NC          PIG  R+    
Sbjct: 193 TSGKTYGVFVAAVFAMILCTCLASSAISRLQTTSIVANCFIIILLFIALPIGTKRN---M 249

Query: 254 HSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEARDAVRAVPIG 313
             FN+A +IFGK ENF+DWN GW +C+ G    +WTIGA+DSC+H +EEA+DA +AVPIG
Sbjct: 250 GGFNDASYIFGKFENFSDWNNGWQFCLQGFMTCVWTIGAFDSCVHQSEEAKDAKKAVPIG 309

Query: 314 IVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKRWTLAFLSFMI 373
           I+GSI  CWILGWLI IVL+AC+DPDL  ++++PYG  + Q+ Y++LGK W +AF+S + 
Sbjct: 310 IIGSITVCWILGWLILIVLMACVDPDLEKVLDNPYGFVLAQIVYESLGKSWAIAFMSLIA 369

Query: 374 ICQFLMGASTVVANSRQFWAFARDDALPFSNFFKKVNGSVAVPIRAVWXXXXXXXXXXXX 433
            CQFLMGAS + A SRQ WAFARDD LP S + K VN  ++VPI AVW            
Sbjct: 370 ACQFLMGASILTAVSRQIWAFARDDGLPLSKYIKMVNERLSVPIVAVWAGGLASVVLGLL 429

Query: 434 XXXXEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFYMGDFWSPIINWISVAF 493
                 AA ALFSL++AG Y++   P  LRLT+G+  FRPGPFY+G FWSPI+NW SV F
Sbjct: 430 CLIDSAAASALFSLAVAGNYLSWGTPTLLRLTFGRDIFRPGPFYLGKFWSPIVNWTSVLF 489

Query: 494 QLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQSKFYEGPKSNLSDEEF 553
           Q F I++VMFP  QH I K TMNY  VIGPG W+L+ +YY  ++ K+Y GPKSNL+DEE+
Sbjct: 490 QAFIIVVVMFPASQHGITKSTMNYACVIGPGIWILAWVYYMVYKKKYYHGPKSNLTDEEY 549

Query: 554 AERVGDDVLDAILSSN 569
            + VG  V+D +LS++
Sbjct: 550 VDAVGSIVIDEMLSNS 565

>Suva_4.38 Chr4 (72470..74185) [1716 bp, 571 aa] {ON} YDL210W (REAL)
          Length = 571

 Score =  570 bits (1470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/572 (51%), Positives = 391/572 (68%), Gaps = 11/572 (1%)

Query: 6   MSTSSSTKDMISA-RKSNVDIGV-----GNVAELRSITSAHGA-PIRYIDAKNATSDQQV 58
           MS SS  ++ I+  RK + D+G      G  + LRSI S  GA  + YI+A  + +D Q+
Sbjct: 1   MSMSSKNENKITVERKVSTDLGQAFQLQGLGSNLRSIRSKTGAGEVNYINASKSVNDHQL 60

Query: 59  LAEIGYKEELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAGPVGLSWGWFVAGGLIL 118
           LAEIGYK+ELKR+FSTLQ+FG+AFSIMGLLPSIAS M GGL  GP  L WGWFVAG  +L
Sbjct: 61  LAEIGYKQELKRQFSTLQVFGIAFSIMGLLPSIASVMGGGLDGGPASLLWGWFVAGFFLL 120

Query: 119 TVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQ 178
            VG+++AE +S+IPTAG +Y   Y +AP  +++ IS+ +G  ++L+L A VCSI YGLA+
Sbjct: 121 LVGMSMAEHASAIPTAGGLYYWTYYYAPEGYKEIISFIIGCSNSLALTAGVCSINYGLAE 180

Query: 179 QILSAVVVS-NPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCXXXXX 237
           +I +AV ++ + +F VT  + YG+FA  V+ M + T +ASG  ++LQT+SI SN      
Sbjct: 181 EIAAAVTLTKDGNFDVTRGMLYGIFAGAVVLMGLCTCIASGGIARLQTLSIASNVFIIIL 240

Query: 238 XXXXXPIGVSRSDKLNHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCL 297
                PIG  R+      FNN  FIFGK ENF+DWN GW +C+ G  PA+WTI ++DSC+
Sbjct: 241 LFIALPIGTKRN---MGGFNNGDFIFGKFENFSDWNNGWQFCLAGFMPAVWTINSFDSCV 297

Query: 298 HMAEEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFY 357
           H +EEA+DA ++VPIGI+ SI  CWILGW I I LLAC++PDL ++++S YG  + Q+ Y
Sbjct: 298 HQSEEAKDAKKSVPIGIILSILVCWILGWFIIICLLACINPDLASVLDSKYGFALAQIIY 357

Query: 358 DALGKRWTLAFLSFMIICQFLMGASTVVANSRQFWAFARDDALPFSNFFKKVNGSVAVPI 417
           D+LGK+W +AF+S +  CQFLMGAS   A SRQ WAF+RD+ LP S + KKV+   +VP 
Sbjct: 358 DSLGKKWAIAFMSLIAFCQFLMGASITTAVSRQVWAFSRDNGLPLSKYIKKVDSKYSVPF 417

Query: 418 RAVWXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFY 477
            A+                 + A +ALFSL++AG  +A   P  LRLT GK  FRPGPFY
Sbjct: 418 YAILAACVCSLVLGLLCLIDQAATNALFSLAVAGNNLAWSTPTVLRLTSGKDLFRPGPFY 477

Query: 478 MGDFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQ 537
           +G FWSPI+ W+ VAFQ+F I+MVMFP QQ  I K TMNYT VIGPG W+L+ IYY  ++
Sbjct: 478 LGKFWSPIVAWVGVAFQVFIIVMVMFPAQQKGITKATMNYTCVIGPGIWILAGIYYKVYK 537

Query: 538 SKFYEGPKSNLSDEEFAERVGDDVLDAILSSN 569
            K+Y GP +NLSDE++ + VG DV+D I+S  
Sbjct: 538 KKYYHGPATNLSDEDYVDAVGVDVIDTIISKQ 569

>NDAI0C03150 Chr3 complement(717726..719450) [1725 bp, 574 aa] {ON}
           Anc_5.112
          Length = 574

 Score =  570 bits (1470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/573 (51%), Positives = 394/573 (68%), Gaps = 14/573 (2%)

Query: 6   MSTSSSTKDM----ISARKSNVD--IGVGNVA-ELRSITSAHGA-PIRYIDAKNATSDQQ 57
           M++ SS KD+    +  R S  +  I + N+A  LRSI S  GA  + YI+A  + +D Q
Sbjct: 5   MTSESSKKDIKIINLEPRASTEEGSIELHNMASNLRSIISKTGAGEVNYINASKSVNDNQ 64

Query: 58  VLAEIGYKEELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAGPVGLSWGWFVAGGLI 117
           +LAEIGYK+ELKR+FSTLQ+FG+AFSIMGLLPSIAS M  G+  G V   WGWF+A   I
Sbjct: 65  LLAEIGYKQELKRQFSTLQVFGIAFSIMGLLPSIASVMGTGISGGSVSFVWGWFIASFFI 124

Query: 118 LTVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLA 177
           L VGI++AE +S+IPTAG +Y   Y +AP  +++  S+ +G  ++L+L A +CSI YGLA
Sbjct: 125 LLVGISMAENASAIPTAGGLYYWTYYYAPKGYKEVFSFIIGCSNSLALVAGLCSIDYGLA 184

Query: 178 QQILSAVVVS-NPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCXXXX 236
           ++I++AVVV+ + DF +TD   Y VF A VI MA+ TS+ASG  ++LQ ISIVSN     
Sbjct: 185 EEIMAAVVVTYDGDFNITDGRLYAVFLASVIVMALCTSMASGVIARLQNISIVSNLFIIV 244

Query: 237 XXXXXXPIGVSRSDKLNHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSC 296
                 P+G         +FN+A FIFG  ENF+DWNGGW +C+ G  PA+WTIG++DSC
Sbjct: 245 LLFIALPVGTKHK---RGTFNDASFIFGGFENFSDWNGGWQFCLTGFMPAVWTIGSFDSC 301

Query: 297 LHMAEEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVF 356
           +H +EEA+DA ++VP+GI+GSI++CWILGWLI I L+AC+DP L N++++ YG  + Q+ 
Sbjct: 302 VHQSEEAKDAKKSVPVGIIGSISACWILGWLIIICLMACIDPQLENVLDTQYGFPMAQLI 361

Query: 357 YDALGKRWTLAFLSFMIICQFLMGASTVVANSRQFWAFARDDALPFSNFFKKVNGSVAVP 416
           YD+LGK+WT+AFLS M  CQFLMG S   A SRQ WAF+RDD LPFS + K+V+ S  VP
Sbjct: 362 YDSLGKKWTIAFLSLMAFCQFLMGCSICTAISRQIWAFSRDDGLPFSKYIKQVHNS--VP 419

Query: 417 IRAVWXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPF 476
             A+                   AA+ALFSL++AG Y+A   P  LRLT G+  FRPGPF
Sbjct: 420 FFAILAACVSSLVLGLLCLIDATAANALFSLAVAGNYLAWCTPTLLRLTSGRDIFRPGPF 479

Query: 477 YMGDFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFW 536
           Y+G   SPI++WI V +++F IIM MFP QQH I+K  MNY  VIGPG W L+ IYY  +
Sbjct: 480 YLGKVLSPIVSWIGVLYEVFIIIMEMFPSQQHGINKTNMNYACVIGPGIWFLAWIYYLLY 539

Query: 537 QSKFYEGPKSNLSDEEFAERVGDDVLDAILSSN 569
           + K+Y GPK+NLSDEE+++ VG DV+D IL   
Sbjct: 540 KKKYYHGPKTNLSDEEYSDMVGIDVIDGILEQK 572

>KLTH0G10736g Chr7 complement(902899..904605) [1707 bp, 568 aa] {ON}
           similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a gamma-
           aminobutyrate (GABA) transport protein involved in the
           utilization of GABA as a nitrogen source catalyzes the
           transport of putrescine and delta-aminolevulinic acid
           (ALA) localized to the vacuolar membrane
          Length = 568

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/565 (49%), Positives = 385/565 (68%), Gaps = 4/565 (0%)

Query: 6   MSTSSSTKDMISARKSNVDIGVGNVAELRSITSAHGAPIRYIDAKNATSDQQVLAEIGYK 65
           +  +++T D+ S+ +   D G+     LR+ITS     + +IDAK A  D ++LAEIGYK
Sbjct: 4   VQAAANTTDVSSSIEPAAD-GLHQFGSLRTITSKRAGEVNFIDAKGANGDSELLAEIGYK 62

Query: 66  EELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAGPVGLSWGWFVAGGLILTVGIALA 125
           +EL R FST+Q+FGVAFSIMGLLPSIAS +  G+  G V L WGW +AG  IL VG  +A
Sbjct: 63  QELNRHFSTIQVFGVAFSIMGLLPSIASVLAIGMPGGMVSLMWGWLIAGIFILAVGCGMA 122

Query: 126 ELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVV 185
           EL+S+IPT+G +Y   Y ++P +++  +S+ +G  ++L+L A +CSI YGLAQ+ILS VV
Sbjct: 123 ELASAIPTSGGLYYYTYYYSPEKYKAFLSFVIGNTNSLALVAGLCSITYGLAQEILSIVV 182

Query: 186 VS-NPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCXXXXXXXXXXPI 244
           V+ + DF +T   TYGVF A + A   +TSLA+   SKLQT+SI++N           PI
Sbjct: 183 VAKDGDFNITSGKTYGVFVAGIAATTAVTSLATVAVSKLQTVSILANVGLIVLFFIVLPI 242

Query: 245 GVSRSDKLNHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEAR 304
           GV+ +  LN  FN+  FIFGK +N T W  GW + + GL PAIWTIGA+DSC+HM+EEA+
Sbjct: 243 GVANTKGLN--FNDGSFIFGKWQNETSWPDGWQFMMAGLQPAIWTIGAFDSCIHMSEEAK 300

Query: 305 DAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKRW 364
           +A +AVP+GI+ SI  CWILG+++CIV+ ACM P+++ I+ S YG  + Q+ ++ALGK+W
Sbjct: 301 NATKAVPVGIISSIGVCWILGFIVCIVIAACMGPNIDAILESSYGSPLPQILFNALGKKW 360

Query: 365 TLAFLSFMIICQFLMGASTVVANSRQFWAFARDDALPFSNFFKKVNGSVAVPIRAVWXXX 424
           T+AF++ +  CQFLMG S + A SRQ WAFARDD L FS + K VN  ++ P+RA W   
Sbjct: 361 TIAFMTLIAACQFLMGCSILTAISRQIWAFARDDGLMFSRYIKVVNKKLSSPLRATWFGA 420

Query: 425 XXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFYMGDFWSP 484
                          A++ALFSL+I G Y+A + P  LR+T GK  FRPG F+MG  WSP
Sbjct: 421 LCALVIGLLCLIGSTASNALFSLAIGGNYVAWMTPNLLRMTVGKDLFRPGAFFMGKLWSP 480

Query: 485 IINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQSKFYEGP 544
           I+NWI++ FQ F +IM+MFP    +I  DTMNYTVVI  G W+ S++Y+  ++ K + GP
Sbjct: 481 IVNWIAIIFQTFILIMIMFPADSKDITPDTMNYTVVICGGVWIGSIVYFLVYKKKAFHGP 540

Query: 545 KSNLSDEEFAERVGDDVLDAILSSN 569
           KSNLSDEE+A+ VG DV+D ILS  
Sbjct: 541 KSNLSDEEYADAVGQDVIDQILSHQ 565

>KLLA0E14675g Chr5 (1312581..1314302) [1722 bp, 573 aa] {ON} similar
           to uniprot|P32837 Saccharomyces cerevisiae YDL210W UGA4
           Permease that serves as a gamma-aminobutyrate (GABA)
           transport protein involved in the utilization of GABA as
           a nitrogen source catalyzes the transport of putrescine
           and delta-aminolevulinic acid (ALA) localized to the
           vacuolar membrane
          Length = 573

 Score =  561 bits (1447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/551 (50%), Positives = 377/551 (68%), Gaps = 7/551 (1%)

Query: 20  KSNVDIGVGNVAELRSITSAHGAPIRYIDAKNATSDQQVLAEIGYKEELKREFSTLQIFG 79
           K+ VD+    V  LR+ITS     + YI+AK A  D ++LAEIGYK+EL+R FS  Q+FG
Sbjct: 22  KNRVDV----VTSLRTITSRRVGDVNYINAKTAHDDTELLAEIGYKQELQRHFSKTQVFG 77

Query: 80  VAFSIMGLLPSIASTMDGGLYAGPVGLSWGWFVAGGLILTVGIALAELSSSIPTAGAVYV 139
           VAFSIMGLLPSIAS +   L  G V L WGW ++G  +L  G+A++EL+S+IPT+G +Y 
Sbjct: 78  VAFSIMGLLPSIASILGVALPGGSVSLVWGWAISGAFVLANGLAMSELASAIPTSGGLYY 137

Query: 140 SCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVV-SNPDFVVTDPIT 198
             + +AP + +  +S+ VG  ++L+L + +CSI YGLA +ILS VVV SN +F +T+  T
Sbjct: 138 YTHYYAPPKVKNFLSFIVGNCNSLALISCLCSINYGLAGEILSIVVVGSNGNFNITNANT 197

Query: 199 YGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCXXXXXXXXXXPIGVSRSDKLNHSFNN 258
           YGV+AAC+IA AV+TS+A+   S+LQT SIVSN           P+GV+RS  +   FN+
Sbjct: 198 YGVYAACIIATAVVTSVATTAVSRLQTFSIVSNLLLICIFFVVLPVGVARSKDME--FND 255

Query: 259 AKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEARDAVRAVPIGIVGSI 318
           A +IFG  EN +DWN GW + + G  P IW IG +DSCLHM+EEA++A  +VP GI+GSI
Sbjct: 256 AAYIFGDFENLSDWNNGWQFMLAGFQPLIWVIGGFDSCLHMSEEAKNATASVPFGIIGSI 315

Query: 319 ASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKRWTLAFLSFMIICQFL 378
           + CW LG+ ICIV+ AC   D+  ++N+ + Q + QV +DALGK+WT+A ++ +  CQFL
Sbjct: 316 SVCWFLGFFICIVIAACSSQDVAALVNTKFHQPLAQVLFDALGKKWTIAIMTLIAFCQFL 375

Query: 379 MGASTVVANSRQFWAFARDDALPFSNFFKKVNGSVAVPIRAVWXXXXXXXXXXXXXXXXE 438
           M AS++ A SRQ WAFARDD LPFS++ K VN  ++ P+RA W                 
Sbjct: 376 MAASSLTAISRQIWAFARDDGLPFSSWIKVVNVKLSSPLRATWVGAGVALAIGCLCLIGP 435

Query: 439 VAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFYMGDFWSPIINWISVAFQLFTI 498
           VA+ ALFSL I+  Y + + P  LR+TYGK  F PG F+MG + SP++NWIS+ F+LF I
Sbjct: 436 VASSALFSLYISANYFSWMLPNLLRMTYGKDVFTPGAFFMGKYLSPVVNWISIIFELFMI 495

Query: 499 IMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQSKFYEGPKSNLSDEEFAERVG 558
           ++V FP +QH I  DTMNY+VV     W L+ IYY+ ++ KFY+GPKSNL+DEE+ E VG
Sbjct: 496 LLVFFPTEQHGITPDTMNYSVVFIGAVWFLATIYYFIYKHKFYKGPKSNLTDEEYEENVG 555

Query: 559 DDVLDAILSSN 569
            DVLDAILS +
Sbjct: 556 QDVLDAILSKS 566

>KLTH0B08140g Chr2 complement(659691..661397) [1707 bp, 568 aa] {ON}
           similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a gamma-
           aminobutyrate (GABA) transport protein involved in the
           utilization of GABA as a nitrogen source catalyzes the
           transport of putrescine and delta-aminolevulinic acid
           (ALA) localized to the vacuolar membrane
          Length = 568

 Score =  559 bits (1440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/553 (50%), Positives = 381/553 (68%), Gaps = 6/553 (1%)

Query: 21  SNVDIGVGNVAE---LRSITSAHGAPIRYIDAKNATSDQQVLAEIGYKEELKREFSTLQI 77
           S+++  VG++ +   LR+ITS     + +IDAK A  D ++LAEIGYK+EL R FST+Q+
Sbjct: 15  SSLEQAVGDIHQIGSLRTITSKRAGEVNFIDAKRAHGDAELLAEIGYKQELNRHFSTVQV 74

Query: 78  FGVAFSIMGLLPSIASTMDGGLYAGPVGLSWGWFVAGGLILTVGIALAELSSSIPTAGAV 137
           FGVAFSIMGLLPSIAS +  G+  G V L WGWF+AG  IL VG  ++EL+S+IPT+G +
Sbjct: 75  FGVAFSIMGLLPSIASVLAIGMPGGMVSLVWGWFIAGIFILAVGCGMSELASAIPTSGGL 134

Query: 138 YVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVS-NPDFVVTDP 196
           Y   Y +AP +++   S+ +G+ ++L+L + +CSI YGLA++ILS VVVS + DF +T+ 
Sbjct: 135 YYYTYYYAPQKYKAFFSFVIGYSNSLALVSGLCSITYGLAEEILSIVVVSKDGDFTITNG 194

Query: 197 ITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCXXXXXXXXXXPIGVSRSDKLNHSF 256
            TYGVF A + A  V+TS+A+   SKLQT+SI++N           PIGV+ +  L+  F
Sbjct: 195 KTYGVFVAGIAATTVVTSIATVAVSKLQTVSILANVGLIVLFFIVLPIGVANTKGLD--F 252

Query: 257 NNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEARDAVRAVPIGIVG 316
           N+  FIFGK  N T W  GW + + GL PAIWTIGA+DSC+HM+EEA++A +AVP+GI+ 
Sbjct: 253 NDGSFIFGKWLNETTWPDGWQFMLAGLQPAIWTIGAFDSCIHMSEEAKNATKAVPLGIIS 312

Query: 317 SIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKRWTLAFLSFMIICQ 376
           SI+ CWILG+LICIV+ ACM PD++ I+ S +G  + Q+ Y+ALGK+WT+A ++ +  CQ
Sbjct: 313 SISVCWILGFLICIVMAACMGPDIDAILGSSFGSPLPQILYNALGKKWTIAIMTLIAACQ 372

Query: 377 FLMGASTVVANSRQFWAFARDDALPFSNFFKKVNGSVAVPIRAVWXXXXXXXXXXXXXXX 436
           FLMG S + A SRQ WAFARDD L FS + K VN  ++ P+RA W               
Sbjct: 373 FLMGCSILTAISRQIWAFARDDGLMFSKYIKVVNKKLSSPLRATWFGAVCALVIGLLCLI 432

Query: 437 XEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFYMGDFWSPIINWISVAFQLF 496
              A++ALFSL I G Y+A + P  LR+T GK  FRPG FYMG  WSPI+NW ++ FQ+F
Sbjct: 433 GGTASNALFSLGIGGNYLAWMAPNLLRMTTGKDLFRPGAFYMGKTWSPIVNWTAIVFQIF 492

Query: 497 TIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQSKFYEGPKSNLSDEEFAER 556
            +IM+MFP +   I  D MNYTVVI  G W+ S+IY++ ++ K + GPKSNLSD+E+ + 
Sbjct: 493 ILIMIMFPAESKGITPDAMNYTVVICGGVWIGSMIYFFVYKKKAFNGPKSNLSDDEYVDA 552

Query: 557 VGDDVLDAILSSN 569
           VG DV+D ILS  
Sbjct: 553 VGQDVIDQILSHQ 565

>YDL210W Chr4 (84270..85985) [1716 bp, 571 aa] {ON}  UGA4Permease
           that serves as a gamma-aminobutyrate (GABA) transport
           protein involved in the utilization of GABA as a
           nitrogen source; catalyzes the transport of putrescine
           and delta-aminolevulinic acid (ALA); localized to the
           vacuolar membrane
          Length = 571

 Score =  556 bits (1433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/572 (50%), Positives = 385/572 (67%), Gaps = 11/572 (1%)

Query: 6   MSTSSSTKDMISARKS-NVDIGV-----GNVAELRSITSAHGA-PIRYIDAKNATSDQQV 58
           MS SS  ++ IS  +  + DIG      G  + LRSI S  GA  + YIDA  + +D Q+
Sbjct: 1   MSMSSKNENKISVEQRISTDIGQAYQLQGLGSNLRSIRSKTGAGEVNYIDAAKSVNDNQL 60

Query: 59  LAEIGYKEELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAGPVGLSWGWFVAGGLIL 118
           LAEIGYK+ELKR+FSTLQ+FG+AFSIMGLLPSIAS M GGL  GP  L WGWFVA   IL
Sbjct: 61  LAEIGYKQELKRQFSTLQVFGIAFSIMGLLPSIASVMGGGLGGGPATLVWGWFVAAFFIL 120

Query: 119 TVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQ 178
            VGI +AE +SSIPTAG +Y   Y +AP  +++ IS+ +G  ++L+L A VCSI YGLA+
Sbjct: 121 LVGITMAEHASSIPTAGGLYYWTYYYAPEGYKEIISFIIGCSNSLALAAGVCSIDYGLAE 180

Query: 179 QILSAVVVS-NPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCXXXXX 237
           +I +AV ++ + +F VT    YG+FA  V+ M + T +ASG  ++LQT+SI +N      
Sbjct: 181 EIAAAVTLTKDGNFEVTSGKLYGIFAGAVVVMCICTCVASGAIARLQTLSIFANLFIIVL 240

Query: 238 XXXXXPIGVSRSDKLNHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCL 297
                PIG          FN+  FIFGK EN +DWN GW +C+ G  PA+WTIG++DSC+
Sbjct: 241 LFIALPIGTKHR---MGGFNDGDFIFGKYENLSDWNNGWQFCLAGFMPAVWTIGSFDSCV 297

Query: 298 HMAEEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFY 357
           H +EEA+DA ++VPIGI+ SIA CWILGWLI I L+AC++PD++++++S YG  + Q+ Y
Sbjct: 298 HQSEEAKDAKKSVPIGIISSIAVCWILGWLIIICLMACINPDIDSVLDSKYGFALAQIIY 357

Query: 358 DALGKRWTLAFLSFMIICQFLMGASTVVANSRQFWAFARDDALPFSNFFKKVNGSVAVPI 417
           D+LGK+W +AF+S +  CQFLMGAS   A SRQ WAF+RD+ LP S + K+V+   +VP 
Sbjct: 358 DSLGKKWAIAFMSLIAFCQFLMGASITTAVSRQVWAFSRDNGLPLSKYIKRVDSKYSVPF 417

Query: 418 RAVWXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFY 477
            A+                 + A DALFSL++AG  +A   P   RLT G+  FRPGPFY
Sbjct: 418 FAILAACVGSLILGLLCLIDDAATDALFSLAVAGNNLAWSTPTVFRLTSGRDLFRPGPFY 477

Query: 478 MGDFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQ 537
           +G  WSPI+ W  VAFQLF II+VMFP QQH I K TMNY  VIGPG W+L+ IYY  ++
Sbjct: 478 LGKIWSPIVAWTGVAFQLFIIILVMFPSQQHGITKSTMNYACVIGPGIWILAGIYYKVYK 537

Query: 538 SKFYEGPKSNLSDEEFAERVGDDVLDAILSSN 569
            K+Y GP +NLSD+++ E VG DV+D I+S  
Sbjct: 538 KKYYHGPATNLSDDDYTEAVGADVIDTIMSKQ 569

>NCAS0D01600 Chr4 (299803..301533) [1731 bp, 576 aa] {ON} Anc_5.112
          Length = 576

 Score =  556 bits (1432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/575 (48%), Positives = 381/575 (66%), Gaps = 15/575 (2%)

Query: 7   STSSSTKDM----ISARKSN-----VDIGVGNVAELRSITSAHGA-PIRYIDAKNATSDQ 56
           S  S  KD     I AR S      VDI   N + +RSI S  GA  + YI++  + +D 
Sbjct: 5   SNRSDDKDFKSISIEARVSTEAGSAVDIRNVN-SHIRSIRSKTGAGEVNYINSATSVTDN 63

Query: 57  QVLAEIGYKEELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAGPVGLSWGWFVAGGL 116
           Q+LAEIGYK+ELKR+FST Q+FG+AFSIMGLLPSIAS M  G+  GP    WGWF+A   
Sbjct: 64  QLLAEIGYKQELKRQFSTFQVFGIAFSIMGLLPSIASVMGTGISGGPTTFVWGWFIASIF 123

Query: 117 ILTVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGL 176
            + +GI++AE +S+IPTAG +Y   Y +AP  ++K IS+ +G  ++L+L A +CSI YGL
Sbjct: 124 TIFIGISMAENASAIPTAGGLYYWTYYYAPEGFKKVISFVIGCSNSLALAAGLCSIDYGL 183

Query: 177 AQQILSAVVVS-NPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCXXX 235
           A++I++AVV++ + DF VT    YG+FAA V+ M + T ++SG  +++Q+ SI SN    
Sbjct: 184 AEEIMAAVVLTFDGDFDVTSGKLYGIFAAAVVVMGICTCISSGAIARMQSFSIASNLFII 243

Query: 236 XXXXXXXPIGVSRSDKLNHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDS 295
                  PIG  R+      FN+AKFIFGK ENF+DWN GW +C+ G  PA+WTIG++DS
Sbjct: 244 VLLFIALPIGTKRN---RGEFNDAKFIFGKFENFSDWNSGWQFCMAGFMPAVWTIGSFDS 300

Query: 296 CLHMAEEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQV 355
           C+H +EEA+DA ++VPIGI+ SIA+CWILGWLI IVL+AC+DP+L N++++ YG  + Q+
Sbjct: 301 CVHQSEEAKDAKKSVPIGIIASIAACWILGWLIIIVLMACIDPNLENVVDTKYGFPMAQL 360

Query: 356 FYDALGKRWTLAFLSFMIICQFLMGASTVVANSRQFWAFARDDALPFSNFFKKVNGSVAV 415
            YD+LGKRW + F+S M  CQFLMG S   A SRQ WAF+RDD LP S + K V+   +V
Sbjct: 361 IYDSLGKRWAITFMSLMAFCQFLMGCSICTAISRQIWAFSRDDGLPLSKYIKIVDKRYSV 420

Query: 416 PIRAVWXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGP 475
           P  A+                   AA+ALFSL++AG Y+A   P  LR T G+  FRPGP
Sbjct: 421 PFNAIIAACVTCLVLGLLCLIDSTAANALFSLAVAGNYLAWSIPTLLRFTTGRDLFRPGP 480

Query: 476 FYMGDFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYF 535
           FY+G   S I+ W  + ++ F IIMVMFP Q++ I+K  MNY  VIGPG W LS IYY  
Sbjct: 481 FYLGKPLSAIVGWTGICYEFFIIIMVMFPTQKNGINKTNMNYACVIGPGIWFLSWIYYIA 540

Query: 536 WQSKFYEGPKSNLSDEEFAERVGDDVLDAILSSNV 570
           ++ K++ GPK+NLS++++ E V  D +D I+ S +
Sbjct: 541 YKKKYFRGPKTNLSEDDYEEMVAIDNIDEIMMSKI 575

>Smik_4.30 Chr4 (62468..64183) [1716 bp, 571 aa] {ON} YDL210W (REAL)
          Length = 571

 Score =  552 bits (1423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/572 (50%), Positives = 388/572 (67%), Gaps = 11/572 (1%)

Query: 6   MSTSSSTKDMIS-ARKSNVDIGV-----GNVAELRSITSAHGA-PIRYIDAKNATSDQQV 58
           MS SS  ++ I+  ++ + D+G      G  + LRSI S  GA  + YIDA  + +D Q+
Sbjct: 1   MSMSSKNENKITIEQRVSTDVGQAYQLQGLGSNLRSIRSKTGAGEVNYIDAAKSVNDNQL 60

Query: 59  LAEIGYKEELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAGPVGLSWGWFVAGGLIL 118
           LAEIGYK+ELKR+FST+Q+FG+AFSIMGLLPSIAS M GGL  GP  L WGWF+A   IL
Sbjct: 61  LAEIGYKQELKRQFSTIQVFGIAFSIMGLLPSIASVMGGGLGGGPATLVWGWFIAAFFIL 120

Query: 119 TVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQ 178
            VGI +AE +SSIPTAG +Y   Y +AP  +++ IS+ +G  ++L+L A VCSI YGLA+
Sbjct: 121 LVGITMAEHASSIPTAGGLYYWTYYYAPEGYKEIISFIIGCSNSLALAAGVCSIDYGLAE 180

Query: 179 QILSAVVVS-NPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCXXXXX 237
           +I +A+ ++ + +F VT    YG+FA  V+ M + T +ASG  ++LQT+SI +N      
Sbjct: 181 EIAAAITLTKDGNFDVTSGKLYGIFAGAVVVMGICTCIASGAIARLQTLSIFANLFIIVL 240

Query: 238 XXXXXPIGVSRSDKLNHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCL 297
                PIG   +      FNN  FIFGK EN +DWN GW +C+ G  PA+WTIG++DSC+
Sbjct: 241 LFIALPIGTKHNIG---GFNNGDFIFGKYENLSDWNKGWQFCLAGFMPAVWTIGSFDSCV 297

Query: 298 HMAEEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFY 357
           H +EEA+DA ++VPIGI+ SI  CWILGWLI I L+AC++PD++++++S YG  + Q+ Y
Sbjct: 298 HQSEEAKDAKKSVPIGIISSITVCWILGWLIIICLMACINPDIDSVLDSKYGFALAQIIY 357

Query: 358 DALGKRWTLAFLSFMIICQFLMGASTVVANSRQFWAFARDDALPFSNFFKKVNGSVAVPI 417
           D+LGK+W +AF+S +  CQFLMGAS   A SRQ WAF+RD+ LP S + K+V+   +VP 
Sbjct: 358 DSLGKKWAIAFMSLIAFCQFLMGASITTAVSRQVWAFSRDNGLPLSKYIKRVDSKYSVPF 417

Query: 418 RAVWXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFY 477
            A+                 + A DALFSL++AG  +A   P  LRLT G+  FRPGPFY
Sbjct: 418 FAILAACAGSLILGLLCLIDDAATDALFSLAVAGNNLAWSTPTVLRLTSGRDLFRPGPFY 477

Query: 478 MGDFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQ 537
           +G  WSPI+ WI VAFQ+F II+VMFP QQH I K TMNY  VIGPG W L+ +YY  ++
Sbjct: 478 LGKIWSPIVAWIGVAFQVFIIILVMFPAQQHGITKSTMNYACVIGPGIWFLAGVYYKVYK 537

Query: 538 SKFYEGPKSNLSDEEFAERVGDDVLDAILSSN 569
            K+Y GP +NLSD+++AE VG DV+D I+S  
Sbjct: 538 KKYYHGPATNLSDDDYAEAVGIDVIDTIISKQ 569

>Kwal_23.4458 s23 (729606..731303) [1698 bp, 565 aa] {ON} YDL210W
           (UGA4) - 1:1 [contig 2] FULL
          Length = 565

 Score =  551 bits (1420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/561 (50%), Positives = 380/561 (67%), Gaps = 6/561 (1%)

Query: 13  KDMISARKSNVDIGVGNVAE---LRSITSAHGAPIRYIDAKNATSDQQVLAEIGYKEELK 69
           K  ++  + +   G+G + +   LR+ITS     + +IDAK A  D+++LAEIGYK+EL 
Sbjct: 4   KQNVNVSEGSAQSGLGEIRQIGSLRTITSKRAGEVNFIDAKGARDDKELLAEIGYKQELN 63

Query: 70  REFSTLQIFGVAFSIMGLLPSIASTMDGGLYAGPVGLSWGWFVAGGLILTVGIALAELSS 129
           R FST+Q+FGVAFSIMGLLPSIAS +  G   G V L WGW +AG  I+T+G+++AEL+S
Sbjct: 64  RHFSTVQVFGVAFSIMGLLPSIASVLSIGFAGGAVALVWGWLIAGFFIMTIGLSMAELAS 123

Query: 130 SIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVS-N 188
           +IPT+G +Y   Y +AP R++  +S+ +G  ++L+L A +CSI YGLA +ILS VVVS +
Sbjct: 124 AIPTSGGLYYYTYYYAPQRFKSFLSFVIGNSNSLALTAGLCSITYGLALEILSIVVVSKD 183

Query: 189 PDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCXXXXXXXXXXPIGVSR 248
            +F +T+  TYGV+   + A AV+TS+A+   SK+QT+SI+SN           PIGVS 
Sbjct: 184 GNFEITNGKTYGVYVGGIAATAVVTSVATVAVSKMQTLSIISNVALIAFFLIVLPIGVSN 243

Query: 249 SDKLNHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEARDAVR 308
           +  L   FN+  FIFGK  N T W  GW + + GL PAIWTIGA+DSC+HM+EEA++A +
Sbjct: 244 TKGLE--FNDGSFIFGKFMNETSWPDGWQFLMAGLQPAIWTIGAFDSCIHMSEEAKNATK 301

Query: 309 AVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKRWTLAF 368
           AVPIGI+ SI  CW+LG+ ICI + ACM PD++ I+ S +G  + Q+ Y+ALGK+WT+ F
Sbjct: 302 AVPIGIISSIFVCWVLGFFICIAIAACMGPDIDAILGSSFGSPLAQILYNALGKKWTITF 361

Query: 369 LSFMIICQFLMGASTVVANSRQFWAFARDDALPFSNFFKKVNGSVAVPIRAVWXXXXXXX 428
           +S +  CQF MG S + A SRQ WAFARDD L F  +FK VN  ++ PIRA W       
Sbjct: 362 MSLIAFCQFAMGCSILTAISRQIWAFARDDGLMFPKYFKVVNKKLSSPIRATWFGAACAL 421

Query: 429 XXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFYMGDFWSPIINW 488
                      AA+ALFSL I G Y+A + P  LR+T GK  FRPG F+MG+FWSPI+NW
Sbjct: 422 VIGLLCLIGGTAANALFSLGIGGNYLAWMTPNLLRMTVGKDLFRPGQFHMGEFWSPIVNW 481

Query: 489 ISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQSKFYEGPKSNL 548
            S+ FQ+F I M+MFP ++  I  DTMNYTVVI  G W  S+IYY  ++ K + GPKSNL
Sbjct: 482 TSIVFQIFIIFMIMFPAEKVGITPDTMNYTVVICGGVWFGSMIYYAVYKYKVFHGPKSNL 541

Query: 549 SDEEFAERVGDDVLDAILSSN 569
           +DEEF+E VG DV+D ILS  
Sbjct: 542 TDEEFSEVVGQDVIDQILSHQ 562

>TDEL0G01370 Chr7 (274664..276373) [1710 bp, 569 aa] {ON} Anc_5.112
          Length = 569

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/544 (52%), Positives = 379/544 (69%), Gaps = 8/544 (1%)

Query: 31  AELRSITSAHGA-PIRYIDAKNATSDQQVLAEIGYKEELKREFSTLQIFGVAFSIMGLLP 89
           +++R + S  GA  + YI++  + +D Q+LAEIGYK+ELKR+FSTLQ+FGVAFSIMGLLP
Sbjct: 31  SDVRYVRSKTGAGEVNYINSATSVNDGQLLAEIGYKQELKRQFSTLQVFGVAFSIMGLLP 90

Query: 90  SIASTMDGGLYAGPVGLSWGWFVAGGLILTVGIALAELSSSIPTAGAVYVSCYQWAPARW 149
           SIAS M GGL  GPV L WGWF+A   IL VGI +AE +S+IPTAG +Y   Y +AP  +
Sbjct: 91  SIASVMGGGLTGGPVTLVWGWFIAAFFILLVGITMAENASAIPTAGGLYYWTYYYAPKGY 150

Query: 150 RKSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVS-NPDFVVTDPITYGVFAACVIA 208
           ++ +S+ +G  ++L+L A VCSI YG A ++L+AVV+S + DF VT   TYG+FAA V+A
Sbjct: 151 KEIVSFVIGCSNSLALSAGVCSISYGFALEVLAAVVISRDGDFEVTTGKTYGIFAAVVVA 210

Query: 209 MAVLTSLASGFTSKLQTISIVSNCXXXXXXXXXXPIGVSRSDKLNHS-FNNAKFIFGKSE 267
             V+T L+SG  ++LQT+SIVSN           PIG     K+N   FNN +FIFG  +
Sbjct: 211 QGVVTCLSSGLVARLQTLSIVSNVFIMILLFIALPIGA----KVNRGGFNNGEFIFGTYQ 266

Query: 268 NFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEARDAVRAVPIGIVGSIASCWILGWL 327
           NF+DWN GW +C+ G  PA+WTIG++DSC+H +EEA+DA ++VPIGI+GSIA+CWILGWL
Sbjct: 267 NFSDWNSGWQFCLAGFMPAVWTIGSFDSCVHQSEEAKDAKKSVPIGIIGSIAACWILGWL 326

Query: 328 ICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKRWTLAFLSFMIICQFLMGASTVVAN 387
           I I L+ACMD D++ ++++ Y   + Q+ YD LGK W +AF++ +  CQFLMGAS V A 
Sbjct: 327 IIICLMACMDSDISKVLDTDYEIILAQIVYDCLGKNWAIAFMALIAFCQFLMGASIVTAA 386

Query: 388 SRQFWAFARDDALPFSNFFKKVNGSVAVPIRAVWXXXXXXXXXXXXXXXXEVAADALFSL 447
           SRQ WAFARDD LP S + KKV+   +VP  A+                   AA ALFSL
Sbjct: 387 SRQIWAFARDDGLPLSKYIKKVDKKYSVPFVAI-IAACVASLLLGLLCLDAAAAAALFSL 445

Query: 448 SIAGMYMALIFPITLRLTYGKKDFRPGPFYMGDFWSPIINWISVAFQLFTIIMVMFPYQQ 507
           ++AG  +A   P  LRLT+G+  FRPGPFY+G  WSPII WI V +Q F II+VMFP  +
Sbjct: 446 AVAGNNLAWSTPTFLRLTWGRDLFRPGPFYLGKLWSPIIAWIGVVYQAFIIILVMFPSAR 505

Query: 508 HNIDKDTMNYTVVIGPGFWVLSLIYYYFWQSKFYEGPKSNLSDEEFAERVGDDVLDAILS 567
           H +   TMNY  VIGPG W+LS IYY  ++ K++ GPKSNLSDE++ E VG+D+++ ILS
Sbjct: 506 HGLTPQTMNYACVIGPGLWILSWIYYMVYRKKYFHGPKSNLSDEDYNEAVGEDLIEEILS 565

Query: 568 SNVE 571
              E
Sbjct: 566 RKGE 569

>KNAG0E00820 Chr5 (152560..154275) [1716 bp, 571 aa] {ON} Anc_5.112
          Length = 571

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/538 (51%), Positives = 367/538 (68%), Gaps = 5/538 (0%)

Query: 31  AELRSITSAHGA-PIRYIDAKNATSDQQVLAEIGYKEELKREFSTLQIFGVAFSIMGLLP 89
           + +R++ S  GA  + YI++  + SD Q+LAEIGYK ELKR+FSTLQ+FG+AFSIMGLLP
Sbjct: 32  SRVRTVRSHTGAGEVNYINSVQSVSDNQLLAEIGYKPELKRQFSTLQVFGIAFSIMGLLP 91

Query: 90  SIASTMDGGLYAGPVGLSWGWFVAGGLILTVGIALAELSSSIPTAGAVYVSCYQWAPARW 149
           SIAS M GGL  GPV L WGWF +   IL VGI +AE +S+IPTAG +Y   Y +AP ++
Sbjct: 92  SIASVMAGGLAGGPVSLVWGWFSSCIGILIVGITMAENASAIPTAGGMYYWTYYYAPKKY 151

Query: 150 RKSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVSNPDFV-VTDPITYGVFAACVIA 208
           +  +S+ VG  ++L+L AS CSI YG A+++++AV ++    V VT    YG+FA   + 
Sbjct: 152 KAVLSFVVGCSNSLALVASCCSINYGFAEEVMAAVFLTYDGAVTVTSGKLYGIFAGATVV 211

Query: 209 MAVLTSLASGFTSKLQTISIVSNCXXXXXXXXXXPIGVSRSDKLNHSFNNAKFIFGKSEN 268
           MA+ T +ASG  ++LQT+SIVSN           PIG   +  + H FN+ K+IFG  EN
Sbjct: 212 MAMCTCVASGAIARLQTVSIVSNIFIIILFVIAVPIGTKAN--IGH-FNDGKYIFGHFEN 268

Query: 269 FTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEARDAVRAVPIGIVGSIASCWILGWLI 328
            +DWN G+ + + G  PA WTI ++DSC+H +EEA+DA ++VPIGI+GSI +CWILG+LI
Sbjct: 269 LSDWNNGFLFFLAGFMPAAWTISSFDSCVHQSEEAKDAKKSVPIGIIGSITACWILGFLI 328

Query: 329 CIVLLACMDPDLNNIINSPYGQGITQVFYDALGKRWTLAFLSFMIICQFLMGASTVVANS 388
            I L ACMD DL+ ++NS  G  + Q+ +D+LGKRW +AF++ +  CQFLMGAS V A S
Sbjct: 329 IICLCACMDTDLDRLVNSDTGFAMAQIIFDSLGKRWAIAFMALIAFCQFLMGASIVTAIS 388

Query: 389 RQFWAFARDDALPFSNFFKKVNGSVAVPIRAVWXXXXXXXXXXXXXXXXEVAADALFSLS 448
           RQ WAFARDD LPFSN  K V+    VP  +V                   A  ALFSLS
Sbjct: 389 RQIWAFARDDGLPFSNLIKYVDKRYQVPFNSVIAAAITSLLLGLLCLINSQATAALFSLS 448

Query: 449 IAGMYMALIFPITLRLTYGKKDFRPGPFYMGDFWSPIINWISVAFQLFTIIMVMFPYQQH 508
           +AG Y+A + P  LRLT G+  FRPGPFY+G FWSPI+ W SV F+++ I++ MFP QQH
Sbjct: 449 VAGGYIAYLIPTVLRLTVGRDVFRPGPFYLGKFWSPIVAWSSVVFEIWIILLEMFPAQQH 508

Query: 509 NIDKDTMNYTVVIGPGFWVLSLIYYYFWQSKFYEGPKSNLSDEEFAERVGDDVLDAIL 566
           +IDK TMNY+ VIGPG  +L+ IYY  W+ + Y GPKSNLSDE++ E +G  VLD I+
Sbjct: 509 HIDKSTMNYSCVIGPGTCLLAWIYYRVWKHREYIGPKSNLSDEDYKEALGPAVLDDII 566

>SAKL0D01232g Chr4 complement(90918..92642) [1725 bp, 574 aa] {ON}
           similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 574

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/561 (49%), Positives = 384/561 (68%), Gaps = 3/561 (0%)

Query: 10  SSTKDMISARKSNVDIGVGNVAELRSITSAHGAPIRYIDAKNATSDQQVLAEIGYKEELK 69
           +S +++     +N +  V  +  LR+ITS     + YI+AK A  D ++LAEIGYK+EL 
Sbjct: 15  TSARELHPIVSANANGEVQQITSLRTITSKRAGEVNYINAKAAHDDTELLAEIGYKQELN 74

Query: 70  REFSTLQIFGVAFSIMGLLPSIASTMDGGLYAGPVGLSWGWFVAGGLILTVGIALAELSS 129
           R FST+Q+FG+AFSIMGLLPSIAS +      G + L WGW ++G  IL+VG  +AEL+S
Sbjct: 75  RHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLISGAFILSVGAGMAELAS 134

Query: 130 SIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVS-N 188
           +IPT+G +Y   Y +AP +++K +S+ +G  ++L+L A +CSI YGLAQ+ILS VV+S +
Sbjct: 135 AIPTSGGLYYYTYYYAPPKFKKVLSFLIGNSNSLALIACLCSIDYGLAQEILSIVVISKD 194

Query: 189 PDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCXXXXXXXXXXPIGVSR 248
            DF +T+  TYGV+A C+IA  +LTS+A+   SKLQT SIVSN           PIGVS+
Sbjct: 195 GDFEITNAKTYGVYAGCIIATTLLTSVATVAVSKLQTFSIVSNVLLIIFFLIVLPIGVSQ 254

Query: 249 SDKLNHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEARDAVR 308
           SD +  +FN  KFIFG  ENF DW  GW + + G  P +W IGA+DSC+HM+EEA++A +
Sbjct: 255 SDDV--TFNGGKFIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFDSCIHMSEEAKNATK 312

Query: 309 AVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKRWTLAF 368
           AVPIGI+ SI+ CWI+G+ I I ++ACM  +++ I+++ YGQ + Q+ Y+ALGK+W + F
Sbjct: 313 AVPIGILTSISVCWIVGFFISIAIVACMGSNISAILDTVYGQPLAQILYNALGKKWAMTF 372

Query: 369 LSFMIICQFLMGASTVVANSRQFWAFARDDALPFSNFFKKVNGSVAVPIRAVWXXXXXXX 428
           ++ +  CQF+MGAST+ A SRQ WAFARDD LPFS + KKVN  ++ P+RA W       
Sbjct: 373 MTLIAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLSSPLRATWFGGAGAL 432

Query: 429 XXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFYMGDFWSPIINW 488
                      A+ ALFS+ IA  Y A + P  LR+T GK+ F PG FYMG+FWSP+INW
Sbjct: 433 CIGLLCLIGSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPGAFYMGNFWSPVINW 492

Query: 489 ISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQSKFYEGPKSNL 548
            S+ F++F IIM+MFP  QHNI  DTMNYT V     W  S+ YYYF++ + + GPKSNL
Sbjct: 493 TSIIFEIFIIIMMMFPSSQHNITADTMNYTCVFVGFVWFGSIAYYYFYKHRTFHGPKSNL 552

Query: 549 SDEEFAERVGDDVLDAILSSN 569
           +D+EF + VG DV+D ILS+ 
Sbjct: 553 TDDEFVDAVGQDVIDEILSNQ 573

>Kwal_0.16 s0 complement(7307..9001) [1695 bp, 564 aa] {ON} YDL210W
           (UGA4) - GABA-specific transport protein [contig 75]
           FULL
          Length = 564

 Score =  543 bits (1400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/547 (48%), Positives = 375/547 (68%), Gaps = 6/547 (1%)

Query: 27  VGNVAE---LRSITSAHGAPIRYIDAKNATSDQQVLAEIGYKEELKREFSTLQIFGVAFS 83
           VG + E   LR+ITS     + YI+AK A  D ++LAEIGYK+EL R FSTLQ+FG+AFS
Sbjct: 20  VGEIHEYRSLRTITSKRAGEVNYINAKTAHDDTELLAEIGYKQELSRHFSTLQVFGIAFS 79

Query: 84  IMGLLPSIASTMDGGLYAGPVGLSWGWFVAGGLILTVGIALAELSSSIPTAGAVYVSCYQ 143
           IMGLLPSIAS +      G V   WGW ++G  +L +G +++EL+S+IPT+G +Y   Y 
Sbjct: 80  IMGLLPSIASVLLMAFPGGMVSFVWGWLISGFFVLLIGCSMSELASAIPTSGGLYYYTYY 139

Query: 144 WAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVS-NPDFVVTDPITYGVF 202
           +AP R++  +S+ +G  +TL+L A +CS+ YG AQ++L+ VV+S + +F +T+ + YGV+
Sbjct: 140 YAPKRFKSLLSFLIGNSNTLALTAGLCSVTYGFAQEVLAIVVISKDGNFELTNGMIYGVY 199

Query: 203 AACVIAMAVLTSLASGFTSKLQTISIVSNCXXXXXXXXXXPIGVSRSDKLNHSFNNAKFI 262
           AA ++A  ++TS+A+   S+LQT+SIVSN           PIGVS++  L+  FN+  FI
Sbjct: 200 AAGIVATMMVTSVATVAVSRLQTVSIVSNLALIAFFLIVLPIGVSKTKWLD--FNDGSFI 257

Query: 263 FGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEARDAVRAVPIGIVGSIASCW 322
           FG   N T W  GW + + G  PA+WTIGA+DSC+HM+EEA++A +AVP GI+GSI+ CW
Sbjct: 258 FGNWTNETTWPDGWQFMMTGFQPAVWTIGAFDSCIHMSEEAKNATKAVPAGILGSISVCW 317

Query: 323 ILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKRWTLAFLSFMIICQFLMGAS 382
           ++G+ ICI + ACM PD++ I++S YG  + Q+ Y+ALGK+WT+AF++ +  CQF+MG S
Sbjct: 318 VVGFFICIAIAACMGPDIDAILDSAYGSPLAQILYNALGKKWTMAFMTLIAFCQFVMGCS 377

Query: 383 TVVANSRQFWAFARDDALPFSNFFKKVNGSVAVPIRAVWXXXXXXXXXXXXXXXXEVAAD 442
            + A SRQ WAFARDD L FS   K VN  ++ P+RA W                  A++
Sbjct: 378 ILTAISRQIWAFARDDGLMFSKHIKVVNKKLSSPLRATWFGAAGALVIGLLCLIGGTASN 437

Query: 443 ALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFYMGDFWSPIINWISVAFQLFTIIMVM 502
           ALFS+ IA  Y++ + P  LR+T GK  F+PG FYMGDFWSPI+NW S+AF+LF I+M+M
Sbjct: 438 ALFSMYIAANYLSWMMPNLLRMTTGKDVFKPGAFYMGDFWSPIVNWTSIAFELFIIVMMM 497

Query: 503 FPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQSKFYEGPKSNLSDEEFAERVGDDVL 562
           FP ++  I  DTMNYT+VI    W+ SL Y+  ++ K++ GPKSNLSD EF + VG DV+
Sbjct: 498 FPTEKTGITPDTMNYTIVICGAVWLGSLAYFLTYKHKYFHGPKSNLSDAEFDKAVGQDVI 557

Query: 563 DAILSSN 569
           D ILS +
Sbjct: 558 DQILSHS 564

>KLLA0E24993g Chr5 complement(2214864..2216570) [1707 bp, 568 aa]
           {ON} similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 568

 Score =  541 bits (1394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/572 (49%), Positives = 385/572 (67%), Gaps = 9/572 (1%)

Query: 1   MATGYMSTSSSTKDMISAR--KSNVDIGVGNVAELRSITSAHGAPIRYIDAKNATSDQQV 58
           M+    S S     +I A+  K+ VD+    V  LR+ITS     + YI+AK A  D ++
Sbjct: 1   MSASVSSGSEKNNYIIGAQEVKNKVDV----VTSLRTITSRRVGDVNYINAKAAHDDTEL 56

Query: 59  LAEIGYKEELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAGPVGLSWGWFVAGGLIL 118
           LAEIGYK+EL+R FS +Q+FGVAFSIMGLLPSIAS +   L  G V L WGW +AG  +L
Sbjct: 57  LAEIGYKQELQRHFSKIQVFGVAFSIMGLLPSIASVLSLALPGGSVSLVWGWGIAGAFVL 116

Query: 119 TVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQ 178
           T G+A++EL+S+IPT+G +Y   Y +AP + +  +S+ VG  ++L+L A +CSI YGLA 
Sbjct: 117 TNGLAMSELASAIPTSGGLYYYTYYYAPPKVKNLLSFVVGNSNSLALIAGLCSINYGLAG 176

Query: 179 QILSAVVV-SNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCXXXXX 237
           +ILS VVV S+ +F +T+  TYGV+AAC++A AV+TS+A+   SKLQT SIVSN      
Sbjct: 177 EILSIVVVGSDGNFNITNASTYGVYAACIVATAVVTSVATVAVSKLQTFSIVSNLLLICI 236

Query: 238 XXXXXPIGVSRSDKLNHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCL 297
                P+GV+RS+ +   FN+AK+IFG  +N +DWN GW +   G  P IW IG +DSC+
Sbjct: 237 FFVALPVGVARSNHME--FNDAKYIFGNFQNLSDWNDGWQFMSAGFQPLIWVIGGFDSCI 294

Query: 298 HMAEEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFY 357
           HM+EEA++A  +VP GI+GSI+ CW+LG+ ICIV+ AC   D+  I+ + + Q + Q+ +
Sbjct: 295 HMSEEAKNATASVPFGIIGSISVCWVLGFFICIVIAACSSQDVAAIVETKFHQPLAQILF 354

Query: 358 DALGKRWTLAFLSFMIICQFLMGASTVVANSRQFWAFARDDALPFSNFFKKVNGSVAVPI 417
           DALGKRWT+A +  +  CQFLM AS + A SRQ WAFARDD LPFS++ K VN  ++ P+
Sbjct: 355 DALGKRWTIAIMVLIAFCQFLMAASILTAISRQIWAFARDDGLPFSSWIKVVNIKLSSPL 414

Query: 418 RAVWXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFY 477
           RA W                 VA+ ALFSL+++  Y + + P  LR+TYGK  F PG F+
Sbjct: 415 RATWVGAGAALAIGCLCLIGPVASSALFSLAVSANYFSWMVPNLLRMTYGKDVFTPGAFF 474

Query: 478 MGDFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQ 537
           MG + SP++NWIS+ F++F I++V FP  QH I  DTMNY+VV     WVL  IYY  ++
Sbjct: 475 MGKYLSPVVNWISIVFEIFMILLVFFPADQHGITPDTMNYSVVFIGAVWVLPTIYYLVYK 534

Query: 538 SKFYEGPKSNLSDEEFAERVGDDVLDAILSSN 569
            KFY GPKSNL+DEE+ E+VG DVLDAILS +
Sbjct: 535 YKFYSGPKSNLTDEEYEEKVGQDVLDAILSKH 566

>Skud_4.46 Chr4 (81451..83166) [1716 bp, 571 aa] {ON} YDL210W (REAL)
          Length = 571

 Score =  537 bits (1383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/572 (50%), Positives = 388/572 (67%), Gaps = 11/572 (1%)

Query: 6   MSTSSSTKDMISA-RKSNVDIGV-----GNVAELRSITSAHGA-PIRYIDAKNATSDQQV 58
           MS SS   + IS  ++ + D G      G  + LRSI S  GA  + YI+A  + +D Q+
Sbjct: 1   MSMSSKNDNKISVEQRVSTDFGEAYQLEGLGSNLRSIRSKTGAGEVNYINAAKSVNDNQL 60

Query: 59  LAEIGYKEELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAGPVGLSWGWFVAGGLIL 118
           LAEIGYK+ELKR+FST+Q+FG+AFSIMGLLPSIAS M GGL  GP  L WGWFVA   IL
Sbjct: 61  LAEIGYKQELKRQFSTVQVFGIAFSIMGLLPSIASVMGGGLGGGPATLLWGWFVAAFFIL 120

Query: 119 TVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQ 178
            VGI +AE +S+IPTAG +Y   Y +AP  +++ IS+ +G  ++L+L A VCSI YGLA+
Sbjct: 121 LVGITMAEHASAIPTAGGLYYWTYHYAPEGYKEIISFIIGCSNSLALAAGVCSIDYGLAE 180

Query: 179 QILSAVVVS-NPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCXXXXX 237
           +I +AV ++ + +F  T    YG+FA  V+ M + T +ASG  ++LQT+SIV+N      
Sbjct: 181 EIAAAVTLTRDGNFDATSGKLYGIFAGAVVLMGICTCIASGAIARLQTVSIVANLFIIVL 240

Query: 238 XXXXXPIGVSRSDKLNHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCL 297
                PIG   +      FNN +FIFGK EN +DWN GW +C+ G  PA+WTIG++DSC+
Sbjct: 241 LFIALPIGTKHN---MGGFNNGEFIFGKFENMSDWNNGWQFCLAGFMPAVWTIGSFDSCV 297

Query: 298 HMAEEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFY 357
           H +EEA+DA ++VPIGI+ SIA CW+LG LI I LLAC++PD+++++NS YG  + Q+ Y
Sbjct: 298 HQSEEAKDAKKSVPIGIISSIAVCWVLGLLIIICLLACINPDIDSVLNSKYGFALAQIIY 357

Query: 358 DALGKRWTLAFLSFMIICQFLMGASTVVANSRQFWAFARDDALPFSNFFKKVNGSVAVPI 417
           D+LGK+W +AF+S +  CQFLMGAS   A SRQ WAF+RD+ LP S + K+V+   +VP 
Sbjct: 358 DSLGKKWAIAFMSLIAFCQFLMGASITTAVSRQVWAFSRDNGLPLSKYIKRVDSKYSVPF 417

Query: 418 RAVWXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFY 477
            A+                 E A  ALFSL++AG  +A   P  LRLT G+  FRPGPFY
Sbjct: 418 YAILAACVGSLILGLLCLIDEAATSALFSLAVAGNNLAWSTPTVLRLTSGRDLFRPGPFY 477

Query: 478 MGDFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQ 537
           +G FWSPII WI VAFQ+F II+VMFP QQH I K TMNY  VIGPG W L+ +YY  ++
Sbjct: 478 LGKFWSPIIAWIGVAFQVFIIILVMFPSQQHGITKSTMNYACVIGPGIWFLAGVYYKVYK 537

Query: 538 SKFYEGPKSNLSDEEFAERVGDDVLDAILSSN 569
            K+Y GP +NLSD+++A+ VG DV+DAI+S  
Sbjct: 538 KKYYHGPATNLSDDDYADAVGVDVIDAIISKQ 569

>KNAG0K01030 Chr11 (202385..204130) [1746 bp, 581 aa] {ON} Anc_8.468
           YDL210W
          Length = 581

 Score =  537 bits (1383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/543 (50%), Positives = 365/543 (67%), Gaps = 14/543 (2%)

Query: 6   MSTSSSTKD--MISARKSNVDIGVGNVAE-----LRSITSAHGA-PIRYIDAKNATSDQQ 57
           MS +SS K+  +++ ++ +VD G     E     +RS+ S  GA  + +IDA    SD Q
Sbjct: 1   MSLTSSKKETQVVTEQRLSVDFGSAEEIERPFSNIRSVRSQTGAGEVNFIDAGATVSDHQ 60

Query: 58  VLAEIGYKEELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAGPVGLSWGWFVAGGLI 117
           +LAEIGYK+EL R+FST+Q+FG+AFSIMGLLPSIAS M GGL  GP  L WGWF+AG  I
Sbjct: 61  LLAEIGYKQELNRQFSTIQVFGIAFSIMGLLPSIASVMGGGLAGGPTTLVWGWFIAGCFI 120

Query: 118 LTVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLA 177
           LTVGIA+AE +S+IPTAG +Y   Y +AP  +++ IS+ +G  ++L+L A VCSI YG A
Sbjct: 121 LTVGIAMAENASAIPTAGGLYYWTYYYAPKGYKEVISFVIGCSNSLALAAGVCSIDYGFA 180

Query: 178 QQILSAVVVS-NPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCXXXX 236
           +++L+AVV++ + +F +T   TYGVFAA V+AM + T +AS   ++LQTISIVSN     
Sbjct: 181 EEVLAAVVIAKDGNFEITPGKTYGVFAAAVVAMGICTCMASKAIARLQTISIVSNLFIIV 240

Query: 237 XXXXXXPIGVSRSDKLNHS-FNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDS 295
                 PIG     K+N   FN+  FIFGK +N +DWN GW + + G  P +WTIGA+DS
Sbjct: 241 LLFIALPIGT----KINMGGFNDGSFIFGKFKNLSDWNNGWQFFLAGFMPVVWTIGAFDS 296

Query: 296 CLHMAEEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQV 355
           C+H +EEA+DA ++VPIGI+GSI+ CW+LGWLI I L+ACM PD+  I+++ YG  + Q+
Sbjct: 297 CVHQSEEAKDAKKSVPIGIIGSISVCWVLGWLILICLMACMSPDIEGIVDNKYGFAMAQI 356

Query: 356 FYDALGKRWTLAFLSFMIICQFLMGASTVVANSRQFWAFARDDALPFSNFFKKVNGSVAV 415
            YD+LGK+W +AF+S +  CQFLMG+S V A SRQ WAFARDD LP S++ K V+    V
Sbjct: 357 IYDSLGKKWAVAFMSLIAFCQFLMGSSVVTAISRQIWAFARDDGLPLSDYIKMVDKKYKV 416

Query: 416 PIRAVWXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGP 475
           P  A+                   A  ALFSL++AG  +A   P  LRLT G+  FRPGP
Sbjct: 417 PFNAIIFACCGSLILGLLCLIDAAATSALFSLAVAGNNLAWSTPTLLRLTSGRDLFRPGP 476

Query: 476 FYMGDFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYF 535
           FY+G  WS +  WIS+ F+ F II+VMFP ++H I K TMNYT VIGPG W LS +YY  
Sbjct: 477 FYLGPVWSKVNGWISIIFEAFIIIVVMFPSEKHGITKSTMNYTCVIGPGIWFLSWVYYSV 536

Query: 536 WQS 538
           ++ 
Sbjct: 537 YKK 539

>ZYRO0B15048g Chr2 complement(1226178..1227926) [1749 bp, 582 aa]
           {ON} similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 582

 Score =  536 bits (1382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/564 (48%), Positives = 379/564 (67%), Gaps = 8/564 (1%)

Query: 4   GYMSTSSSTKDMISARKSNVDIGVGNVAELRSITSAHGAPIRYIDAKNATSDQQVLAEIG 63
           GY +TS++  D      + ++   G  + +RS+ S     + YI++  + +D+ +LAEIG
Sbjct: 14  GYSTTSAAELDGEKNEGTLLEF-RGLKSHIRSVRSPVAGEVNYINSATSNTDKGLLAEIG 72

Query: 64  YKEELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAGPVGLSWGWFVAGGLILTVGIA 123
           YK+EL+R+FST+Q+FGVAFSIMGLLPSI + +  GL  GPV   WGW +AG  IL +G+A
Sbjct: 73  YKQELERKFSTIQVFGVAFSIMGLLPSIGTLLSDGLAGGPVSTIWGWLIAGFFILVLGLA 132

Query: 124 LAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQQILSA 183
           +AE +S+IPTAG +Y   Y +AP  ++  +S+ +G  ++L+L A+ CSI YG A+++L+A
Sbjct: 133 MAENASAIPTAGGLYYWTYYYAPKGYKAVMSFIIGCSNSLALTAACCSITYGFAEEVLAA 192

Query: 184 VVVS-NPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCXXXXXXXXXX 242
           VV++ + +F VT+   YG+FA   I M V TS+ASGF +KLQT+SI+ N           
Sbjct: 193 VVLTKDGNFDVTNGKLYGIFAGAAIMMGVCTSVASGFVAKLQTLSIICNLFIIVLFFIAV 252

Query: 243 PIGVSRSDKLNH-SFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAE 301
           PIG     K+N   FN+  FIF   +N +DWN GW +C+ G  PAIWTIG +DSC+H +E
Sbjct: 253 PIGA----KVNRGKFNHGHFIFANYQNSSDWNNGWQFCLAGFMPAIWTIGGFDSCVHQSE 308

Query: 302 EARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALG 361
           EA+DA ++V +GIVGSI+ CWILGW I IVLLACMDPD++  +N+ Y   I Q+ YD LG
Sbjct: 309 EAKDAKKSVALGIVGSISVCWILGWFILIVLLACMDPDVSKTMNTKYVLSIAQIIYDCLG 368

Query: 362 KRWTLAFLSFMIICQFLMGASTVVANSRQFWAFARDDALPFSNFFKKVNGSVAVPIRAVW 421
           K W +AF+S +  CQFLMGAST+ A SRQ WAF+RD+ LPFS + KKVN + ++P  A+ 
Sbjct: 369 KNWAIAFMSLIAFCQFLMGASTITAVSRQIWAFSRDNGLPFSKYIKKVNKTYSIPFVAII 428

Query: 422 XXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFYMGDF 481
                           E AA+ALFSLS+AG  ++   P  LRLT+GK  FRPGPFY+G F
Sbjct: 429 AACCGTLVLGLLCLQDE-AANALFSLSVAGNNLSWGTPTFLRLTFGKDLFRPGPFYLGKF 487

Query: 482 WSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQSKFY 541
            S +  WISV + LF II+VMFP  QHN+   +MNY  VIGPG W+LS IYY  ++ K+Y
Sbjct: 488 LSTVNGWISVFWGLFVIILVMFPTSQHNVTPQSMNYACVIGPGVWILSFIYYITYKKKYY 547

Query: 542 EGPKSNLSDEEFAERVGDDVLDAI 565
            GP SNL++EE+   VG+DVLD I
Sbjct: 548 HGPASNLTEEEYVNAVGEDVLDNI 571

>ABL116C Chr2 complement(181138..181889,181944..182826) [1635 bp,
           544 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YDL210W (UGA4); 1-intron
          Length = 544

 Score =  473 bits (1216), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 233/514 (45%), Positives = 340/514 (66%), Gaps = 4/514 (0%)

Query: 36  ITSAHGAPIRYIDAKNATSDQQVLAEIGYKEELKREFSTLQIFGVAFSIMGLLPSIASTM 95
           I  ++  P+ YIDAKN   D ++LAEIGYK+ELKR FSTLQIFG+AFSIMGLLPSIAS +
Sbjct: 32  IECSNKGPMNYIDAKNVHDDVELLAEIGYKQELKRHFSTLQIFGIAFSIMGLLPSIASVL 91

Query: 96  DGGLYAGPVGLSWGWFVAGGLILTVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISY 155
              L  G V + WGWF+ G  IL VG A+AEL+S+ PT+G +Y   Y +AP R +  +S+
Sbjct: 92  PVALPGGSVSMVWGWFIFGAFILAVGAAMAELASAFPTSGGLYYYTYYYAPPRLKACLSF 151

Query: 156 SVGFLDTLSLCASVCSIVYGLAQQILSAVVVSNPDFVVTDP-ITYGVFAACVIAMAVLTS 214
            +G  ++L+L A +CSI YGLA+QILS + +S+  ++V+   + YG++   ++A  +L S
Sbjct: 152 LIGNGNSLALIAGLCSIEYGLAEQILSIIAISSNSYLVSSRWLLYGIYCMGLLATVLLAS 211

Query: 215 LASGFTSKLQTISIVSNCXXXXXXXXXXPIGVSRSDKLNHSFNNAKFIFGKSENFTDWNG 274
           +A+   S LQT SIV N           P+GV+ + +    FN+AKF+F   EN T W  
Sbjct: 212 IATFSVSLLQTASIVMNLALVALFIIVLPVGVAHNGR---GFNSAKFMFTNFENHTGWPD 268

Query: 275 GWSWCINGLTPAIWTIGAYDSCLHMAEEARDAVRAVPIGIVGSIASCWILGWLICIVLLA 334
            + + + G  P +W IGA+DS +HM+EEA++A R+VPIGI+ SI++CW LG+ I +V+ A
Sbjct: 269 WFQFFLCGSLPIVWVIGAFDSTVHMSEEAKNATRSVPIGILSSISTCWALGFAIVVVIAA 328

Query: 335 CMDPDLNNIINSPYGQGITQVFYDALGKRWTLAFLSFMIICQFLMGASTVVANSRQFWAF 394
           CM PD++ I+N  +   + Q+ Y+ALGK W L+ + F+++CQ+LMGAS + A+SRQ WAF
Sbjct: 329 CMGPDIDAILNGEFNHPLAQILYNALGKGWALSVMVFIVVCQYLMGASILTASSRQIWAF 388

Query: 395 ARDDALPFSNFFKKVNGSVAVPIRAVWXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYM 454
           ARDD LPFS++ K VN  ++ P+RA W                  A+ ALFS+++A  Y+
Sbjct: 389 ARDDGLPFSSWIKVVNTKLSSPLRATWASAFVALVIGLLTLAGPTASSALFSMAVAANYL 448

Query: 455 ALIFPITLRLTYGKKDFRPGPFYMGDFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDT 514
           A + P  LR+ +GK+ +RPG FYMG FWSP+INW ++ FQ+F I+++MFP     +   T
Sbjct: 449 AWMTPNLLRMLFGKEIYRPGSFYMGKFWSPVINWTAILFQVFIILVMMFPSDTAGLRAST 508

Query: 515 MNYTVVIGPGFWVLSLIYYYFWQSKFYEGPKSNL 548
           MNYT +I    W+ S+ Y+  ++ + + GPKSNL
Sbjct: 509 MNYTAIITGFVWIGSIFYFLAYKHRTFIGPKSNL 542

>Ecym_4621 Chr4 complement(1216034..1217752) [1719 bp, 572 aa] {ON}
           similar to Ashbya gossypii ABL116C
          Length = 572

 Score =  467 bits (1202), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 236/555 (42%), Positives = 352/555 (63%), Gaps = 6/555 (1%)

Query: 18  ARKSNVDIGVGNVAELRSITSAHGAPIRYIDAKNATSDQQVLAEIGYKEELKREFSTLQI 77
           A  +N  + V  ++ +++  S     + YI+AK A  D ++LAEIGYK+EL R FST+Q+
Sbjct: 21  ALTNNTSVRVQQISSIKTSRSKTVDQVNYINAKTAYDDVELLAEIGYKQELSRHFSTIQV 80

Query: 78  FGVAFSIMGLLPSIASTMDGGLYAGPVGLSWGWFVAGGLILTVGIALAELSSSIPTAGAV 137
           FG+AFSIMGLLPSIAS +   L  G V   WGW + G  IL++G A++EL+S+IPT+G +
Sbjct: 81  FGIAFSIMGLLPSIASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGL 140

Query: 138 YVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVV-SNPDFVVTDP 196
           Y   Y +AP +++  +S+ +G  ++L+L A +CS+ YGLAQ++LS V +  + DF ++  
Sbjct: 141 YYYTYYYAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSS 200

Query: 197 ITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCXXXXXXXXXXPIGVSRSDKLNHSF 256
            T+ V+ A ++A  +LTS+A+   S LQT+SIV N           PIGV+ +D +  +F
Sbjct: 201 KTFAVYCAAILATVILTSMATAAVSVLQTVSIVINLSLVAFLIVL-PIGVANNDSM--TF 257

Query: 257 NNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEARDAVRAVPIGIVG 316
           N   FIF   +N + W     + + G  P +W IGA+DS +HM+EEA++A +AVP+ I+ 
Sbjct: 258 NGPGFIFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILT 317

Query: 317 SIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKRWTLAFLSFMIICQ 376
           SI  CW+LG+ I + + ACM PD+N ++++ +GQ + Q+ ++ LGK+W +AF+S + +CQ
Sbjct: 318 SITVCWLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQ 377

Query: 377 FLMGASTVVANSRQFWAFARDDALPFSNFFKKVNGSVAVPIRAVWXXXXXXXXXXXXXXX 436
           ++MGAS + A SRQ WAFARDD LPFS + KKVN S++ PIRA W               
Sbjct: 378 YVMGASILTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLTLA 437

Query: 437 XEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFYMGDFWSPIINWISVAFQLF 496
             VA+ ALFS+ +   Y+A + P  LR+ +GK  F PG FYMG FWSPIINW+S+ FQL 
Sbjct: 438 GPVASSALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLL 497

Query: 497 TIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQSKFYEGPKSNLSDEEFAER 556
            I+++M P    NI   +MNYT +     W  S+IY+  ++ K +EGPKSNL+D +    
Sbjct: 498 CIVLMMLPTNPINITGSSMNYTFLFTGFVWFGSIIYFVLYKHKTFEGPKSNLTDSDL--N 555

Query: 557 VGDDVLDAILSSNVE 571
             D  ++ I S   E
Sbjct: 556 TPDGSIEHISSQTFE 570

>Skud_7.205 Chr7 complement(365478..367166) [1689 bp, 562 aa] {ON}
           YGL077C (REAL)
          Length = 562

 Score =  158 bits (400), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 141/558 (25%), Positives = 257/558 (46%), Gaps = 28/558 (5%)

Query: 32  ELRSITSAHGAPIRYIDAKNATSD---QQVLAEIGYKEELKREFSTLQIFGVAFSIMGLL 88
           E  S T  H   +R  +    + D   + V+A  G +  L++ FS   I GV F +    
Sbjct: 16  EQSSNTHIHKRDVRVEEEIKPSDDMDGKGVVAADG-EVHLRKSFSLWSILGVGFGLTNSW 74

Query: 89  PSIASTMDGGLYAG-PVGLSWGWFVAGGLILTVGIALAELSSSIPTAGAVYVSCYQWAPA 147
             I+++M  G+ +G P+ + +G  +   + + +G +L ELSS+ P AG  +    + AP 
Sbjct: 75  FGISTSMVAGISSGGPMMIIYGIIIVALISICIGTSLGELSSAYPHAGGQFWWSLKLAPP 134

Query: 148 RWRKSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVSNPDFVVTDPITYGVFAACVI 207
           ++++  +Y  G         +  S    +A +++    + +P+F    P  + +F    +
Sbjct: 135 KYKRFAAYMCGSFAFAGSVFTSASTTLSVATEVVGMYALMHPEFT---PKRWHIF----V 187

Query: 208 AMAVLTSLASGFTSKLQTISIVSNCXXXXXXXXXXPIGVSRSDKLNHSFNNAKFIFGKSE 267
              +L      F    +++ I+S+            I ++     +  FN+AKF+F    
Sbjct: 188 CFELLHLFLMLFNCYGKSLPIISSSSLYISLFSFFTITITVLACSHGKFNDAKFVFATFY 247

Query: 268 NFTDW-NGGWSWCINGLTPAIWTIGAYDSCLHMAEEARDAVRAVPIGIVGSIASCWILGW 326
           N T W NGG ++ +  + PA W+    D   HMA E     R +PI I+G++A  ++  +
Sbjct: 248 NETGWKNGGIAFIVGLINPA-WSFSCLDCATHMAFEVEKPERVIPIAIMGTVAIGFVTSF 306

Query: 327 LICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKRWTLAFLSFMIICQFLMGASTVVA 386
              I +   +  DL+ +++S  G  I  ++  ALG +    FL  +I+   L     V+A
Sbjct: 307 CYVIAMFFSIK-DLSAVLSSTTGAPILDIYNQALGNKSGAIFLGCLIL---LTSFGCVIA 362

Query: 387 ----NSRQFWAFARDDALPFSNFFKKVNGSVAVPIRAVWXXXXXXXXXXXXXXXXEVAAD 442
                +R  W+FARD+ LP S ++ +VN  + VP+ A                    A  
Sbjct: 363 CHTWQARLCWSFARDNGLPLSRYWAQVNPHIGVPLNAHLMSCAWISLIGLLYLASSTAFQ 422

Query: 443 ALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFYMGDFWSPIINWISVAFQLFTIIMVM 502
           +L +  IA + ++ I P+   L   K+D   GPF++G F     N + + + +F+++   
Sbjct: 423 SLITGCIAFLLLSYIIPVVCLLA-KKRDIAHGPFWLGKF-GFFSNIVLLGWTIFSVVFFS 480

Query: 503 FPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQSK-FYEGPKSNLSDEEFAERV--GD 559
           FP     + KD MNY  V+  G+   SL+Y++F   K F+   +S     +FA      D
Sbjct: 481 FP-PVLPVTKDNMNYVCVVIVGYTAYSLLYWHFKGKKEFHAVEESEDEQADFANNFENED 539

Query: 560 DVLDAILSSNVEVNNDRL 577
               ++++S+VEV N+ +
Sbjct: 540 SQEFSLVASDVEVENEHV 557

>Suva_7.193 Chr7 complement(355063..356754) [1692 bp, 563 aa] {ON}
           YGL077C (REAL)
          Length = 563

 Score =  157 bits (396), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 136/553 (24%), Positives = 254/553 (45%), Gaps = 23/553 (4%)

Query: 35  SITSAHGAPIRYIDAKNATSD---QQVLAEIGYKEELKREFSTLQIFGVAFSIMGLLPSI 91
           S T  H   +R  +    + D   + V+A  G +  L++ FS   I GV F +      I
Sbjct: 19  SNTDVHKRDVRVAEEFEPSDDADGKGVVAADG-EVHLRKSFSLWSILGVGFGLTNSWFGI 77

Query: 92  ASTMDGGLYAG-PVGLSWGWFVAGGLILTVGIALAELSSSIPTAGAVYVSCYQWAPARWR 150
           +++M  G+ +G P+ + +G  +   + + +G +L ELSS+ P AG  +    + AP +++
Sbjct: 78  SASMVAGISSGGPMMIVYGIIIVALISVCIGTSLGELSSAYPHAGGQFWWSLKLAPPKYK 137

Query: 151 KSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVSNPDFVVTDPITYGVFAACVIAMA 210
           +  +Y  G         +  S    +A +++    + NP+F+   P  + +F    +   
Sbjct: 138 RFAAYMCGSFAYAGSVFTSASTTLSVATEVVGMYALMNPNFI---PKRWHIF----VCFE 190

Query: 211 VLTSLASGFTSKLQTISIVSNCXXXXXXXXXXPIGVSRSDKLNHSFNNAKFIFGKSENFT 270
           +L      F    +++ ++S+            I ++     +  FN+AKF+F    N T
Sbjct: 191 LLHLFLMLFNCYGKSLPLISSSSLYISLLSFFTITITVLACSHGKFNDAKFVFATFYNET 250

Query: 271 DW-NGGWSWCINGLTPAIWTIGAYDSCLHMAEEARDAVRAVPIGIVGSIASCWILGWLIC 329
            W NGG ++ +  + PA W+    D   HMA E     R +PI I+G++A  ++      
Sbjct: 251 GWKNGGIAFIVGLINPA-WSFSCLDCATHMAFEVEKPERVIPIAIMGTVAIGFVTSLCYV 309

Query: 330 IVLLACMDPDLNNIINSPYGQGITQVFYDALGKRWTLAFLSFMII-CQFLMGASTVVANS 388
           I +   +  DL+ +++S  G  I  ++  ALG +    FL  +++   F    +     +
Sbjct: 310 IAMFFSIK-DLDAVLSSTTGAPILDIYNQALGNKSGAIFLGCLVLFTSFGCVIACHTWQA 368

Query: 389 RQFWAFARDDALPFSNFFKKVNGSVAVPIRAVWXXXXXXXXXXXXXXXXEVAADALFSLS 448
           R  W+FARD+ LP S F+ +VN    VP+ A                    A  +L +  
Sbjct: 369 RLCWSFARDNGLPLSRFWSQVNPHTGVPLNAHLMSCAWISLIGLLYLASSTAFQSLITGC 428

Query: 449 IAGMYMALIFPITLRLTYGKKDFRPGPFYMGDFWSPIINWISVAFQLFTIIMVMFPYQQH 508
           IA + ++ I P+   L   K+D   GPF++G F     N + + + +F+I+   FP    
Sbjct: 429 IAFLLLSYIIPVICLLA-KKRDIAHGPFWLGKF-GLFSNIVLLGWTVFSIVFFSFP-PVL 485

Query: 509 NIDKDTMNYTVVIGPGFWVLSLIYY-YFWQSKFYEGPKSNLSDEEFA---ERVGDDVLDA 564
            + KD MNY  V+  G+   S++Y+ Y  + +F+   +S    ++FA   E + D    +
Sbjct: 486 PVTKDNMNYVCVVIVGYTAYSILYWRYKGKKEFHAVEESEHEQDDFANNFETIEDSRDHS 545

Query: 565 ILSSNVEVNNDRL 577
           + +S+VE+  + +
Sbjct: 546 LAASDVELETENV 558

>TPHA0E02920 Chr5 (612901..614661) [1761 bp, 586 aa] {ON} Anc_6.205
           YGL077C
          Length = 586

 Score =  155 bits (393), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 134/531 (25%), Positives = 244/531 (45%), Gaps = 21/531 (3%)

Query: 55  DQQVLAEIGYKE-ELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAG-PVGLSWGWFV 112
           DQQ+   +G  E  L++ FS   I GV F +      I++++  G+ +G P+ + +G  +
Sbjct: 46  DQQLNHHVGDGEVHLRKSFSAWSILGVGFGLTNSWFGISTSLVTGISSGGPLMVVYGIII 105

Query: 113 AGGLILTVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSI 172
              + + VG++L ELSS+ P AG  +    + AP + RK  +Y  G         +  S 
Sbjct: 106 IALISVCVGVSLGELSSAYPHAGGQFWWSLKLAPPKHRKFAAYLCGSFAYAGSVFTSAST 165

Query: 173 VYGLAQQILSAVVVSNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNC 232
              +A +++    + +P+F    P  + VF    I   +L      F    +++ ++S+ 
Sbjct: 166 TLSVATEVVGMYALKHPEF---KPQRWHVF----ICFELLHLFLMLFNCYGKSLPLISSS 218

Query: 233 XXXXXXXXXXPIGVSRSDKLNHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGA 292
                      I V+     +  FN++KF+F    N T W       I GL    W+   
Sbjct: 219 SLYISLTSFFTITVTVLACSSGKFNDSKFVFASFYNETGWKNNGIAFITGLINPAWSFSC 278

Query: 293 YDSCLHMAEEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGI 352
            D   HMA E     + +P+ I+G+IA  ++  +   I +   +  DL+ ++NS  G  I
Sbjct: 279 LDCATHMAFEVEKPEKIIPLAIMGTIAIGFVTSFCYVIAMFFSIR-DLDKLLNSTTGAPI 337

Query: 353 TQVFYDALGKRWTLAFLSFMIICQFLMGASTVVA----NSRQFWAFARDDALPFSNFFKK 408
             +F  ALG      FL  +I+         V+A     +R  W+F+R+  LP+S+ + +
Sbjct: 338 LDIFNQALGNSSGAIFLGCLIL---FTSFGCVIACHTWQARLCWSFSRNKGLPYSHLWSQ 394

Query: 409 VNGSVAVPIRAVWXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRLTYGK 468
           VN +V VP+ A                    A ++L +  IA + ++ I P+ + L   +
Sbjct: 395 VNPNVGVPLNAHLMSCALISIIGVLYIASSTAFNSLITACIAFLLLSYIIPV-ICLLLKR 453

Query: 469 KDFRPGPFYMGDFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVL 528
           +  + GPF++G F     N + + + +F I+   FP  Q  + KD MNY  V+  G+ + 
Sbjct: 454 RQIKHGPFWLGKF-GLFSNIVLLCWTIFAIVFFSFP-PQLPVTKDNMNYVSVVIVGYSIY 511

Query: 529 SLIYYYFWQSKFYEGPKSNLSDEEFAERVGDDVLDAILSS-NVEVNNDRLS 578
           +++Y++F  SK +   +   + +       +D  ++I+S  N EV+N  L+
Sbjct: 512 AILYWHFKGSKEFHFTEEEETQKSMDTDYDNDSNESIVSDLNDEVSNGSLN 562

>YGL077C Chr7 complement(362225..363916) [1692 bp, 563 aa] {ON}
           HNM1Choline/ethanolamine transporter; involved in the
           uptake of nitrogen mustard and the uptake of glycine
           betaine during hypersaline stress; co-regulated with
           phospholipid biosynthetic genes and negatively regulated
           by choline and myo-inositol
          Length = 563

 Score =  153 bits (386), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 139/585 (23%), Positives = 265/585 (45%), Gaps = 48/585 (8%)

Query: 4   GYMSTSSSTKDMISARKSNVDIGVGNVAELRSITSAHGAPIRYIDAKNATS-DQQVLAEI 62
           GYM    S+   +  R   V+       E++        P+  +D+K A + D +V    
Sbjct: 11  GYMQPDQSSNASMHKRDLRVE------EEIK--------PLDDMDSKGAVAADGEV---- 52

Query: 63  GYKEELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAG-PVGLSWGWFVAGGLILTVG 121
                L++ FS   I GV F +      I+++M  G+ +G P+ + +G  +   + + +G
Sbjct: 53  ----HLRKSFSLWSILGVGFGLTNSWFGISTSMVAGISSGGPMMIVYGIIIVALISICIG 108

Query: 122 IALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQQIL 181
            +L ELSS+ P AG  +    + AP ++++  +Y  G         +  S    +A +++
Sbjct: 109 TSLGELSSAYPHAGGQFWWSLKLAPPKYKRFAAYMCGSFAYAGSVFTSASTTLSVATEVV 168

Query: 182 SAVVVSNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCXXXXXXXXX 241
               +++P+F+   P  + +F    +   +L      F    +++ I+S+          
Sbjct: 169 GMYALTHPEFI---PKRWHIF----VCFELLHLFLMFFNCYGKSLPIISSSSLYISLLSF 221

Query: 242 XPIGVSRSDKLNHSFNNAKFIFGKSENFTDW-NGGWSWCINGLTPAIWTIGAYDSCLHMA 300
             I ++     +  FN+AKF+F    N T W NGG ++ +  + PA W+    D   HMA
Sbjct: 222 FTITITVLACSHGKFNDAKFVFATFNNETGWKNGGIAFIVGLINPA-WSFSCLDCATHMA 280

Query: 301 EEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDAL 360
            E     R +PI I+G++A  ++  +   I +   +  DL+ +++S  G  I  ++  AL
Sbjct: 281 FEVEKPERVIPIAIMGTVAIGFVTSFCYVIAMFFSIQ-DLDAVLSSTTGAPILDIYNQAL 339

Query: 361 GKRWTLAFLSFMIICQFLMGASTVVA----NSRQFWAFARDDALPFSNFFKKVNGSVAVP 416
           G +    FL  +I+         V+A     +R  W+FARD+ LP S  + +VN    VP
Sbjct: 340 GNKSGAIFLGCLIL---FTSFGCVIACHTWQARLCWSFARDNGLPLSRLWSQVNPHTGVP 396

Query: 417 IRAVWXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPF 476
           + A                    A  +L +  IA + ++ I P+   L   K++   GPF
Sbjct: 397 LNAHLMSCAWITLIGLLYLASSTAFQSLITGCIAFLLLSYIIPVICLLA-KKRNIAHGPF 455

Query: 477 YMGDFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYY-YF 535
           ++G F     N + + + +F+++   FP     + KD MNY  V+  G+   S++Y+ Y 
Sbjct: 456 WLGKF-GFFSNIVLLGWTVFSVVFFSFP-PVLPVTKDNMNYVCVVIVGYTAYSILYWKYK 513

Query: 536 WQSKFYEGPKSNLSDEEFA---ERVGDDVLDAILSSNVEVNNDRL 577
            + +F+   +S     E++   + + D    ++ +S+VE+ N+ +
Sbjct: 514 GKKEFHALEESENEQAEYSNNFDTIEDSREFSVAASDVELENEHV 558

>SAKL0A04730g Chr1 (432222..433847) [1626 bp, 541 aa] {ON} similar
           to uniprot|P19807 Saccharomyces cerevisiae YGL077C HNM1
           Choline transporter (permease) that also controls the
           uptake of nitrogen mustard expression is co- regulated
           with phospholipid biosynthetic genes and negatively
           regulated by choline and myo-inositol
          Length = 541

 Score =  150 bits (380), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 123/507 (24%), Positives = 235/507 (46%), Gaps = 25/507 (4%)

Query: 67  ELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAG-PVGLSWGWFVAGGLILTVGIALA 125
           EL++ FS   I GV F +      I+++M  G+ +G P+ + +G  +   + + +GI+L 
Sbjct: 46  ELRKSFSLWSILGVGFGLTNSWFGISASMVTGISSGGPMMIVYGIIIIALVSVCIGISLG 105

Query: 126 ELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVV 185
           ELSS+ P AG  +    + AP ++R+  +Y  G         +  S    +A +++    
Sbjct: 106 ELSSAYPHAGGQFWWSLKLAPPKYRRFAAYMCGSFAWAGSVFTSASTTLSVATELVGMYA 165

Query: 186 VSNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCXXXXXXXXXXPIG 245
           +++PDF V     +  F    + + +       F    +++ ++S+            I 
Sbjct: 166 LTHPDFEVKRWHIFVCFELLHLFLMI-------FNCSGKSLPLISSSALYISLFSFITIT 218

Query: 246 VSRSDKLNHSFNNAKFIFGKSENFTDW-NGGWSWCINGLTPAIWTIGAYDSCLHMAEEAR 304
           ++     +  +N+AKF+F    N T W N G ++ +  + PA W+    D   HMA E  
Sbjct: 219 ITVLACSHGQYNDAKFVFATFYNETGWKNSGIAFIVGLINPA-WSFSCLDCATHMAFEVE 277

Query: 305 DAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKRW 364
              R +PI I+G++A  +I  +   I +   +  +L+ I++S  G  I  ++Y AL  + 
Sbjct: 278 KPERVIPISIMGTVAIGFITSFCYVIAMFFSLH-NLDEIMSSNTGAPILDIYYQALQSKA 336

Query: 365 TLAFLSFMIICQFLMGASTVVA----NSRQFWAFARDDALPFSNFFKKVNGSVAVPIRAV 420
               L  +I+         V+A     +R  W+FARD+ LP+S ++ KVN  + VP+ A 
Sbjct: 337 GAIVLGCLIL---FTSFGCVIACHTWQARLCWSFARDNGLPYSRYWSKVNPELGVPLNAH 393

Query: 421 WXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFYMGD 480
                              A ++L +  IA + ++ + P+ + L + K+  + GPF++G 
Sbjct: 394 LMSCAWIVLLGVLYLASSTAFNSLITGCIAFLLLSYVVPV-ICLLWRKRQIQHGPFWLGK 452

Query: 481 FWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFW-QSK 539
                 N++ + + +F ++   FP     + KD MNY  V+  G+ + SL+Y+ F  +  
Sbjct: 453 I-GLFSNYVLLGWTVFALVFFCFP-AVMPVTKDNMNYASVVIVGYLLYSLLYWRFRGRYT 510

Query: 540 FYEGPKSNLSDEEF---AERVGDDVLD 563
           FY   +   + E     +E + D  ++
Sbjct: 511 FYVVEEDEYTGENVSVNSETIHDTTIE 537

>AFL081W Chr6 (286339..287967) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL077C (HNM1)
          Length = 542

 Score =  150 bits (380), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 123/476 (25%), Positives = 215/476 (45%), Gaps = 13/476 (2%)

Query: 60  AEIGYKEELKREFSTLQIFGVAFSIMGLLPSIASTMDGGL-YAGPVGLSWGWFVAGGLIL 118
            ++   + L++ FS   + GV F +      I+ +M  G+   GP+ + +G  +   + +
Sbjct: 34  CQVDEGQLLRKSFSLWSVLGVGFGLTNSWFGISVSMITGIGSGGPMMIVYGIVIIALVSV 93

Query: 119 TVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQ 178
            VG++LAELSS+ P AG  +    + AP + R+  +Y  G L       +  S     A 
Sbjct: 94  CVGVSLAELSSAYPHAGGQFWWSLKLAPPKHRRLAAYLCGSLAWAGSVFTSASTTLSAAT 153

Query: 179 QILSAVVVSNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCXXXXXX 238
           +++    +  P+FVV     + VF    +   +L      F    +++ +VS+       
Sbjct: 154 ELVGMYALVRPEFVVRK---WHVF----VCYQILHCFLMLFNCYGRSLPLVSSSALYVSL 206

Query: 239 XXXXPIGVSRSDKLNHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLH 298
                I ++        FN+ KF+F    N T W       I GL    W+    D   H
Sbjct: 207 FSFVTITITVVACSRGHFNDPKFVFATFRNETGWQNSAIAFIVGLINPAWSFSCLDCATH 266

Query: 299 MAEEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYD 358
           MA E     R +PI I+G++A  ++  +   I +   +  DL+ I+ S  G  I  ++Y 
Sbjct: 267 MAFEVEQPERVIPIAILGTVAIGFLTSFCYVIAMFFSLR-DLSEIMTSNTGVPILDIYYQ 325

Query: 359 ALGKR-WTLAFLSFMIICQFLMGASTVVANSRQFWAFARDDALPFSNFFKKVNGSVAVPI 417
           ALG R   L   S +++       S+    +R  W+FARD  LP+S+ + +VN SV VP+
Sbjct: 326 ALGSRAGALVLGSLVLLTSVGCIISSHTWQARLCWSFARDGGLPYSHLWARVNRSVGVPL 385

Query: 418 RAVWXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFY 477
            A                    A ++L +  IA + ++ I P+ + L   K+  + GPF+
Sbjct: 386 NAHLMSCVCISLLGILYMASSTAFNSLITGCIAFLLLSYIVPV-ICLLLKKRQIKHGPFW 444

Query: 478 MGDFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYY 533
           +G F     N++ +A+ +F +I    P  +  + KD MNY  V+  G+ +  LI++
Sbjct: 445 LGPF-GAFCNYVLLAWTVFVLIFFSLPPLK-PVTKDNMNYVSVVVVGYILYVLIFW 498

>Ecym_2212 Chr2 (417948..419585) [1638 bp, 545 aa] {ON} similar to
           Ashbya gossypii AFL081W
          Length = 545

 Score =  148 bits (373), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 126/500 (25%), Positives = 226/500 (45%), Gaps = 21/500 (4%)

Query: 67  ELKREFSTLQIFGVAFSI----MGLLPSIASTMDGGLYAGPVGLSWGWFVAGGLILTVGI 122
           EL++ FS   + GV F +     GL  S+ + +  G   GP+ + +G  +   + + VG+
Sbjct: 46  ELRKSFSLWSVLGVGFGLTNSWFGLSVSMVTGISSG---GPMMIIYGIVIIALISVCVGV 102

Query: 123 ALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVG-FLDTLSLCASVCSIVYGLAQQIL 181
           +L ELSS+ P AG  +    Q AP ++++  +Y  G F    S+ AS  S +    + +L
Sbjct: 103 SLGELSSAYPHAGGQFWWSLQLAPNKYKRLAAYLCGSFAWAGSVFASASSTL-STTRLLL 161

Query: 182 SAVVVSNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCXXXXXXXXX 241
               + +P   + D   + VF  C  A+ +   L   F    + + ++S+          
Sbjct: 162 GMYALVHPSLEIKD---WHVFV-CYQALHMFLLL---FNCHGRPLPLISSTALYVSLFSF 214

Query: 242 XPIGVSRSDKLNHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAE 301
             I ++     + +FN+AKF+F    N T W       I GL    W+    D   HMA 
Sbjct: 215 ITITITVLASSHGNFNDAKFVFANFRNETGWESNTIAFIVGLINPAWSFSCLDCATHMAF 274

Query: 302 EARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALG 361
           E       +P  I+G++A  ++   + CI +   +  DL+ I++S  G  I  ++Y A G
Sbjct: 275 EVEKPETVIPTAILGTVAIGFLTSIVYCIAMFFSIR-DLDGILSSTTGAPILDIYYQASG 333

Query: 362 -KRWTLAFLSFMIICQFLMGASTVVANSRQFWAFARDDALPFSNFFKKVNGSVAVPIRAV 420
            K   +   S +++  F    S     +R  W+FARD+  P+S  + KVN  + VP+ A 
Sbjct: 334 SKACAIVLGSLVLLTSFTCVTSCHTWQARLCWSFARDNGFPYSRIWAKVNTELGVPLNAH 393

Query: 421 WXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFYMGD 480
                              A +AL +  I+ + ++   P+ + L   +++ + GPF++G 
Sbjct: 394 LLSCAVISLLGVLYLASSTAFNALVTGCISFLLLSYTVPV-ICLLLKQRNIKRGPFWLGK 452

Query: 481 FWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQSKF 540
           F     N++ +A+ LF+++    P     I K  MNY  ++   + + S++Y+ F   K 
Sbjct: 453 F-GTFSNYVLLAWTLFSLVFFSLP-PMKPITKGNMNYVSIVILSYLLYSILYWKFSGHKK 510

Query: 541 YEGPKSNLSDEEFAERVGDD 560
           +   +  +  EE  ER   D
Sbjct: 511 FYIYQEKIPVEESDERAEID 530

>Smik_7.206 Chr7 complement(356650..358341) [1692 bp, 563 aa] {ON}
           YGL077C (REAL)
          Length = 563

 Score =  148 bits (373), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 127/521 (24%), Positives = 239/521 (45%), Gaps = 25/521 (4%)

Query: 67  ELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAG-PVGLSWGWFVAGGLILTVGIALA 125
            L++ FS   I GV F +      I+++M  G+ +G P+ + +G  +   + + +G +L 
Sbjct: 53  HLRKSFSLWSILGVGFGLTNSWFGISTSMVAGISSGGPMMIVYGIIIVALISICIGTSLG 112

Query: 126 ELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVV 185
           ELSS+ P AG  +    + AP ++++  ++  G         +  S    +A +++    
Sbjct: 113 ELSSAYPHAGGQFWWSLKLAPPKYKRFAAFMCGSFAYAGSVFTSASTTLAVATEVVGMYA 172

Query: 186 VSNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCXXXXXXXXXXPIG 245
           + + +F    P  + +F    +   +L      F    +++ I+S+            I 
Sbjct: 173 LMHSEFT---PKRWHIF----VCFELLHLFLMFFNCYGKSLPIISSSSLYISLLSFFTIT 225

Query: 246 VSRSDKLNHSFNNAKFIFGKSENFTDW-NGGWSWCINGLTPAIWTIGAYDSCLHMAEEAR 304
           ++     +  FN++KF+F    N T W NGG ++ +  + PA W+    D   HMA E  
Sbjct: 226 ITVLACSHGKFNDSKFVFATFYNETGWKNGGIAFIVGLINPA-WSFSCLDCATHMAFEVE 284

Query: 305 DAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKRW 364
              R +PI I+G+IA  ++  +   I +   +  DL+ I++S  G  I  ++  ALG + 
Sbjct: 285 KPERVIPIAIMGTIAIGFVTSFCYVIAMFFSIK-DLDGILSSTTGAPILDIYNQALGNKS 343

Query: 365 TLAFLSFMIICQFLMGASTVVA----NSRQFWAFARDDALPFSNFFKKVNGSVAVPIRAV 420
              FL  +I+         V+A     +R  W+F+RD+ LP S  + +VN    VP+ A 
Sbjct: 344 GAIFLGCLIL---FTSFGCVIACHTWQARLCWSFSRDNGLPLSRLWSQVNPHTGVPLNAH 400

Query: 421 WXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFYMGD 480
                              A  +L +  IA + ++ I P+   L   K+D   GPF++G 
Sbjct: 401 LMSCAWISLIGLLYLASSTAFQSLITGCIAFLLLSYIIPVVCLLN-KKRDIAHGPFWLGK 459

Query: 481 FWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYY-YFWQSK 539
           F     N + + + LF ++   FP     + KD MNY  V+  G+   S++Y+ Y  + +
Sbjct: 460 F-GFFSNIVLLGWTLFAVVFFSFP-PVLPVTKDNMNYVCVVIVGYTAYSILYWKYKGKKE 517

Query: 540 FYEGPKSNLSDEEFA---ERVGDDVLDAILSSNVEVNNDRL 577
           F+   +S +   +FA   + + D    ++ +S++EV N+ +
Sbjct: 518 FHAVEESEIDQTDFANHFDTIEDSREFSLAASDIEVENEHV 558

>TDEL0G01410 Chr7 (285255..286916) [1662 bp, 553 aa] {ON} Anc_6.205
           YGL077C
          Length = 553

 Score =  147 bits (370), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 126/491 (25%), Positives = 218/491 (44%), Gaps = 21/491 (4%)

Query: 55  DQQVLAEIGYKEELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAG-PVGLSWGWFVA 113
              ++ E G +  L++ FS   I GV F +      I+ +M  G+++G P+ + +G  + 
Sbjct: 34  KDTMMTERGGEVHLRKSFSLWSILGVGFGLTNSWFGISVSMVTGIFSGGPMMIVYGIIIV 93

Query: 114 GGLILTVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIV 173
             + + VG +L ELSS+ P AG  +    + AP + ++  +Y  G         +  S  
Sbjct: 94  ALISICVGASLGELSSAYPHAGGQFWWSLKLAPPKHKRFAAYLCGSFAYAGSVFTSASTT 153

Query: 174 YGLAQQILSAVVVSNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCX 233
              A +++    +++PDF    P  + VF  C   M +  +L   F    +++ ++S   
Sbjct: 154 LSAATEVVGMYALAHPDFT---PKRWHVFV-CFEIMHLFLTL---FNCYGKSLPLISASA 206

Query: 234 XXXXXXXXXPIGVSRSDKLNHSFNNAKFIFGKSENFTDW-NGGWSWCINGLTPAIWTIGA 292
                     I V+     +  FN+AKF+F    N T W N G ++ +  + PA W+   
Sbjct: 207 LYISLLSFFTITVTVLACSSGKFNDAKFVFATFYNETGWKNSGIAFIVGLINPA-WSFSC 265

Query: 293 YDSCLHMAEEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGI 352
            D   HMA E     R +PI I+G++A  +   +   I +   +  DL++++ S  G  I
Sbjct: 266 LDCATHMAFEVEKPERVIPIAIMGTVAIGFATSFCYVISMFFSIR-DLDSLMQSATGAPI 324

Query: 353 TQVFYDALGKRWTLAFLSFMIICQFLMGASTVVA----NSRQFWAFARDDALPFSNFFKK 408
             ++  ALG      FL  M++         ++A     +R  W+FARD  LPFS    +
Sbjct: 325 LDIYNQALGNTSGAIFLGCMVL---FTSFGCIIACHTWQARLGWSFARDKGLPFSGLLSQ 381

Query: 409 VNGSVAVPIRAVWXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRLTYGK 468
           VN  V VP+ A                    A ++L +  IA + ++   P+ + L   K
Sbjct: 382 VNPQVGVPLNAHLMSCALISLIGLLYLASSTAFNSLCTGCIAFLLLSYSIPV-ICLLRKK 440

Query: 469 KDFRPGPFYMGDFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVL 528
           +  + GPF+ G       N + + + +F I+   FP     + KD MNY  V+  GF   
Sbjct: 441 RQIKHGPFWFGKL-GYFFNIVLLGWAVFCIVFFSFP-PALPVTKDNMNYVSVVIVGFTAY 498

Query: 529 SLIYYYFWQSK 539
           +L+Y+ F   K
Sbjct: 499 ALLYWKFKGCK 509

>NCAS0D03750 Chr4 complement(696686..698395) [1710 bp, 569 aa] {ON}
           Anc_6.205
          Length = 569

 Score =  146 bits (368), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 125/483 (25%), Positives = 220/483 (45%), Gaps = 21/483 (4%)

Query: 67  ELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAG-PVGLSWGWFVAGGLILTVGIALA 125
            L++ FS   I GV F +      I+++M  G+ +G P+ + +G  +   + + +G +L+
Sbjct: 54  HLRKSFSVWSILGVGFGLTNSWFGISASMVTGISSGGPMMVVYGIIIIALVSICIGTSLS 113

Query: 126 ELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVV 185
           ELSS+ P AG  +    + AP + ++  +Y  G         +  S    +A +++    
Sbjct: 114 ELSSAYPHAGGQFFWSLKLAPPKHKRFAAYLCGSFAYAGSVFTSASTTLSVATEVVGMYA 173

Query: 186 VSNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCXXXXXXXXXXPIG 245
           +++PDF V     + +F    +   +L  L   F    +++  +S             I 
Sbjct: 174 LTHPDFKVQR---WHIF----VCFELLHLLLMLFNCYGKSLPFISASSLYISLVSFFTIT 226

Query: 246 VSRSDKLNHSFNNAKFIFGKSENFTDW-NGGWSWCINGLTPAIWTIGAYDSCLHMAEEAR 304
           V+     + +FN+ KF+F    N T W NGG ++ +  + PA W+    D   HMA E  
Sbjct: 227 VTVLACSHGNFNDPKFVFATFYNETGWKNGGIAFIVGLINPA-WSFSCLDCATHMAFEVE 285

Query: 305 DAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKRW 364
              R +PI I+G+IA  +   +   I +   +  DL+ I+ S  G  I  ++   LG + 
Sbjct: 286 KPERVIPIAIMGTIAIGFATSFCYVIAMFFSLR-DLDKILTSTTGAPILDIYNQVLGNKS 344

Query: 365 TLAFLSFMIICQFLMGASTVVA----NSRQFWAFARDDALPFSNFFKKVNGSVAVPIRAV 420
              FL  +++         V+A     +R  W+FARD+ LP+S+ + +VN  + VP+ A 
Sbjct: 345 GAIFLGCLVL---FTSFGCVIACHTWQARLCWSFARDNGLPWSHLWAQVNPQMGVPLNAH 401

Query: 421 WXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFYMGD 480
                              A ++L +  IA + ++ I P+ + L   K+  R GPF++G 
Sbjct: 402 LMSCAWISLIGILYLASSTAFNSLITGCIAFLLLSYIIPV-ICLLMKKRQIRHGPFWLGK 460

Query: 481 FWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQSKF 540
           F     N I +A+  F II   FP     + KD MNY  V+  G+   +L+Y+ F   K 
Sbjct: 461 F-GLFSNIILLAWTAFAIIFFSFP-PVLPVTKDNMNYVAVVIVGYTSYALLYWRFKGRKE 518

Query: 541 YEG 543
           +  
Sbjct: 519 FHA 521

>Kpol_1033.41 s1033 complement(106505..108265) [1761 bp, 586 aa]
           {ON} complement(106505..108265) [1761 nt, 587 aa]
          Length = 586

 Score =  146 bits (368), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 124/503 (24%), Positives = 226/503 (44%), Gaps = 22/503 (4%)

Query: 48  DAKNATSDQQVLAE---IGYKEELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAG-P 103
           +  ++ SD++ + +    G +  L++ FS   I GV F +      I++++  G+ +G P
Sbjct: 38  ENDHSISDKKEIQQGGGNGDEVHLRKSFSLWSILGVGFGLTNSWFGISASLVTGISSGGP 97

Query: 104 VGLSWGWFVAGGLILTVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTL 163
           + + +G  +   + + VG++L ELSS+ P AG  +    + AP + ++  +Y  G     
Sbjct: 98  MMVVYGIIIIALISVCVGVSLGELSSAYPHAGGQFWWSLKLAPQKHKRFAAYLCGSFAYA 157

Query: 164 SLCASVCSIVYGLAQQILSAVVVSNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKL 223
               +  S    +A +++    +++P+F+   P  + VF    +   +L      F    
Sbjct: 158 GSVFTSASTTLSVATELVGMYSLTHPEFI---PQRWHVF----VCFELLHLFLMLFNCYG 210

Query: 224 QTISIVSNCXXXXXXXXXXPIGVSRSDKLNHSFNNAKFIFGKSENFTDWNGGWSWCINGL 283
           +++ ++S             I V+     + +FN+ KF+F    N T W       I GL
Sbjct: 211 KSLPLISTTSLYISLASFLTITVTVLGCSHGNFNDPKFVFATFYNQTGWKNSVIAFITGL 270

Query: 284 TPAIWTIGAYDSCLHMAEEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNI 343
               W+    D   HMA E     R +PI I+G+IA  ++  +   I +   +  DL+ +
Sbjct: 271 INPAWSFSCLDCATHMAFEVEKPERVIPIAIMGTIAIGFVTSFCYVIAMFFSIR-DLDAL 329

Query: 344 INSPYGQGITQVFYDALGKRWTLAFLSFMIICQFLMGASTVVA----NSRQFWAFARDDA 399
             S  G  I  ++  ALG +     L  +I+         V+A     +R  W+F+RD  
Sbjct: 330 FASHTGAPILDIYNQALGNKGGAIVLGCLIL---FTSFGCVIACHTWQARLCWSFSRDKG 386

Query: 400 LPFSNFFKKVNGSVAVPIRAVWXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFP 459
           LP+S+ + +VN  + VP+ A                    A ++L +  IA + ++ I P
Sbjct: 387 LPYSHLWAQVNPQLGVPLNAHLMSCAWISLIGILYIASTTAFNSLITGCIAFLLLSYIIP 446

Query: 460 ITLRLTYGKKDFRPGPFYMGDFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTV 519
           +   L   K+  + GPF++G F     N + + + LF I+   FP  Q  + KD MNY  
Sbjct: 447 VICLLK-KKRQIKHGPFWLGKF-GLFSNIVLLGWTLFAIVFFSFP-PQLPVTKDNMNYVS 503

Query: 520 VIGPGFWVLSLIYYYFWQSKFYE 542
           V+  G+ +  LIY+ F  SK + 
Sbjct: 504 VVIVGYTLYVLIYWKFKGSKEFH 526

>CAGL0H03399g Chr8 complement(316110..317780) [1671 bp, 556 aa] {ON}
           highly similar to uniprot|P19807 Saccharomyces
           cerevisiae YGL077c HNM1 choline permease
          Length = 556

 Score =  144 bits (362), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 127/515 (24%), Positives = 226/515 (43%), Gaps = 14/515 (2%)

Query: 32  ELRSITSAHGAPIR-YIDAKNATSDQQVLAEIGYKEELKREFSTLQIFGVAFSIMGLLPS 90
           E  SITS   + +    +AKN     +    I  +  L++ FS   I GV F +      
Sbjct: 7   ERTSITSQQDSILDGQFEAKNGKKIIEQEQSIDGEVHLRKSFSLWSILGVGFGLTNSWFG 66

Query: 91  IASTMDGGLYAG-PVGLSWGWFVAGGLILTVGIALAELSSSIPTAGAVYVSCYQWAPARW 149
           I+++M  G+ +G P+ + +G  +   + + +G++L ELSS+ P AG  +    + AP + 
Sbjct: 67  ISASMVTGINSGGPMMIVYGIIIIALISVCIGVSLGELSSAYPHAGGQFWWSLKLAPTKH 126

Query: 150 RKSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVSNPDFVVTDPITYGVFAACVIAM 209
           ++  +Y  G         +  S     A +++   V+++P+F    P  + +F    +  
Sbjct: 127 KRFAAYLCGSFAYAGSLFTSASTTLSAATELVGMYVLTHPEFT---PKRWHIF----VCF 179

Query: 210 AVLTSLASGFTSKLQTISIVSNCXXXXXXXXXXPIGVSRSDKLNHSFNNAKFIFGKSENF 269
            +L      F    +++ ++S             I V+     +  FN+AKF+F    N 
Sbjct: 180 ELLHLFLMLFNCYGKSLPLISASSLYISLTSFFVITVTVLACSSGKFNDAKFVFATFYNE 239

Query: 270 TDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEARDAVRAVPIGIVGSIASCWILGWLIC 329
           T W       I GL    W+    D   HMA E     R +PI I+G+IA  ++  +   
Sbjct: 240 TGWKNSVIAFIVGLINPAWSFSCLDCATHMAFEVEKPERVIPIAIMGTIAIGFLTSFCYV 299

Query: 330 IVLLACMDPDLNNIINSPYGQGITQVFYDALG-KRWTLAFLSFMIICQFLMGASTVVANS 388
           I +   +  DL+ ++ S  G  I  ++  A   K   +     ++I  F    +     +
Sbjct: 300 IAMFFSIR-DLDALLASNTGAPILNIYEQATNSKAGAIVLGCLVLITSFGCIIACHTWQA 358

Query: 389 RQFWAFARDDALPFSNFFKKVNGSVAVPIRAVWXXXXXXXXXXXXXXXXEVAADALFSLS 448
           R  W+FARD+ LP+S ++ +VN +  VP+ A                    A ++L +  
Sbjct: 359 RLGWSFARDNGLPYSKYWSQVNPNAGVPLNAHLMSSALIALIGVLYLASTTAFNSLITGC 418

Query: 449 IAGMYMALIFPITLRLTYGKKDFRPGPFYMGDFWSPIINWISVAFQLFTIIMVMFPYQQH 508
           IA + ++ I P+ + L   K+  R GPF++G F     N + + + LF I+   FP    
Sbjct: 419 IAFLLLSYIIPV-ICLLMRKRQIRQGPFWLGKF-GLFSNIVLLGWTLFAIVFFSFP-PVL 475

Query: 509 NIDKDTMNYTVVIGPGFWVLSLIYYYFWQSKFYEG 543
            + KD MNY  V+  G+ V ++ Y+ F   K +  
Sbjct: 476 PVSKDNMNYVSVVIVGYTVYAIAYWEFKGKKEFHA 510

>KNAG0D05140 Chr4 complement(937630..939261) [1632 bp, 543 aa] {ON}
           Anc_6.205 YGL077C
          Length = 543

 Score =  142 bits (359), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 130/505 (25%), Positives = 231/505 (45%), Gaps = 22/505 (4%)

Query: 65  KEELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAG-PVGLSWGWFVAGGLILTVGIA 123
           +  L++ FS   I GV F +      I+ +M  G+ +G P+ + +G  +   + + VG +
Sbjct: 51  EPHLRKSFSLWSILGVGFGLTNSWFGISVSMVTGIMSGGPMMIVYGIIIIALISVCVGGS 110

Query: 124 LAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQQILSA 183
           L ELSS+ P AG  +    + APAR R+  ++  G         +  S       +++  
Sbjct: 111 LGELSSAYPHAGGQFWWALKLAPARHRRFAAFLCGSFAYAGSVFTSASTTLSAGTEVVGM 170

Query: 184 VVVSNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCXXXXXXXXXXP 243
             + +P FVV     + VF  C   + +   L   F    +++ ++S+            
Sbjct: 171 YALKHPGFVVKR---WHVFV-CFELIHLFLML---FNCYGKSLPLISSSSLYISLISFLT 223

Query: 244 IGVSRSDKLNHSFNNAKFIFGKSENFTDW-NGGWSWCINGLTPAIWTIGAYDSCLHMAEE 302
           I ++     + SFN++KF+F    N T W N G ++ +  + PA W+    DS  HMA E
Sbjct: 224 ITITVLACSSGSFNDSKFVFATFYNETGWKNSGMAFIMGLINPA-WSFSCLDSATHMAFE 282

Query: 303 ARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALGK 362
                R +P  I+G++A  ++  +   I +   +  D++ ++ S  G  I +++  ALG 
Sbjct: 283 VERPERVIPTAIMGTVAIGFVTSFCYVIAMFFSIR-DISAVLKSTTGAPILEIYRQALGN 341

Query: 363 RWTLAFLSFMII-CQFLMGASTVVANSRQFWAFARDDALPFSNFFKKVNGSVAVPIRAVW 421
                FL  +++   F    S     +R  W+F+RD+ LP+S ++ +VN  V VP+ A  
Sbjct: 342 EGGAIFLGCLVLFTSFGCIISCHTWQARLCWSFSRDNGLPYSKWWSQVNPDVGVPLNAHL 401

Query: 422 XXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFYMGDF 481
                             A ++L +  IA + ++   PI   L + ++D   GPF++G F
Sbjct: 402 MSCAWISLIGVLYLASSTAFNSLITACIAFLLLSYSVPIVC-LLWRRRDIPQGPFWLGKF 460

Query: 482 WSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQS--- 538
                N + +A+ +F ++   FP     +D++ MNY  V+  GF   SL+Y+ F  S   
Sbjct: 461 -GLFANVVLLAWTVFAVVFFSFP-PVLPVDRNNMNYVCVVIVGFVTYSLLYWRFKGSRDF 518

Query: 539 -KFYEGPKSNLSDEEFAERVGDDVL 562
            K  + P   L D   AE  G+ +L
Sbjct: 519 HKVEDEPGEKLVD---AESTGESIL 540

>KLTH0H04444g Chr8 (397467..399065) [1599 bp, 532 aa] {ON} similar
           to uniprot|P19807 Saccharomyces cerevisiae YGL077C HNM1
           Choline transporter (permease) that also controls the
           uptake of nitrogen mustard expression is co- regulated
           with phospholipid biosynthetic genes and negatively
           regulated by choline and myo- inositol
          Length = 532

 Score =  142 bits (358), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 129/535 (24%), Positives = 244/535 (45%), Gaps = 29/535 (5%)

Query: 32  ELRSITSAHGAPIRYIDAKNATSDQQVLAEIGYKE---ELKREFSTLQIFGVAFSIMGLL 88
           E RS+ S  G  +R +  ++     + +++ G +     L+++FS   I GV F +    
Sbjct: 10  EERSLNS--GDNVRELRKEDDILVTESVSKNGEEHGEVHLRKQFSLWSILGVGFGLTNSW 67

Query: 89  PSIASTMDGGLYAG-PVGLSWGWFVAGGLILTVGIALAELSSSIPTAGAVYVSCYQWAPA 147
             I+++M  G+ +G P+ + +G  +   + + + ++L ELSS+ P AG  +    + AP 
Sbjct: 68  FGISTSMITGIMSGGPMMVVYGIIIIALISICIAVSLGELSSAYPHAGGQFWWSLKLAPP 127

Query: 148 RWRKSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVSNPDFVVTDPITYGVFAACVI 207
           + ++  +Y  G L       +  S    +A +I+    +++P+F V    T+       +
Sbjct: 128 KHKRFAAYMCGSLAWAGSVFTSASTTLSVAAEIVGMYALTHPEFEVKRWHTF-------V 180

Query: 208 AMAVLTSLASGFTSKLQTISIVSNCXXXXXXXXXXPIGVSRSDKLNHSFNNAKFIFGKSE 267
              VL      F    + + ++S+            I ++     +  +N+AKF+F    
Sbjct: 181 CFEVLHLFLMLFNCYGKALPLISSSSLYISLFSFITITITVLACSHGKYNDAKFVFATFY 240

Query: 268 NFTDW-NGGWSWCINGLTPAIWTIGAYDSCLHMAEEARDAVRAVPIGIVGSIASCWILGW 326
           N T W N G ++ +  + PA W+    D   HMA E     R +PI I+G++A  ++  +
Sbjct: 241 NETGWKNSGIAFIVGLINPA-WSFSCLDCATHMAFEVEKPERVIPISILGTVAIGFVTSF 299

Query: 327 LICIVLLACMDPDLNNIINSPYGQGITQVFYDALG-KRWTLAFLSFMIICQFLMGASTVV 385
              I +   +  +L+ ++NS     I  ++Y ALG K   +     ++   F    +   
Sbjct: 300 CYVIAMFFSLQ-NLDKVVNSNTQVPILDIYYQALGSKAGAIVLGCLLLFTSFGCVIACHT 358

Query: 386 ANSRQFWAFARDDALPFSNFFKKVNGSVAVPIRAVWXXXXXXXXXXXXXXXXEVAADALF 445
             +R  W+FARD+ LPFS ++ +V+  + VP+ A                    A ++L 
Sbjct: 359 WQARLCWSFARDEGLPFSRYWARVSPELGVPLNAHLMSSFWIVLLGCLYLASSTAFNSLI 418

Query: 446 SLSIAGMYMALIFPITLRLTYGKKDFRPGPFYMGDFWSPIINWISVAFQLFTIIMVMFPY 505
           +  I  + ++   P+   L   K++ + GPF++G F     N + + + LF+I+   FP 
Sbjct: 419 TGCIMFLLLSYTIPVVC-LLLKKRNIKHGPFWLGKF-GCFSNVVLLGWMLFSIVFFCFP- 475

Query: 506 QQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQSKFYEGPKSNLSDEEFAERVGDD 560
            Q  + KD MNY  V+  G+ + SL+   FWQ   + G  +  + E   E  G+D
Sbjct: 476 SQMPVVKDNMNYASVVIVGYLLFSLL---FWQ---FRGRHTFHALE---EEAGED 521

>ZYRO0G08602g Chr7 complement(697178..698887) [1710 bp, 569 aa] {ON}
           similar to uniprot|P19807 Saccharomyces cerevisiae
           YGL077C HNM1 Choline transporter (permease) that also
           controls the uptake of nitrogen mustard expression is
           co- regulated with phospholipid biosynthetic genes and
           negatively regulated by choline and myo-inositol
          Length = 569

 Score =  141 bits (356), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 124/521 (23%), Positives = 234/521 (44%), Gaps = 21/521 (4%)

Query: 45  RYIDAKNATSDQQVLAEIGYKEELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAG-P 103
           +Y D   +   ++V+        L++ FS   I GV F +      I++++  GL +G P
Sbjct: 38  KYDDESGSGGSEEVV--------LRKSFSLWSILGVGFGLTNSWFGISASLVTGLSSGGP 89

Query: 104 VGLSWGWFVAGGLILTVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTL 163
           + + +G  +   + +T+G++L EL+S+ P AG  +    + AP + ++  +Y  G     
Sbjct: 90  LLVIYGIILISLISITIGVSLGELTSAYPHAGGQFWWSLKLAPPKHKRFAAYMCGSFAYA 149

Query: 164 SLCASVCSIVYGLAQQILSAVVVSNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKL 223
               +  S    +A ++++   +++ DF    P  + VF   +I    L      F    
Sbjct: 150 GAIFTSASTTLSVASELVAMYQLTHEDFT---PKRWQVFVTYLILHFFLMQ----FNCYG 202

Query: 224 QTISIVSNCXXXXXXXXXXPIGVSRSDKLNHSFNNAKFIFGKSENFTDWNGGWSWCINGL 283
           +++ ++++            I ++     +  FN+AKF+F    N T W+ G    I GL
Sbjct: 203 KSLPLIASSSLYISLLSFIVITITVLACSSGHFNSAKFVFSHFYNETGWSSGGIAFIVGL 262

Query: 284 TPAIWTIGAYDSCLHMAEEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNI 343
               W+    D   HMA E       +P  I+G+IA  +I  +   I L   +  DL ++
Sbjct: 263 INPAWSFSCLDCATHMAFEVEKPETIIPTAILGTIAIGFITSFCYVISLFFSIR-DLPSV 321

Query: 344 INSPYGQGITQVFYDALGKRWTLAFLSFMII-CQFLMGASTVVANSRQFWAFARDDALPF 402
           +N+  G  +  ++  AL  +     L  +I+   F    ++    SR  W+F+RD  LPF
Sbjct: 322 LNNTGGFPVLVIYEQALNSKAGAIVLGCLILFTSFGCVIASHTWQSRLCWSFSRDGGLPF 381

Query: 403 SNFFKKVNGSVAVPIRAVWXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPITL 462
           +  + KVN  + VP+ A                    A ++L +  IA + ++   P+ +
Sbjct: 382 AGLWSKVNSRMGVPLNAHLMSCVWVAIIGFLYLASSTAFNSLITACIAFLLLSYSIPV-I 440

Query: 463 RLTYGKKDFRPGPFYMGDFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIG 522
            L   K+    GPF+ G F     N   + + +F ++   FP   + ++KD MNY  V+ 
Sbjct: 441 CLLMKKRQIAHGPFWFGKF-GLFCNIALLLWTVFCLVFFSFP-PDYPVNKDNMNYVSVVI 498

Query: 523 PGFWVLSLIYYYFWQSKFYEGPKSNLSDEEFAERVGDDVLD 563
            G+++ SLIY+ FW SK +     +  ++  A+ + ++  D
Sbjct: 499 VGYFLYSLIYWKFWASKDFHTHDDDDDEQTVAQEISNEGFD 539

>NDAI0I01140 Chr9 (276535..278337) [1803 bp, 600 aa] {ON} Anc_6.205
          Length = 600

 Score =  141 bits (355), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 122/472 (25%), Positives = 215/472 (45%), Gaps = 15/472 (3%)

Query: 67  ELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAG-PVGLSWGWFVAGGLILTVGIALA 125
            L++ FS   + GV F +      I+++M  G+ +G P+ + +G  +   + + +G +L 
Sbjct: 67  HLRKSFSLWSVLGVGFGLTNSWFGISTSMVTGISSGGPMMVIYGIIIIALISICIGTSLG 126

Query: 126 ELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVV 185
           ELSS+ P AG  +    + AP ++++  +Y  G         +  S     A +++    
Sbjct: 127 ELSSAYPHAGGQFWWSLKLAPPKYKRLAAYMCGSFAYAGSVFTSASTTLSAATEVVGMYA 186

Query: 186 VSNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCXXXXXXXXXXPIG 245
           +++ DFV   P  + VF    +   +L      F    +++ I+S             I 
Sbjct: 187 LTHEDFV---PKRWHVF----VCFEILHLFLMIFNCYGKSLPIISASSLYISLSSFLIIT 239

Query: 246 VSRSDKLNHSFNNAKFIFGKSENFTDW-NGGWSWCINGLTPAIWTIGAYDSCLHMAEEAR 304
           ++        FN+AKF+F    N T W N G ++ +  + PA W+    D   HMA E  
Sbjct: 240 ITVLACSRGQFNDAKFVFATFYNETGWKNSGIAFIVGLINPA-WSFSCLDCATHMAFEVE 298

Query: 305 DAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKRW 364
              R +PI I+ +IA  +I  +   I +   +  DL++I+ S  G  I  ++  ALG + 
Sbjct: 299 KPERVIPIAILSTIAIGFITSFCYVISMFFSLR-DLDSILKSTTGAPILDIYNQALGNKA 357

Query: 365 TLAFLSFMII-CQFLMGASTVVANSRQFWAFARDDALPFSNFFKKVNGSVAVPIRAVWXX 423
               L  MI+   F    +     +R  W+FARD+ LP+S  + +VN  V VP+ A    
Sbjct: 358 GAIILGCMILFTSFGCVIACHTWQARLGWSFARDNGLPYSKLWAQVNPQVGVPLNAHLMS 417

Query: 424 XXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFYMGDFWS 483
                           A ++L +  IA + ++ I P++  L   K+  R GPF++G F  
Sbjct: 418 CAWISLIGILYLASSTAFNSLITGCIAFLLLSYIIPVSC-LLLKKRQIRHGPFWLGKF-G 475

Query: 484 PIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYF 535
              N + + + +F I+   FP     + KD MNY  V+  G+ + S++Y+ F
Sbjct: 476 LFSNIVLLLWTVFAIVFFSFPAMM-PVTKDNMNYVAVVIAGYTLYSVLYWNF 526

>TBLA0A01960 Chr1 complement(473787..475571) [1785 bp, 594 aa] {ON}
           Anc_6.205 YGL077C
          Length = 594

 Score =  138 bits (347), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 126/534 (23%), Positives = 240/534 (44%), Gaps = 25/534 (4%)

Query: 29  NVAELRSITSAHGAPIRYIDAKNATSDQQVLAEIGYKEELKREFSTLQIFGVAFSIMGLL 88
           + A    + S   + I  +D  +  ++     E+     L++ FS   I GV F +    
Sbjct: 23  DTASFNQLGSVSSSKISDLDKNSINNEFNQTEEV----HLRKSFSLWSILGVGFGLTNSW 78

Query: 89  PSIASTMDGGLYAG-PVGLSWGWFVAGGLILTVGIALAELSSSIPTAGAVYVSCYQWAPA 147
             I+++M  G+ +G P+ + +G  +   + + VG++L ELSS+ P AG  +    + AP 
Sbjct: 79  FGISASMVTGIESGGPMMIVYGIIIISLISICVGVSLGELSSAYPHAGGQFFWSLKLAPP 138

Query: 148 RWRKSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVSNPDFVVTDPITYGVFAACVI 207
           + R+  +Y  G         +  S    +A +++    + +  FV   P  + VF  C  
Sbjct: 139 KHRRFAAYMCGSYAYAGSVFTSASTTLSVATELVGMYALCHESFV---PRRWHVFV-CFE 194

Query: 208 AMAVLTSLASGFTSKLQTISIVSNCXXXXXXXXXXPIGVSRSDKLNHSFNNAKFIFGKSE 267
            + +   L + +    +++  +S+            I ++     +  +N+AKF+F    
Sbjct: 195 LLHLFLLLFNCYG---KSLPFISSSSLYISLLSFFTITITVLACAHGKYNDAKFVFATFY 251

Query: 268 NFTDW-NGGWSWCINGLTPAIWTIGAYDSCLHMAEEARDAVRAVPIGIVGSIASCWILGW 326
           N T W NGG ++ +  + PA W+    D   HMA E     R +P+ I+G+IA  +I  +
Sbjct: 252 NETGWKNGGIAFIVGLINPA-WSFSCLDCATHMAFEVEKPERVIPMAIMGTIAIGFITSF 310

Query: 327 LICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKRWTLAFLSFMIICQFLMGASTVVA 386
              I +   ++ DLN + NS  G  I  ++  AL  +     L  +++         V+A
Sbjct: 311 CYVIAMFFSLN-DLNALFNSHTGAPILDIYNQALHNKAGAIVLGCLVL---FTSFGCVIA 366

Query: 387 ----NSRQFWAFARDDALPFSNFFKKVNGSVAVPIRAVWXXXXXXXXXXXXXXXXEVAAD 442
                +R  W+FA D  LP+S ++ +VN ++ VP+ A                    A +
Sbjct: 367 CHTWQARLCWSFATDQGLPYSKWWAEVNPTLGVPLNAHLMSCGWIAIIGLLYLASSTAFN 426

Query: 443 ALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFYMGDFWSPIINWISVAFQLFTIIMVM 502
           +L +  IA + ++ I P+ + L   K+  + GPF++G F     N + + + LF+I+   
Sbjct: 427 SLITGCIAFLLLSYIIPV-ICLLQKKRQIKHGPFWLGKF-GLFSNIVLLCWTLFSIVFFS 484

Query: 503 FPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQSKFYEGPKSNLSDEEFAER 556
           FP     ++++ MNY  V+  GF    LIY+ +  +K +   + +  + E+   
Sbjct: 485 FP-PNLPVNRNNMNYVCVVIVGFTCYQLIYWKWKGAKEFHSAQDDDDNIEYENN 537

>KLLA0C15521g Chr3 complement(1347098..1348741) [1644 bp, 547 aa]
           {ON} similar to uniprot|P19807 Saccharomyces cerevisiae
           YGL077C HNM1 Choline transporter (permease) that also
           controls the uptake of nitrogen mustard expression is
           co- regulated with phospholipid biosynthetic genes and
           negatively regulated by choline and myo-inositol
          Length = 547

 Score =  137 bits (346), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 119/478 (24%), Positives = 206/478 (43%), Gaps = 22/478 (4%)

Query: 67  ELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAG-PVGLSWGWFVAGGLILTVGIALA 125
            L++ FS   I GV F +      I+ +M  G+Y+G P+ + +G  +   + + + + L 
Sbjct: 56  HLRKSFSLWSILGVGFGLTNSWFGISVSMVTGIYSGGPMMVVYGIIIIALISICIAVTLG 115

Query: 126 ELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVV 185
           ELSS+ P AG  +    Q AP ++R+  +Y  G         S  S    +A +++    
Sbjct: 116 ELSSAFPHAGGQFWWSLQLAPPKYRRLAAYLCGSFAWAGAIFSSASTTLSVASELVGMYA 175

Query: 186 VSNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCXXXXXXXXXXPIG 245
           +++PDF V     + VF    +   +L      F    + + ++S             I 
Sbjct: 176 LTHPDFEVKR---WHVF----VCFQILHLFLMMFNCSGKALPVISQSSLYISLISFFTIT 228

Query: 246 VSRSDKLNHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEARD 305
           V+     +  +N+AKF+F    N T W  G    I GL    W+    D   HMA E  +
Sbjct: 229 VTVLACSHGKYNDAKFVFATFYNETGWKNGVIAFIVGLINPAWSFSCLDCATHMAFEVEN 288

Query: 306 AVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKRWT 365
             R +PI I+ ++   ++  +   I +   +  DL  + +S  G  I ++F  A      
Sbjct: 289 PERVIPISILCTVGIGFLTSFSYVIAMFFSLQ-DLEAVASSNTGMPILEIFRQATKSTPG 347

Query: 366 LAFLSFMIICQFLMGASTVVA----NSRQFWAFARDDALPFSNFFKKVNGSVAVPIRAVW 421
              L  +I+         V+A     +R  W+FARD+ +P+S ++ K++  + VP+ A  
Sbjct: 348 AVVLGCLIL---FTSFGCVIACHTWQARLCWSFARDNGIPYSKYWAKIDPELGVPLNAHL 404

Query: 422 XXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFYMGDF 481
                             A ++L +  IA +  +   P+   L   K++ + GPF++G F
Sbjct: 405 LSCALISLLGCLYMASTTAFNSLITGCIAFLLFSYSVPVVCLLAR-KRNIKHGPFWLGKF 463

Query: 482 WSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQSK 539
                N + + + LF ++   FP     + KD MNY  V+  GF    L Y  FWQ K
Sbjct: 464 -GAFSNIVLLGWNLFALVFFCFP-AVMPVTKDNMNYASVVIVGFL---LFYLGFWQFK 516

>KAFR0K00360 Chr11 (79233..80849) [1617 bp, 538 aa] {ON} Anc_6.205
           YGL077C
          Length = 538

 Score =  129 bits (324), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 124/540 (22%), Positives = 239/540 (44%), Gaps = 35/540 (6%)

Query: 49  AKNATSDQQVLAEIGYKEE----LKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAG-P 103
           +   + D ++L++   +++    L++ FS   I GV F +      I+++M  G+ +G P
Sbjct: 22  SNTPSKDPEILSDKLIEQDEDIHLRKSFSLWSILGVGFGLTNSWFGISASMITGITSGGP 81

Query: 104 VGLSWGWFVAGGLILTVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTL 163
           + + +G  +   + + +G++L ELSS+ P AG  +    Q A  + ++  +Y  G     
Sbjct: 82  MMIVYGIIIIALISICIGVSLGELSSAYPHAGGQFHWTLQLASPKHKRFAAYMCGSFAYA 141

Query: 164 SLCASVCSIVYGLAQQILSAVVVSNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKL 223
               +  S    +A  ++    +++ +F+   P  + VF  C   + +   L   F    
Sbjct: 142 GSVFTSASTTLSVATLLVGMYSLTHENFI---PKRWHVFV-CFELVHLFLML---FNCYG 194

Query: 224 QTISIVSNCXXXXXXXXXXPIGVSRSDKLNHSFNNAKFIFGKSENFTDWNGGWSWCINGL 283
           +++ ++S+            I ++     +  FN++KF+F    N T W       I GL
Sbjct: 195 KSLPLISSSSLYISLFSFFTITITVLACSSGKFNDSKFVFATFYNETGWKSSAIAFIVGL 254

Query: 284 TPAIWTIGAYDSCLHMAEEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNI 343
               W+    D   HMA E     R +P+ I+G+IA    +G+L     +  M   + NI
Sbjct: 255 INPAWSFSCLDCATHMAFEVEKPERVIPMAIMGTIA----IGFLTSFAYVISMFFSIRNI 310

Query: 344 ---INSPYGQGITQVFYDALGKRWTLAFLSFMIICQFLMGASTVVA----NSRQFWAFAR 396
              +NS  G  I +++  ALG +     L  +++         V+A     +R  W+FAR
Sbjct: 311 QDVLNSNSGAPILEIYNQALGNKAGAVILGCLVL---FTSFGCVIACHTWQARLCWSFAR 367

Query: 397 DDALPFSNFFKKVNGSVAVPIRAVWXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMAL 456
           D  LP+S F+ +VN +  VP+ A                    A ++L +  IA + ++ 
Sbjct: 368 DKGLPYSRFWSQVNPTFGVPLHAHLMSCTLISIIGLLYLASSTAFNSLITACIAFLLLSY 427

Query: 457 IFPITLRLTYGKKDFRPGPFYMGDFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMN 516
             P+ + L   K+D   GPF++G F     N + +A+ +F+++   FP  Q  ++++ MN
Sbjct: 428 SIPV-ICLLLRKRDMNRGPFWLGKF-GLFSNIVLLAWTVFSLVFFSFP-SQIPVNRNNMN 484

Query: 517 YTVVIGPGFWVLSLIYYYFWQSKFYEGPKSNLSDEEFAERVGDDVLDAILSSNVEVNNDR 576
           Y  V+  G+   S+ Y+      F +G      D+       ++  D +   +V +  D+
Sbjct: 485 YVSVVIAGYTFFSVSYW------FVKGKNEFYLDDNIISSSSEEEADIVTREDVILIEDK 538

>Kwal_56.24009 s56 complement(812371..813399) [1029 bp, 342 aa] {ON}
           YGL077C (HNM1) - Transporter (permease) for choline and
           nitrogen mustard; share homology with UGA4 [contig 168]
           PARTIAL
          Length = 342

 Score =  110 bits (274), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 85/315 (26%), Positives = 148/315 (46%), Gaps = 19/315 (6%)

Query: 255 SFNNAKFIFGKSENFTDW-NGGWSWCINGLTPAIWTIGAYDSCLHMAEEARDAVRAVPIG 313
           ++N+ KF+F    N T W N G ++ +  + PA W+    D   HMA E     R +PI 
Sbjct: 39  NYNDPKFVFATFFNETGWRNSGIAFIVGLINPA-WSFSCLDCATHMAFEVERPERVIPIS 97

Query: 314 IVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKRWTLAFLSFMI 373
           I+G++A  ++  +   I +   +  +L+ I+ S  G  I  ++  ALG +     L  ++
Sbjct: 98  ILGTVAIGFVTSFCYVIAMFFSLH-NLDEIVGSNTGAPILDIYLQALGNKAGAVVLGCLV 156

Query: 374 ICQFLMGASTVVA----NSRQFWAFARDDALPFSNFFKKVNGSVAVPIRAVWXXXXXXXX 429
           +         V+A     +R  W+FARD+ LP+S  + KV+  + VP+ A          
Sbjct: 157 L---FTSFGCVIACHTWQARLCWSFARDEGLPYSRIWAKVSPELGVPLNAHLMSCFWIVL 213

Query: 430 XXXXXXXXEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFYMGDFWSPIINWI 489
                     A ++L +  I  +  + I P+ + L   K++ + GPF++G F     N +
Sbjct: 214 LGLLYLASTTAFNSLITGCIMFLLFSYIVPV-ICLLIKKRNIKHGPFWLGKF-GLFANIV 271

Query: 490 SVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQSKFYEGPKSNLS 549
            + + LF ++   FP+    +DKD MNY  V+  G+ + SL++++F      +G  S   
Sbjct: 272 LLGWSLFALVFFCFPFVM-PVDKDNMNYASVVIVGYILFSLLFWHF------KGRHSFHL 324

Query: 550 DEEFAERVGDDVLDA 564
            EE  E V     DA
Sbjct: 325 LEEEEENVFPLETDA 339

>Kwal_33.13806 s33 complement(401429..403078) [1650 bp, 549 aa] {ON}
           YKL174C - Hypothetical ORF [contig 110] PARTIAL
          Length = 549

 Score = 99.0 bits (245), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 112/533 (21%), Positives = 233/533 (43%), Gaps = 22/533 (4%)

Query: 50  KNATSDQQVLAEIGYKEELKREF-STLQIFGVAFSIMGLLPSIASTMDGGLY-AGPVGLS 107
           ++   +Q+ +    Y+++L R F S   I G+ F++M  +  +++TM+ GL   GP+ + 
Sbjct: 31  QDGDDEQEEVQAFKYEQQLDRSFLSKGSIIGLGFALMSPVLGMSTTMNIGLLNGGPMTIL 90

Query: 108 WGWFVAGGLILTVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCA 167
            G+ + G       ++L E+ S  P    ++      AP  ++ S S+  G+L  L    
Sbjct: 91  LGFLINGLATWLCSLSLGEIVSRFPIE--LHGGSAMLAPYNYQLSCSWFTGWLMLLGNWT 148

Query: 168 SVCSIVYGLAQQILSAVVVSNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTIS 227
              SI +  AQ ++S V ++N   +    I      A  I + ++  +   F S ++ ++
Sbjct: 149 MSTSITFAGAQLVISLVTMANDQLIGEKYIVLFTVLAFYIIVTIVGLINLRFASFIEAVN 208

Query: 228 IVSNCXXXXXXXXXXPIGVSRSDKLNHS--FNNAKF-IFGKSENFTDWNGGWSWCINGLT 284
            V  C           I +     L HS  + + K+ +F    +F+ ++      + G  
Sbjct: 209 KV--CVYWIIYAV---IFIDILLLLFHSGSYRSLKYALFHFDNSFSGYSSKALSFMIGFQ 263

Query: 285 PAIWTIGAYDSCLHMAEEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNII 344
            + +T+  +     +A+E +   R +P G+  ++ +  + G +  + ++  + PD   II
Sbjct: 264 QSSFTLQGFSMLPALADEVKRPERDIPKGMFTAVLTSTLTGIVFLLPIMIIL-PDTKTII 322

Query: 345 NSPYGQGITQVFYDALGKRWTLAFLSFMIICQ-FLMGASTVVANSRQFWAFARDDALPFS 403
           ++P    I  +F  +    +   FL  MI+   F  G  ++  +SR  ++ +RD ALP+S
Sbjct: 323 DNPKLMPIVLIFTQSTHSMFVSLFLVIMILGNLFFSGIGSITTSSRAVYSMSRDMALPYS 382

Query: 404 NFFKKVNGSV--AVPIRAVWXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPIT 461
            F+  V+ +    VP  ++                   A +A    ++  +  A   P+ 
Sbjct: 383 EFWSYVDPTSDHRVPKNSILLSMGISYLLGLLALVSTAAFNAFMGAAVMCLCSATCIPLV 442

Query: 462 LRLTYGKKDFRPGPFYMGDFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVI 521
           L +   ++  R  P  +      ++N IS+ + LFT++++ +P  +  +   +MNY  ++
Sbjct: 443 LVMMSRRRALRGAPVKVRYRMGWLVNIISILWLLFTMVVICWP-PKLPVTLGSMNYAFLV 501

Query: 522 GPGFWVLSLIYYYFWQSKFYEGPKSNLSDEEFAERVGDDVLDAILSSNVEVNN 574
              F     + Y+ W    ++ P   L  EE   +  +  L +++  NVEV  
Sbjct: 502 YLLFLTGITVLYFRWGKYNFKTP---LIGEE--NKSNESTLTSVVLENVEVTK 549

>KLTH0F04576g Chr6 complement(404994..406643) [1650 bp, 549 aa] {ON}
           similar to uniprot|P36029 Saccharomyces cerevisiae
           YKL174C TPO5 Protein involved in excretion of putrescine
           and spermidine putative polyamine transporter in the
           Golgi or post-Golgi vesicles
          Length = 549

 Score = 95.5 bits (236), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 105/503 (20%), Positives = 218/503 (43%), Gaps = 17/503 (3%)

Query: 50  KNATSDQQVLAEIGYKEELKREF-STLQIFGVAFSIMGLLPSIASTMDGGLY-AGPVGLS 107
           ++A  +++ +    Y+++L R F S   + G+ F +M  +  +++TM  GL   GP+ + 
Sbjct: 31  QDADEEEEEVQRFKYEQQLDRSFLSKSSVIGLGFGLMSPVLGMSTTMSIGLLNGGPLTIV 90

Query: 108 WGWFVAGGLILTVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCA 167
            G+ + G       ++L E+ S  P    ++      A  +++ + S+  G+L  L    
Sbjct: 91  IGFLINGIATWLCSLSLGEIVSRFPIE--LHGGSAMLARQKFKLACSWFTGWLMLLGNWT 148

Query: 168 SVCSIVYGLAQQILSAVVVSNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTIS 227
              SI +  AQ ++S V ++N   +  + I      A  + + ++  +   F   ++T++
Sbjct: 149 MSTSITFAGAQLLVSLVTMTNDKLIGENYIVVTTVLAFYLIVTIVGLINLKFAGFIETVN 208

Query: 228 IVSNCXXXXXXXXXXPIGVSRSDKLNHS--FNNAKFIFGKSEN-FTDWNGGWSWCINGLT 284
            V  C           I +     L HS  + + K+     +N F+ ++      I G  
Sbjct: 209 KV--CVYWIVYAV---IFIDILLLLFHSGKYRSLKYALAHFDNSFSGYSSAALSFIIGFQ 263

Query: 285 PAIWTIGAYDSCLHMAEEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNII 344
            + +T+  +     +A+E +++ R +P G+  ++ +  + G +  + ++  + PD   II
Sbjct: 264 QSSFTLQGFSMLPALADEVKESERDIPKGMSTAVLTSTVTGVVFLLPIMLIL-PDTQTII 322

Query: 345 NSPYGQGITQVFYDALGKRWTLAFLSFMIICQFLM-GASTVVANSRQFWAFARDDALPFS 403
           N+P    I  +F  +    +   FL  MI+   L  G  +V  +SR  ++ +RD ALP+S
Sbjct: 323 NNPKVMPIALIFTQSTHSIFVSLFLVIMILGNLLFSGIGSVTTSSRAVYSMSRDMALPYS 382

Query: 404 NFFKKVNGSVA--VPIRAVWXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPIT 461
            F+  V+ S    VP  ++                   A +A    ++  +  A   P+ 
Sbjct: 383 EFWSYVDPSSKHRVPKNSILLSMGISYLLGLLALLSTAAFNAFMGAAVLCLCSATCIPLV 442

Query: 462 LRLTYGKKDFRPGPFYMGDFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVI 521
           L L   ++  R  P  +       +N  S+ + +FT++++  P  Q  +   +MNY  V+
Sbjct: 443 LVLISRRRALRGSPIKVRYRLGWFVNIASILWLVFTMVVICIP-PQVPVTFSSMNYAFVV 501

Query: 522 GPGFWVLSLIYYYFWQSKFYEGP 544
              F     + Y+ W    ++ P
Sbjct: 502 YLLFLAAITVLYFRWGRYNFKTP 524

>TBLA0C05740 Chr3 complement(1391698..1393677) [1980 bp, 659 aa]
           {ON} Anc_1.173 YKL174C
          Length = 659

 Score = 92.8 bits (229), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 109/527 (20%), Positives = 221/527 (41%), Gaps = 18/527 (3%)

Query: 53  TSDQQVLAEIGYKEELKREF-STLQIFGVAFSIMGLLPSIASTMDGGLY-AGPVGLSWGW 110
           T   Q +    Y ++L +   S   + G+ F +M  +  + ++M  GL   GP  + WG+
Sbjct: 39  TEGPQEVEHFNYHQDLDKSLLSRGSVMGLGFGLMSPVLGMCTSMAIGLMNGGPATIMWGF 98

Query: 111 FVAGGLILTVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVC 170
            ++G ++    ++L E+ S  P    ++VS    AP + +   S+  G+L  +       
Sbjct: 99  LISGIMVWFCSLSLGEIVSKFPM--ELHVSSAMLAPKKLKLICSWYTGWLTLIGNWTMST 156

Query: 171 SIVYGLAQQILSAVVVSNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVS 230
           SI +  AQ  +S ++++N D +     T  +F   ++   V+T +        + I I++
Sbjct: 157 SITFAGAQLTISLILMANNDLISE---TNLIFFTVIVFYLVVTIVGIVNLKLARFIEIIN 213

Query: 231 NCXXXXXXXXXXPIGVSRSDKLNHSFNNAKF-IFGKSENFTDWNGGWSWCINGLTPAIWT 289
                        I +      +  + + KF +F    + + +   +   I G   + +T
Sbjct: 214 KVCVYWIIYAILFIDILLLFFHSGKYRSLKFALFHFDNSLSGYANCFVSFIIGFQQSNFT 273

Query: 290 IGAYDSCLHMAEEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYG 349
           +  +     +A+E ++A R +P  +  S+    + G++  + ++  + PD  N+      
Sbjct: 274 LQGFSMLPALADEVKEAERDIPRAMSASVLISTVSGFIFLLPIMLIL-PDNTNLFADHKI 332

Query: 350 QGITQVFYDALGKRWTLAFLSFMIICQ-FLMGASTVVANSRQFWAFARDDALPFSNFFKK 408
             I  +F  +    +   FL  MI+   F  G  ++  +SR  ++F+RD A+P   F+  
Sbjct: 333 LPIVSIFTQSTHSTFVSFFLVLMILGNLFFSGIGSITTSSRVVYSFSRDHAIPKHEFWTY 392

Query: 409 VN-GSVA-VPIRAVWXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRLTY 466
           V+  SV+ VP  +V                   A +A    ++  +  A + P+ L L  
Sbjct: 393 VDPQSVSKVPKYSVLLSMAVSYLLGILALFSTAAFNAFIGAAVLCLCSATVLPLVLVLFT 452

Query: 467 GKKDFRPGPFYMGDFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFW 526
            ++  R  P  +      I+N  S+ + L ++  V  P  Q  +   TMNY +++     
Sbjct: 453 RRRILRNAPIKIHYKLGWIVNITSIVWLLLSMGSVCLP-SQVPVTVRTMNYALIVYVACL 511

Query: 527 VLSLIYYYFWQSKFYEGPKSNLSDEEFAERVGDDVLDAILSSNVEVN 573
           +   I Y+ W    +  P   L DE++       ++++  SSN   N
Sbjct: 512 IAITILYFRWGKYHFTLP---LVDEDYKNLTS--IMESATSSNFPTN 553

>CAGL0M08272g Chr13 complement(823019..824884) [1866 bp, 621 aa]
           {ON} highly similar to uniprot|P36029 Saccharomyces
           cerevisiae YKL174c
          Length = 621

 Score = 88.2 bits (217), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 104/513 (20%), Positives = 212/513 (41%), Gaps = 21/513 (4%)

Query: 45  RYIDAKNATSDQQVLAEIGYKEELKREF-STLQIFGVAFSIMGLLPSIASTMD-GGLYAG 102
            Y+     T + + +    YK+EL +   S   + G+ F +M  +  + ++M  G L  G
Sbjct: 34  HYVQEDEVTDEPEEVEHFNYKQELDKSLLSRNSVIGLGFGLMSPVLGMCTSMGIGMLNGG 93

Query: 103 PVGLSWGWFVAGGLILTVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDT 162
           P+ +  G+F++G LI    ++L E+ S  P    ++V     AP R +   S+  G+L  
Sbjct: 94  PLSIMLGFFISGILIWFSSLSLGEIVSKFPM--ELHVGSAMIAPPRLKLICSWFTGWLML 151

Query: 163 LSLCASVCSIVYGLAQQILSAVVVSNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSK 222
           +       SI +  AQ  +S ++++N + +     T+ +    ++   V+T +       
Sbjct: 152 IGNWTMSTSITFAGAQLTISLILMANNELISE---THLILFTVIVFYMVVTLVGLVNLKF 208

Query: 223 LQTISIVSNCXXXXXXXXXXPIGVSRSDKLNHSFNNAKF-IFGKSENFTDWNGGWSWCIN 281
            + I I++             I +         F + K+ +F    + + ++  +   + 
Sbjct: 209 ARFIEIINKVCVYWIIYAIIFIDILLLIFHKGKFRSLKYALFHFDNSMSGYSSAFLSFLI 268

Query: 282 GLTPAIWTIGAYDSCLHMAEEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLN 341
           G   + +T+  +     +A+E +   + +P G+  ++      G LI ++ +  + PD+ 
Sbjct: 269 GFQQSNFTLQGFSMLPALADEVKKPEKDIPRGMSTAVLLSTFSG-LIFLLPIMLILPDIE 327

Query: 342 NIINSPYGQGITQVFYDALGKRWTLAFLSFMIICQ-FLMGASTVVANSRQFWAFARDDAL 400
            I ++     I  +F  +        FL  +I+   F  G  ++  +SR  ++F+RD A+
Sbjct: 328 TIFSNHKVLPIVTIFTKSTHSMVVSVFLVLLILGNLFFSGIGSITTSSRAVYSFSRDHAI 387

Query: 401 PFSNF--FKKVNGSVAVPIRAVWXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIF 458
           P  +   F   +    VP  ++                   A +A    ++  +  A   
Sbjct: 388 PRYDLWTFVPPDSQSRVPKYSILLSMGISYFLGLLALISTAAFNAFIGAAVLCLCSATFI 447

Query: 459 PITLRLTYGKKDFRPGPFYMGDFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYT 518
           P+ L L  G++  +  P  +   +   IN  SV + L  ++ V FP  Q  +    MNY 
Sbjct: 448 PLVLVLCTGRRSIKHAPVKIRYKFGWFINIASVLWLLLVMVSVCFP-TQLPVTVKGMNYA 506

Query: 519 VVIGPGFWVLSL----IYYYFWQSKFYEGPKSN 547
           +V+    +VL L    I Y+ W    +  P S+
Sbjct: 507 IVV----YVLCLIGITILYFKWGKYNFRLPLSD 535

>SAKL0C05126g Chr3 complement(488745..490451) [1707 bp, 568 aa] {ON}
           similar to uniprot|P36029 Saccharomyces cerevisiae
           YKL174C TPO5 Protein involved in excretion of putrescine
           and spermidine putative polyamine transporter in the
           Golgi or post-Golgi vesicles
          Length = 568

 Score = 84.7 bits (208), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 113/518 (21%), Positives = 209/518 (40%), Gaps = 32/518 (6%)

Query: 57  QVLAEIGYKEELKREF-STLQIFGVAFSIMGLLPSIASTMDGGLY-AGPVGLSWGWFVAG 114
           +V+ +  Y+++L +   S   + G+ F +M  +  +++TM  GL   GP+ +  G+ V G
Sbjct: 41  EVVEQFQYEQKLDKSLLSRGSVIGLGFGLMSPVLGMSTTMSIGLLNGGPLTIVAGFMVVG 100

Query: 115 GLILTVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVY 174
                  ++L E+ S  P    ++      A  + R   S+  G+L  L       SI +
Sbjct: 101 FATWLCSLSLGEIVSKFPIE--LHGGSAMLAAKKHRLVFSWYTGWLMLLGNWTMSTSITF 158

Query: 175 GLAQQILSAVVVSNPDFVVTDPI---TYGVFAACVIAMAVLTSLASGFTSKLQTIS---I 228
             AQ ++S + ++N   V  D +   T  VF A V  + V+    + F   +  +    I
Sbjct: 159 AGAQLVISLISLANDSLVPKDSVIFYTVVVFYAIVTVVGVVNLKFARFIETINKVCVYWI 218

Query: 229 VSNCXXXXXXXXXXPIGVSRSDK--LNHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPA 286
           +               G  RS K  L H F+N+          + +       + G   +
Sbjct: 219 IYAIIFTDILLLLFHTGEYRSLKYALAH-FDNS---------LSGYRSAALSFMIGFQQS 268

Query: 287 IWTIGAYDSCLHMAEEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINS 346
            +T+  +     +A+E ++  R +P G+  S+    + G L+ ++ +  + PD + I+N+
Sbjct: 269 NFTLQGFSMLPALADEVKEPERDIPRGMSLSVVLSALSG-LVFLLPIMLILPDTSAILNN 327

Query: 347 PYGQGITQVFYDALGKRWTLAFLSFMIICQFLM-GASTVVANSRQFWAFARDDALPFSNF 405
                I  +F  +        FL  MI+   L  G  ++  +SR  ++ +RD ALP+   
Sbjct: 328 DRVMPIVLIFTQSTHSIVVSFFLVLMILGNLLFSGIGSITTSSRAVYSMSRDHALPYHEL 387

Query: 406 FKKVN--GSVAVPIRAVWXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPITLR 463
           +  V       VP  ++                   A +A    ++  +  A   P+ L 
Sbjct: 388 WTYVEPASQSRVPKYSILLTMAISYVLGLLALVSTAAFNAFVGAAVLCLCSATCIPVVLV 447

Query: 464 LTYGKKDFRPGPFYMGDFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGP 523
           L   ++  R  P  +      ++N  SVA+ +FT+ ++  P  Q  +   TMNY   +  
Sbjct: 448 LASRRRALRGSPIKVRYKLGWLVNLASVAWLVFTMFVISMP-PQVPVTLVTMNYAAFVFA 506

Query: 524 GFWVLSLIYYYFWQSKFYEGPKSNLSDEEFAERVGDDV 561
            F V     Y+ W    +  P   L DE    + G DV
Sbjct: 507 AFMVGITALYFCWGRHHFRAP---LVDEN--SKAGGDV 539

>TPHA0E03350 Chr5 (709592..711535) [1944 bp, 647 aa] {ON} Anc_1.173
           YKL174C
          Length = 647

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 108/533 (20%), Positives = 219/533 (41%), Gaps = 32/533 (6%)

Query: 64  YKEELKREF-STLQIFGVAFSIMGLLPSIASTMDGGLY-AGPVGLSWGWFVAGGLILTVG 121
           Y+++L +   S   I G+ F +M  +  + ++M  GL   GP+ +  G+ V+G       
Sbjct: 54  YEQQLDKSLLSKSSIVGLGFGLMSPVLGMCTSMSIGLKDGGPLTILIGFMVSGIFTWFCS 113

Query: 122 IALAELSSSIPTA---GAVYVSCY---QWAPARWRKSISYSVGFLDTLSLCASVCSIVYG 175
           ++L E+ S  P      +  +S Y       ++ R   S+  G+L  +       SI + 
Sbjct: 114 LSLGEVVSKYPNELHISSAMLSSYLTDNTLDSKLRYIASWYTGWLMLIGNWTMSTSITFA 173

Query: 176 LAQQILSAVVVSNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCXXX 235
            AQ  +S +++   D +    +         + + ++  +   F+  ++TI+ +  C   
Sbjct: 174 GAQLTISLLLLMKSDLISETHLILFTVIVFYLVVTIVGFINLKFSRFIETINKI--CVIW 231

Query: 236 XXXXXXXPIGVSRSDKLNHSFNNAKF------IFGKSENFTDWNGGWSWCINGLTPAIWT 289
                     +   D L   F   KF      +F    + + +   +   I G   + +T
Sbjct: 232 IFY------AIIFIDVLLLVFQAGKFRSLKYALFHFDNSLSGYTSAFLSFIIGFQQSNFT 285

Query: 290 IGAYDSCLHMAEEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYG 349
           +  +     +A+E +   R +P G+  ++      G +  + ++  + PDL+NI N+   
Sbjct: 286 LQGFSMLPALADEVKRPERDIPRGMSTAVLLSTFSGVVFLLPIMLIL-PDLDNIFNNKNS 344

Query: 350 Q--GITQVFYDALGKRWTLAFLSFMIICQFLM-GASTVVANSRQFWAFARDDALPFSNF- 405
               I  +F  +   ++   FL F I+   L  G  ++  +SR  ++F+RD ALP+    
Sbjct: 345 NLLPIVSIFTQSTHSKFVSVFLVFCILGNLLFSGIGSITTSSRAVYSFSRDHALPYHELW 404

Query: 406 -FKKVNGSVAVPIRAVWXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRL 464
            F   +    VP  ++W                  A +A    ++  +  A + P+ L L
Sbjct: 405 TFVDSDSVSKVPKYSIWLSMGVSYTLGLLALFSTAAFNAFVGAAVLCLCTATVIPLILVL 464

Query: 465 TYGKKDFRPGPFYMGDFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPG 524
             G++  R  P  M      I+N +SVA+ L  ++ V FP  Q  +   TMNY +++   
Sbjct: 465 ISGRRSIRNAPVKMKYKLGWIVNILSVAWLLLAMVSVCFP-PQIPVTFSTMNYALMVYIF 523

Query: 525 FWVLSLIYYYFWQSKFYEGP---KSNLSDEEFAERVGDDVLDAILSSNVEVNN 574
             ++  + Y+ W    +  P   K++L+       +   ++D    +++E  N
Sbjct: 524 CLIIITVLYFQWGKNNFVLPHPMKTSLTSNPSTYAMSKSLVDLSRETDMEEFN 576

>KLLA0A06666g Chr1 complement(603169..604851) [1683 bp, 560 aa] {ON}
           similar to uniprot|P36029 Saccharomyces cerevisiae
           YKL174C TPO5 Protein involved in excretion of putrescine
           and spermidine putative polyamine transporter in the
           Golgi or post-Golgi vesicles
          Length = 560

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 106/512 (20%), Positives = 217/512 (42%), Gaps = 19/512 (3%)

Query: 43  PIRYIDAKNATSDQQV---LAEIGYKEEL-KREFSTLQIFGVAFSIMGLLPSIASTMDGG 98
           P R +   N   DQ +   + E  Y ++L K   S   + G+ F +M  +  +++TM  G
Sbjct: 54  PERLLSLLNE-EDQDIPDEVKEFTYVQQLDKNLLSRTSVIGLGFGLMSPVLGMSTTMSIG 112

Query: 99  LY-AGPVGLSWGWFVAGGLILTVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSV 157
           L   G   + +G+ + G +     ++L+E+ S  P    ++ +    AP R R  +S+  
Sbjct: 113 LLNGGSPSIIFGYLICGIMTWISSLSLSEIVSKYPIE--LHGAAAMLAPGRLRLRMSWYC 170

Query: 158 GFLDTLSLCASVCSIVYGLAQQILSAVVVSNPDFVVTDPITYGVFAACVIAMAVLTSLAS 217
           G+L          SI +  AQ I+S + ++N   + +  +T        + + V+  +  
Sbjct: 171 GWLMLFGSWTMSTSITFAGAQLIISLLTMTNESLIDSRWLTLWTVLMFYLIVTVVGVINL 230

Query: 218 GFTSKLQTISIVSNCXXXXXXXXXXPIGVSRSDKLNHSFNNAKFIFGKSEN-FTDWNG-G 275
            F+S ++TI+ V  C             +    + NH   + K +F K +N  + ++   
Sbjct: 231 KFSSFIETINKV--CVYWILYAILFTSTLLLLFQPNH--RSFKDVFTKFDNSLSGYSSMA 286

Query: 276 WSWCINGLTPAIWTIGAYDSCLHMAEEARDAVRAVPIGIVGSIASCWILGWLICIVLLAC 335
            S+ I G   + +T   +     +++E     + +P  +  S+    + G    I ++  
Sbjct: 287 LSFLIGGFQQSNFTFQGFAMLSALSDETEKPEKDIPYSMTRSVIISLVSGLFFLIPMMLI 346

Query: 336 MDPDLNNIINSPYGQGITQVFYDALGKRWTLAFLSFMIICQFLM-GASTVVANSRQFWAF 394
           + PD++ ++N      I  +F  +    +   FL  +I+   L  G  +V  +SR  ++ 
Sbjct: 347 L-PDVSEVMNHEGVMPIVLIFTKSTKSLFVSIFLVLLILGNLLFSGIGSVTTSSRALYSL 405

Query: 395 ARDDALPFSNFFKKVN--GSVAVPIRAVWXXXXXXXXXXXXXXXXEVAADALFSLSIAGM 452
           +RD  +P+ + +  V+      VP  +V                   A +A    ++  +
Sbjct: 406 SRDRGIPYHHLWTYVDPASESKVPKYSVMLSMGVSYVLALLALISTAAFNAFVGCAVLCL 465

Query: 453 YMALIFPITLRLTYGKKDFRPGPFYMGDFWSPIINWISVAFQLFTIIMVMFPYQQHNIDK 512
             A + PI L L + +K  +   F +      I N ++V + LFT++++  P Q+  +  
Sbjct: 466 CSASMLPILLSLYHRRKLVKGSAFRIKYRLGYITNCLTVIWLLFTMVIISLP-QKVPVTF 524

Query: 513 DTMNYTVVIGPGFWVLSLIYYYFWQSKFYEGP 544
            +MNY+ V+   F ++  + Y  W    +  P
Sbjct: 525 RSMNYSSVVYFLFMIMVTVLYDRWGIYNFRAP 556

>ZYRO0F00242g Chr6 (26301..27908) [1608 bp, 535 aa] {ON} similar to
           uniprot|Q0CZS0 Aspergillus terreus NIH2624 ATEG_00814
           Hypothetical protein
          Length = 535

 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 108/510 (21%), Positives = 197/510 (38%), Gaps = 28/510 (5%)

Query: 67  ELKREFSTLQIFGVAFSI----MGLLPSIASTMDGGLYAGPVGLSWGWFVAGGLILTVGI 122
            L+++F+ L       S       L  +I ++++ G   GP G+ + +         +G 
Sbjct: 36  RLEKKFNLLSAIASGISTGNTWTALGGAIVASLNNG---GPPGIMYEFIAVSVFYWAIGA 92

Query: 123 ALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQQILS 182
           ++AEL+SS+P +G VY         +W     +  G+ D L+    + S    +A  I+ 
Sbjct: 93  SIAELASSVPASGGVYHWAAMTPGKKWGPICGWFAGWFDFLAWNFGIASNANMVASMIVY 152

Query: 183 AVVVSNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTS-KLQTISIVSNCXXXXXXXXX 241
           +  + +PD   T+   + V+  C + +  L      F    L TI+ + +          
Sbjct: 153 SYGLFHPD---TELQRWHVY-ICFLILTWLCCFVVMFADWALPTINRIGSFLILGGWFVT 208

Query: 242 XPIGVSRSDKLNHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAE 301
             +             +  F++ K +N T ++      + G+    +++G  D   H+AE
Sbjct: 209 VVVCAVMPSTTGKGHASNDFVWSKWQNNTGYSSDGFAFLLGMLNGAFSVGTPDCITHLAE 268

Query: 302 EARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNI-------INSPYGQGITQ 354
           E  DA R +P  +   I    ++G++  I  +  M   +NN+         SP G+   Q
Sbjct: 269 EIPDAGRNLPKVLFWQI----LVGFITAITYMIAMFYAINNLPIIFSSNTFSPLGEIYLQ 324

Query: 355 VFYDALGKRWTLAFLSFMIICQFLMGASTVVANSRQFWAFARDDALPFSNFFKKVNGSVA 414
                 G    L  +   IIC  +      +   R  +  ARD+A PFS +   ++    
Sbjct: 325 ATNSRGGAIGLLLIIYLPIICAIV---GCYITAGRTLYVLARDNATPFSKYLGAIHPRYK 381

Query: 415 VPIRAVWXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPG 474
            P  A +                  A +A     +     A    +   L   +     G
Sbjct: 382 SPFWATFACGVLCTCLGAIYVGSATAFNAFVGSFVLLTTAAFFLAMLPNLLTKRSKLPLG 441

Query: 475 PFYMGDFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYY 534
            F MG F    +N IS  + L   ++  FPY       + MNYT V+  G  ++  I++ 
Sbjct: 442 SFNMGKF-GYAVNIISCLYILVFFVIYCFPYSL-PATAENMNYTSVMVSGLTLMVAIWWM 499

Query: 535 FWQSKFYEGPKSNLSDEEFAERVGDDVLDA 564
               K Y+GP  ++ +++    + DD L A
Sbjct: 500 VHGRKNYKGPTFDMVEKDNCSVLTDDYLVA 529

>NCAS0B08350 Chr2 (1593557..1595395) [1839 bp, 612 aa] {ON}
           Anc_1.173
          Length = 612

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 108/524 (20%), Positives = 211/524 (40%), Gaps = 28/524 (5%)

Query: 47  IDAKNATSDQQVLAEIGYKEELKREF-STLQIFGVAFSIMGLLPSIASTMDGGLY-AGPV 104
           I  ++ T + + +    Y +EL +   S   + G+ F +M  +  ++++M  GL   GP 
Sbjct: 31  IHEESDTDEVESVEHFKYNQELDKSLLSRSSVVGLGFGLMSPVLGMSTSMAIGLINGGPA 90

Query: 105 GLSWGWFVAGGLILTVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLS 164
            + WG+ ++G  I    ++L E+ S  P    ++VS    AP   +   S+  G+L  L 
Sbjct: 91  TILWGFIISGICIWFCSLSLGEVVSKFPM--ELHVSSAMLAPKDAKLICSWYTGWLMLLG 148

Query: 165 LCASVCSIVYGLAQQILSAVVVSNPDFVVTDPI---TYGVFAACVIAMAVLTSLASGFTS 221
                 SI +  AQ  +S ++++  D +    +   T  +F   V  + ++    + F  
Sbjct: 149 NWTMSTSITFAGAQLTISLILMAKSDLIAEKYMIGFTVIIFYLVVTLVGLINLKFARFIE 208

Query: 222 KLQTISIV----SNCXXXXXXXXXXPIGVSRSDKLNHSFNNAKFIFGKSENFTDWNGGWS 277
            +  + +V    + C            G  RS K    FN    + G S  F  +     
Sbjct: 209 TINKVCVVWIIYAICVIDILLLIFHQ-GKYRSLKFA-LFNFDNSLSGYSNFFVSF----- 261

Query: 278 WCINGLTPAIWTIGAYDSCLHMAEEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMD 337
             I G   + +T+  +     +A+E +   + +P G+  ++      G +  I ++  + 
Sbjct: 262 --IIGFQQSNFTLQGFSMLPALADEVKVPEKDIPRGMSNAVLLSTFSGIIFLIPIMIIL- 318

Query: 338 PDLNNIINSPYGQGITQVFYDALGKRWTLAFLSFMIICQ-FLMGASTVVANSRQFWAFAR 396
           PD + + ++     I  +F  +   +    FL   I+   F  G  ++  +SR  ++F+R
Sbjct: 319 PDSDKLFSNNQMLPIVNIFTQSTHSKIVSLFLVLSILGNLFFSGIGSITTSSRAVYSFSR 378

Query: 397 DDALPFSNF--FKKVNGSVAVPIRAVWXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYM 454
           D A+P      F K      VP  ++                   A +A    ++  +  
Sbjct: 379 DHAIPHHELWTFVKPESQSKVPKNSILLSMAISYFLGILALFSTAAFNAFIGAAVLCLCS 438

Query: 455 ALIFPITLRLTYGKKDFRPGPFYMGDFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDT 514
           A   P+ L L   ++  R  P  +       +N IS+ + + ++I V FP  +  +   T
Sbjct: 439 ATCIPLVLVLFRRRRIIRSAPVKIRYKLGWAVNIISIVWLILSMISVCFP-PKIPVTWGT 497

Query: 515 MNYTVVIGPGFWVLSLIYYYFWQSKFYEGPKSNLSDEEFAERVG 558
           MNY +++   F +   I Y  W    ++ P   L DE+    +G
Sbjct: 498 MNYALIVYVIFLIAITIMYLKWGKYNFKLP---LIDEDKMVPIG 538

>ZYRO0G18700g Chr7 (1542876..1544651) [1776 bp, 591 aa] {ON} similar
           to uniprot|P36029 Saccharomyces cerevisiae YKL174C TPO5
           Protein involved in excretion of putrescine and
           spermidine putative polyamine transporter in the Golgi
           or post-Golgi vesicles
          Length = 591

 Score = 73.6 bits (179), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 110/548 (20%), Positives = 222/548 (40%), Gaps = 36/548 (6%)

Query: 44  IRYIDAKNATSDQQVLAEIGYKEELKREF-STLQIFGVAFSIMGLLPSIASTMDGGLY-A 101
           +  I  + A ++ ++     Y++EL +   S   + G+ F +M  +  + ++M  GL   
Sbjct: 27  LHTIIHEEADNEPEIAEHFEYEQELDKSLLSRTSVIGLGFGLMSPVLGMCTSMGIGLLNG 86

Query: 102 GPVGLSWGWFVAGGLILTVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLD 161
           GP  + +G+ V G        +L E+ S  P    ++ +    AP   ++  S+  G+  
Sbjct: 87  GPFTIMFGFQVCGVFSFLCACSLGEVVSKFPME--LHGASAILAPDYIKRISSWLTGWFL 144

Query: 162 TLSLCASVCSIVYGLAQQILSAVVVSNPDFVVTDPITYGVFAACVIAMAVLTSLAS---G 218
            L        + +  AQ I+S + ++N D +      Y V    +I  AV+T +      
Sbjct: 145 LLGNWFMSIGVTFAGAQLIISLIAMANFDLISEK---YLVLYTVLIYYAVVTIVGVVNLK 201

Query: 219 FTSKLQTISIVSNCXXXXXXXXXXPIGVSRSDKLNHSFNNAKF------IFGKSENFTDW 272
           +   ++TI+ V  C             V   D L   F+  KF      +F      + +
Sbjct: 202 YAKYVETINKV--CIYWIIY------AVLFIDVLLLLFHRNKFRSLPYALFHFDNELSGY 253

Query: 273 NGGWSWCINGLTPAIWTIGAYDSCLHMAEEARDAVRAVPIGIVGSIASCWILGWLICIVL 332
                  I G   + +T+  +     +A+E +   + +P G+  ++    ++G +    +
Sbjct: 254 RSVIISFIIGFQQSNFTLQGFSMLPALADEVKVPEKDIPRGMSSAVLISTVIGIIFLFPI 313

Query: 333 LACMDPDLNNIINSPYGQGITQVFYDALGKRWTLAFLSFMIICQ-FLMGASTVVANSRQF 391
           +  + PD  ++ ++     I  +F  +   ++   FL  +I+   F  G  ++  +SR  
Sbjct: 314 MVIL-PDSRDLFSNQKVLPIVNIFKKSTDSQFVSIFLVLLILGNLFFSGIGSITTSSRAV 372

Query: 392 WAFARDDALPFSNFFKKVN--GSVAVPIRAVWXXXXXXXXXXXXXXXXEVAADALFSLSI 449
           ++F+RD A+P+   +  V+      VP  ++                   A +A    ++
Sbjct: 373 YSFSRDHAIPYYRLWTYVDPQSESRVPKYSILLSMSISYILGLLPLFSNAAFNAFIGCAV 432

Query: 450 AGMYMALIFPITLRLTYGKKDFRPGPFYMGDFWSPIINWISVAFQLFTIIMVMFPYQQHN 509
             +  A + P+ L L   ++  +  P  +      I N  SV + L ++  V  P  Q  
Sbjct: 433 LCLCSATLIPLLLVLVTRRRVLKNAPVKIKYKLGWIANIGSVCWLLLSMFSVCLP-PQIP 491

Query: 510 IDKDTMNYTVVIGPGFWVLSLIYYYFWQSKFYEGPKSNLSDEEFAERVGDDVLDAILSSN 569
           +   TMNY +++    + +  I YY W  K ++ P+  +     AE +    LD I   N
Sbjct: 492 VTAKTMNYALLVFLFCFFIICILYYKWGRKHFQLPQ--VDKASIAEEMS--TLDVI---N 544

Query: 570 VEVNNDRL 577
           V+ N+  L
Sbjct: 545 VDQNSTPL 552

>KNAG0C00980 Chr3 complement(191133..193277) [2145 bp, 714 aa] {ON}
           Anc_1.173 YKL174C
          Length = 714

 Score = 73.2 bits (178), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 117/536 (21%), Positives = 226/536 (42%), Gaps = 44/536 (8%)

Query: 47  IDAKNATSDQQVLAEIGYKEELKREF-STLQIFGVAFSIMGLLPSIASTMDGGLY-AGPV 104
           I   +  ++ +++    Y++EL +   S   I G+ F +M  +  + ++M  GL   GP 
Sbjct: 28  IHEDSDENEPEIVEHFKYEQELDKSLLSRSSIVGLGFGLMSPVLGMCTSMAIGLINGGPA 87

Query: 105 GLSWGWFVAGGLILTVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLS 164
            + WG+ ++G  I    ++L E+ S  P    ++V     APA  +   S+  G+L  + 
Sbjct: 88  TIMWGFLISGICIWFCSLSLGEIVSKFPM--EIHVGSAMLAPASLKLISSWYTGWLMLIG 145

Query: 165 LCASVCSIVYGLAQQILSAVVVSNPDFVVTDP--ITYGVFA-ACVIAMAVLTSLASGFTS 221
                 SI +  AQ  +S ++++N D ++ DP  + Y V     V+ +  L +L   F  
Sbjct: 146 NWTMSTSITFAGAQLTISLILMNNND-LIKDPHLVLYTVIVFYLVVTIVGLINLK--FAR 202

Query: 222 KLQTIS------IVSNCXXXXXXXXXXPIGVSRSDK--LNHSFNNAKFIFGKSENFTDWN 273
            ++TI+      I+               G  RS K  L H F+N++  +G   NF    
Sbjct: 203 FIETINKVCVYWILYAVIFIDILLLIFHKGKYRSLKYALTH-FDNSRSGYG---NFV--- 255

Query: 274 GGWSWCINGLTPAIWTIGAYDSCLHMAEEARDAVRAVPIGIVGSIASCWILGWLICIVLL 333
              S+ I G   + +T+  +     +A+E R   + +P G+  ++      G +I ++ +
Sbjct: 256 --ISFII-GFQQSNFTLQGFSMLPALADEVRVPEKDIPRGMSNAVLLSAFSG-IISLLPI 311

Query: 334 ACMDPDLNNIINSPYGQG----ITQVFYDALGK-RWTLAFLSFMIICQFLMGASTVVANS 388
             + PD++  I   +  G    I  +F  +      +   +  ++   F  G  ++ A+S
Sbjct: 312 MIILPDMDTFI---FYDGRVLPIVNIFTQSTDSVILSTLLVLLILGNLFFSGIGSITASS 368

Query: 389 RQFWAFARDDALPFSNF--FKKVNGSVAVPIRAVWXXXXXXXXXXXXXXXXEVAADALFS 446
           R  ++F+RD A+P  +   F K      VP  ++                   A +A   
Sbjct: 369 RSVYSFSRDHAIPGYDLWTFVKPESESKVPKNSILLSMLISYILGLLALFSTAAFNAFIG 428

Query: 447 LSIAGMYMALIFPITLRLTYGKKDFRPGPFYMGDFWSPIINWISVAFQLFTIIMVMFPYQ 506
            ++  +  A   P+ L L   ++  +  P  +       IN  S+ + L ++  V  P  
Sbjct: 429 AAVLCLCSATCIPLVLVLFRRRRILKSAPVKIRYKLGWGINIFSICWLLLSMFSVCLP-T 487

Query: 507 QHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQSKFYEGPKSNLSDEEFAE-RVGDDV 561
           +  +   TMNY +V+     +   + Y+FW    +  PK   +D + A+  +G DV
Sbjct: 488 RIPVTFKTMNYALVVYVVCLISITVLYFFWGKSNFRLPK---ADGQVAKYEMGSDV 540

>Kpol_2002.70 s2002 complement(159457..161325) [1869 bp, 622 aa]
           {ON} complement(159457..161325) [1869 nt, 623 aa]
          Length = 622

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 107/498 (21%), Positives = 213/498 (42%), Gaps = 23/498 (4%)

Query: 54  SDQ-QVLAEIGYKEELKREFSTLQI-----FGVAFSIMGLLPSIASTMDGGLYAGPVGLS 107
           +DQ +V+ +  Y++EL +   +L       FG+   ++G+  S++  +  G   GP+ + 
Sbjct: 36  NDQVEVVEQFKYEQELDKSLLSLSSVVGLGFGLMSPVLGMCTSMSIGLKNG---GPLTII 92

Query: 108 WGWFVAGGLILTVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCA 167
            G+ ++G  I    ++L E+ S  P    ++ S    AP   +   S+  G+L  +    
Sbjct: 93  MGFLLSGISIWFCSLSLGEVVSKFPME--LHGSSALLAPDSLKLICSWYTGWLMLIGNWT 150

Query: 168 SVCSIVYGLAQQILSAVVVSNPDFVVTDPITYGVFAACVIAMAV-LTSLASGFTSKLQTI 226
              SI Y  AQ  +S ++++N D +    + +  F   V  M V +  L +   S+   I
Sbjct: 151 MSTSITYAGAQLTISLILMNNSDLISEANLIF--FTVIVFYMVVTIVGLVNLKFSRF--I 206

Query: 227 SIVSNCXXXXXXXXXXPIGVSRSDKLNHSFNNAKF-IFGKSENFTDWNGGWSWCINGLTP 285
            I++             I +      +  F + K+ +F    + + +  G    I G   
Sbjct: 207 EIINKICVLWIIYAIIFIDILLLIFHSGKFRSLKYALFHFDNHLSGYGSGVLSFIIGFQQ 266

Query: 286 AIWTIGAYDSCLHMAEEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIIN 345
           + +T+  +     ++EE +     +P G+  ++    + G +I ++ +  + PD++ +  
Sbjct: 267 SNFTLQGFSMLPALSEEVKRPENDIPRGMSNAVLLSTLSG-VIFLIPILIILPDIDTLFT 325

Query: 346 SPYGQGITQVFYDALGKRWTLAFLSFMIICQ-FLMGASTVVANSRQFWAFARDDALPFSN 404
                 I  +F  +        FL  MI+   F  G  ++  +SR  ++F+RD  +P+ N
Sbjct: 326 GHKILPIVNIFTKSTNSTVVSIFLVLMILGNLFFSGIGSITTSSRSVYSFSRDRGIPYHN 385

Query: 405 FFKKVNGSVA--VPIRAVWXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPITL 462
            +  V+ S    VP  ++W                  A +A    ++  +  A + P+ L
Sbjct: 386 LWTYVDPSSVSKVPKYSIWLSMAISYFLGLLALFSTAAFNAFIGAAVLCLCSATVIPLIL 445

Query: 463 RLTYGKKDFRPGPFYMGDFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIG 522
            L   ++  R  P  M      I+N ISV + L +++ V FP  Q  +   TMNY +++ 
Sbjct: 446 VLFSRRRVIRNAPVKMKYKLGWIVNIISVLWLLLSMVSVCFP-PQIPVTFQTMNYALIVY 504

Query: 523 PGFWVLSLIYYYFWQSKF 540
             F ++S+   YF   K+
Sbjct: 505 I-FCLISITVLYFKWGKY 521

>Ecym_8105 Chr8 (224611..226362) [1752 bp, 583 aa] {ON} similar to
           Ashbya gossypii AEL125C
          Length = 583

 Score = 70.5 bits (171), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 82/387 (21%), Positives = 161/387 (41%), Gaps = 29/387 (7%)

Query: 50  KNATSDQQVLAEIGYKEELKREF-STLQIFGVAFSIMGLLPSIASTMDGGLY-AGPVGLS 107
           K    D  ++    Y++ L +   S   + G+ F +M  +  +++++  GL   GP+ + 
Sbjct: 33  KEDDDDTVLVEHFQYEQRLDKSLLSKYSVIGLGFGLMSPVLGMSTSLSTGLVNGGPLTIL 92

Query: 108 WGWFVAGGLILTVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCA 167
             + + G +     +++ E+ S  P    ++ S    AP  +R   +Y  G+L  L  C 
Sbjct: 93  GAFIICGFMNWLTSLSIGEVVSKYPIE--LHGSVAMLAPDNYRLVTAYFTGWLMLLGNCV 150

Query: 168 SVCSIVYGLAQQILSAVVVSNPDFVVTDPI---TYGVFAACVIAMAVLTSLASGFTSKLQ 224
              SI Y  A+ I+S V +S    +  D +   T  V+  C+    ++ S    F   L+
Sbjct: 151 MNASIQYAGARLIISLVTISGDSLISEDNLIIWTVLVYFLCITITGIINS---NFARYLE 207

Query: 225 TISIVSNCXXXXXXXXXXPIGVSRSDKLNHSFNNAKF------IFGKSENFTDWNGG-WS 277
            I+ V  C             V+  D L   F+   F       F      + ++    S
Sbjct: 208 IINTV--CIYWILY------AVAFIDILLLMFHYGSFRPFLYAFFHFDNKLSGYSSAVLS 259

Query: 278 WCINGLTPAIWTIGAYDSCLHMAEEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMD 337
           + + G   + +T+  +     +++E R+  + +P G+  S+    I G +  I +L  + 
Sbjct: 260 FMVGGFQQSNFTLQGFSLLPALSDETREPEKDIPKGMSQSVLVSTICGIIYLIPILLVI- 318

Query: 338 PDLNNIINSPYGQGITQVFYDALGKRWTLAFLSFMIICQFLM-GASTVVANSRQFWAFAR 396
           P+   I+N      I  +F  +   +    F   +I+   L  G  ++  +SR  ++ +R
Sbjct: 319 PEPEEIMNDSRVMEIVLIFTKSTRSKIVSYFQVLLILGNLLFSGIGSITTSSRAVYSMSR 378

Query: 397 DDALPFSNFFKKV--NGSVAVPIRAVW 421
           D  LP+S+ +  V  +    VP  AV+
Sbjct: 379 DHGLPYSDLWSYVSPDSQSQVPRYAVY 405

>KAFR0G00390 Chr7 complement(115188..117011) [1824 bp, 607 aa] {ON}
           Anc_1.173 YKL174C
          Length = 607

 Score = 70.1 bits (170), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 100/524 (19%), Positives = 208/524 (39%), Gaps = 20/524 (3%)

Query: 46  YIDAKNATSDQQVLAEIGYKEELKREF-STLQIFGVAFSIMGLLPSIASTMDGGLY-AGP 103
           Y+     + +   +    Y++EL +   S   + G+ F +M  +  + ++M  GL   GP
Sbjct: 29  YLHEDEDSVNSDTVEHFKYEQELDKSLLSRSSVIGLGFGLMSPVLGMCTSMSIGLINGGP 88

Query: 104 VGLSWGWFVAGGLILTVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTL 163
           + +  G+ ++G  I    ++L E+ S  P    ++V+    AP +++   S+  G+L  +
Sbjct: 89  LTIMLGFILSGISIWFCSLSLGEIISKFPME--MHVASAMLAPKKFKLLCSWYTGWLMLI 146

Query: 164 SLCASVCSIVYGLAQQILSAVVVSNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKL 223
                  SI +  AQ  +S  ++ +   +  +   +       + + V+  +   F   +
Sbjct: 147 GNWTMSTSITFAGAQLTISLFLMKDQYLISEEHFIFYTVIVFYLVVTVVGLINLKFARFI 206

Query: 224 QTISIVSNCXXXXXXXXXXPIGVSRSDKLNHSFNNAKFIFGKSENFTDWNGGWSWCINGL 283
           + I+ V              + +        S   A F F  S   + ++      I G 
Sbjct: 207 EIINKVCVYWIIYAIIFIDILLLIFHKGTYRSLKYALFHFDNSR--SGYSNVLISFIIGF 264

Query: 284 TPAIWTIGAYDSCLHMAEEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNI 343
             + +T+  +     +A+E +   R +P G+  S+      G +  + ++  + PDL+ I
Sbjct: 265 QQSNFTLQGFSMLPALADEVKKPERDIPRGMSISVLISTFSGIIFLLPIMIIL-PDLSTI 323

Query: 344 INSPYGQGITQVFYDALGKRWTLAFLSFMIICQ-FLMGASTVVANSRQFWAFARDDALPF 402
                   I  +F  +        FL  +I+   F  G  ++ A+SR  ++F+RD A+P+
Sbjct: 324 FTDHKVLPIVNIFIQSTDSMIVSFFLVLLILGNLFFSGIGSITASSRTVYSFSRDQAIPY 383

Query: 403 SN--FFKKVNGSVAVPIRAVWXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPI 460
            +   F K      VP  +V                   A +A    ++  +  A   P+
Sbjct: 384 YDHWIFVKPESESKVPKNSVLLSMAISYVLGILALFSTAAFNAFIGAAVLCLCSATCIPL 443

Query: 461 TLRLTYGKKDFRPGPFYMGDFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVV 520
            L L   ++  +  P  +       IN IS+ + L ++  V  P Q   +   TMNY ++
Sbjct: 444 ILILFGRRRILKNAPIKIRYKLGWGINIISILWLLLSMFSVCLPVQI-PVTFQTMNYALM 502

Query: 521 IGPGFWVLSLIYYYFWQSKFYEGPKSNLSDEEFAERVGDDVLDA 564
           +     +     Y  W  + ++ P   L++ ++      D+LD+
Sbjct: 503 VYVFCLICVTFLYVKWGKRNFKLP---LAEHQY------DLLDS 537

>NDAI0A00890 Chr1 complement(181903..183828) [1926 bp, 641 aa] {ON}
           Anc_1.173 YKL174C
          Length = 641

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 99/528 (18%), Positives = 214/528 (40%), Gaps = 12/528 (2%)

Query: 57  QVLAEIGYKEELKREF-STLQIFGVAFSIMGLLPSIASTMDGGLY-AGPVGLSWGWFVAG 114
           +V+    Y +EL +   S   I G+ FS+M     ++++M  GL   GP  + WG+ ++G
Sbjct: 41  EVVEHFKYNQELDKSLLSRGSIVGLGFSLMSAPLGMSTSMAIGLINGGPATIIWGFLISG 100

Query: 115 GLILTVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVY 174
             I    ++L E+ S  P    ++VS    AP + +   S+  G+L  L       SI +
Sbjct: 101 ICIWFCSLSLGEVVSKFPME--LHVSSAMLAPKKLKLICSWYTGWLMLLGNWTMSTSITF 158

Query: 175 GLAQQILSAVVVSNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCXX 234
             AQ  +S ++++N D +    +         + + ++  +   F   ++TI+       
Sbjct: 159 AGAQLTISLILMTNSDLISEKYLIGFTVIIFYLVVTIVGLINLKFARFIETINRACVIWI 218

Query: 235 XXXXXXXXPIGVSRSDKLNHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYD 294
                    + +       HS   + F F  S   + ++G     + G   + +T+  + 
Sbjct: 219 IYAILFIDILLLIFHRGKYHSLKYSLFHFDNS--LSGYSGFLISFLIGFQQSNFTLQGFS 276

Query: 295 SCLHMAEEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQ 354
               +A+E +   + +P G+  ++      G +  I ++  + P+ + +  +     I  
Sbjct: 277 MLPALADEVKVPEKDIPRGMSNAVLLSAFSGIVFLIPIMIIL-PESDKLFTNHKILPIVN 335

Query: 355 VFYDALGKRWTLAFLSFMIICQ-FLMGASTVVANSRQFWAFARDDALPFSN--FFKKVNG 411
           +F  +    +   FL  MI+   F  G  ++  +SR  ++F+RD A+P      F +   
Sbjct: 336 IFTQSTHSMFVSFFLLLMILGNLFFSGIGSITTSSRAVYSFSRDHAIPHHETWTFVQPES 395

Query: 412 SVAVPIRAVWXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRLTYGKKDF 471
              VP  ++                   A +A    ++  +  A   P+ L L   ++  
Sbjct: 396 QSKVPKNSILLSMAISYILGLLALFSTAAFNAFIGAAVLCLCSATCIPLVLVLFRRRRVL 455

Query: 472 RPGPFYMGDFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLI 531
           R  P  +       +N +S+ + L +++ V  P  +  +  ++MNY +++     ++  +
Sbjct: 456 RNAPVKIRYKLGWFVNIVSILWLLLSMVSVCLP-PKIPVTLESMNYALIVYLLCIIIITL 514

Query: 532 YYYFWQSKFYEGPKSNLSDEEFAERVGDDVLDAI-LSSNVEVNNDRLS 578
            Y+ W    ++ P      +   +R     LD I +  N++ +   +S
Sbjct: 515 MYFKWGKDNFKLPLIEEEKKNQNDRTRKVPLDIISIKKNIKAHKTGVS 562

>SAKL0H11484g Chr8 complement(983765..985447) [1683 bp, 560 aa] {ON}
           similar to uniprot|P53744 Saccharomyces cerevisiae
           YNR056C BIO5 Putative transmembrane protein involved in
           the biotin biosynthesis pathway responsible for uptake
           of 7-keto 8-aminopelargonic acid BIO5 is in a cluster of
           3 genes (BIO3 BIO4 and BIO5) that mediate biotin
           synthesis
          Length = 560

 Score = 66.6 bits (161), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 119/560 (21%), Positives = 215/560 (38%), Gaps = 81/560 (14%)

Query: 47  IDAKNATSDQQVLAEIGYKEELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAG-PVG 105
           ID  + +   + +       +L + FS   + G++FS+      ++S++  GLY+G P+ 
Sbjct: 10  IDKTSESVSAKSIVPTESSTKLLKNFSWWSLIGISFSLTNSWLGVSSSLVVGLYSGGPLL 69

Query: 106 LSWGWFVAGGLILTVGIALAELSSSIP-TAGAVY-------------------------- 138
           + +G  +        G +L+E SS +P ++G+ +                          
Sbjct: 70  IIYGLIIGLFFTFMCGWSLSEFSSLLPNSSGSSFWVLKMLEKNDDIEDNHNINIKSDSHN 129

Query: 139 ------------VSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVV 186
                       VS  +   + W++S++ +VG ++      +  S+   L+   L    +
Sbjct: 130 CDEELKLEKYCAVSSVK-VTSNWQRSVALTVGLINYFGAVFTTASVCSSLSLNFLGVYSL 188

Query: 187 SNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCXXXXXXXXXXPIG- 245
            +P + +     + VF    I     T+  + ++  L  IS                I  
Sbjct: 189 VHPAYEIKH---WHVFLTYEILNVFFTTF-NCWSKWLPAISQFGLYMSMFSFGLTFVISL 244

Query: 246 VSRSDKLNHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEARD 305
           V RS+     +     IF +  N T W+      I GL   +W     DS  HM +E   
Sbjct: 245 VCRSNDKVTPWPTKSSIFSEFSNTTGWSSSGMAFIVGLINPLWAFAGIDSATHMVDEVGH 304

Query: 306 AVRA--VPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKR 363
           +     VP  I+G++   ++  +   I +  C+  D  +++ S     I Q++Y A G R
Sbjct: 305 STSRTLVPRAIIGTVLLGFVTSFTYSIGMFYCIT-DTKSVVESIL--PILQIYYQATGNR 361

Query: 364 WTLAFLSFMIICQ-FLMGASTVVANSRQFWAFARD-------DALPFSNFFKK----VNG 411
               FL    I    + G ++    SR  W+ +RD          P   +F K    VN 
Sbjct: 362 NLSIFLQCCCITSGVVCGIASGTWQSRILWSISRDFENIDTNKPRPVFRYFCKRFGHVNS 421

Query: 412 SVAVPIRAVWXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRL-TYGKKD 470
            + VP+ +                    A +A+ +  I  + ++   P T+ L   GK+ 
Sbjct: 422 LLKVPLTSHLFSQVIVAIIGCIFMGSTTAFNAIITACITLLLLSYAIPCTILLVVVGKRQ 481

Query: 471 F--RPGP------------FYMGDFW-SPIINWISVAFQLFTIIMVMFPYQQHNIDKDTM 515
           F  R G             F+  + W   I N  ++A+ LF +I + FPY    +    M
Sbjct: 482 FYRRIGQELDELKLSTSSIFHSKNVWFGYIANGFTIAWALFCLIFLSFPYTL-PVSAGNM 540

Query: 516 NY-TVVIGPGFWVLSLIYYY 534
           NY +VV G    V+S+I Y+
Sbjct: 541 NYVSVVYGAIALVISVIVYF 560

>TDEL0G02120 Chr7 complement(415216..416997) [1782 bp, 593 aa] {ON}
           Anc_1.173 YKL174C
          Length = 593

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 101/531 (19%), Positives = 208/531 (39%), Gaps = 29/531 (5%)

Query: 39  AHGAPIRYID------AKNATSDQQVLAEIGYKEELKREF-STLQIFGVAFSIMGLLPSI 91
           AH AP   +D       +N+T   +V+    Y+++L +   S   + G+ F +M  +  +
Sbjct: 17  AHLAPNEILDNLHTIIHENSTDVPEVVEHFEYEQQLDKSLLSRSSVVGLGFGLMSPVLGM 76

Query: 92  ASTMDGGLY-AGPVGLSWGWFVAGGLILTVGIALAELSSSIPTAGAVYVSCYQWAPARWR 150
            ++M  GL   GP  + +G+ + G        +L E+ S  P    ++ +    AP   +
Sbjct: 77  CTSMGIGLVNGGPFTIMFGFPICGFFSFLCASSLGEVVSKYPIE--LHGASAMIAPKSIK 134

Query: 151 KSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVSNPDFVVTDPITYGVFAACVIAMA 210
              S+  G+L  L        + +  AQ I+S V + + D +    +  G++   V    
Sbjct: 135 PMCSWFTGWLMLLGNWFMSIGVTFAGAQLIISLVNIGDRDVIADGRL--GIYTVLVYYGV 192

Query: 211 VLTSLASGFTSKLQTISIVSNCXXXXXXXXXXPIGVSRSDKLNHSFNNAKF------IFG 264
           V               +I   C             V   D L   F+  KF      +F 
Sbjct: 193 VTVVGVVNLKYARYVEAINKVCIYWIIY------AVLFIDVLLLLFHRQKFRSLPYALFH 246

Query: 265 KSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEARDAVRAVPIGIVGSIASCWIL 324
                + ++  +   I G   + +T+  +     +A+E +   + +P G+  ++    ++
Sbjct: 247 FDNTLSGYSSAFLSFIIGFQQSNFTLQGFSMLPALADEVQVPEKDIPRGMSSAVLISTLI 306

Query: 325 GWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKRWTLAFLSFMIICQ-FLMGAST 383
           G +  + ++  + PD++ +  +     I  VF  +   ++   FL  +I+   F  G  +
Sbjct: 307 GMIFLLPIMLIL-PDVDGLFENTKVLPIVDVFTHSTNSKFVSVFLILLILGNLFFSGIGS 365

Query: 384 VVANSRQFWAFARDDALPFSNFFKKVN--GSVAVPIRAVWXXXXXXXXXXXXXXXXEVAA 441
           +  +SR  ++F+RD A+P    +  V+      VP  ++                   A 
Sbjct: 366 ITTSSRAVYSFSRDCAIPNHQLWTYVDPTSESKVPKYSILLSMGVSYILGLLPLFSTAAF 425

Query: 442 DALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFYMGDFWSPIINWISVAFQLFTIIMV 501
           +A    ++  +  A + P+ L L   ++  R  P  +      I N  SV +   +++ V
Sbjct: 426 NAFIGCAVLCLCSATLIPLVLVLLTRRRILRDAPVKIKYKLGWIANVGSVIWLPLSMVSV 485

Query: 502 MFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQSKFYEGPKSNLSDEE 552
             P  Q  +   TMNY +V+    +   ++ Y+ W    ++ P  +   E+
Sbjct: 486 CMP-PQIPVTPKTMNYALVVFIACFAGIIVLYFKWGKYNFKLPLVDKQIED 535

>TDEL0G04830 Chr7 complement(891989..893620) [1632 bp, 543 aa] {ON} 
          Length = 543

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 89/405 (21%), Positives = 161/405 (39%), Gaps = 41/405 (10%)

Query: 148 RWRKSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVSNPDFVVTDPITYGVFAACVI 207
           +W+K +    G  +      +  SI   L+  IL    + +PD+ +     +  +    I
Sbjct: 136 KWKKDLGIMTGLFNYAGAVFTSASICASLSLSILGVYSLMHPDYELRHWNVFLTYELLNI 195

Query: 208 AMAVLTSLASGFTSKLQ---TISIVSNCXXXXXXXXXXPIGVSRSDKLNHSFNNAKFIFG 264
           AMA + S A    +  Q    IS+VS               +SRS   +  +   K +FG
Sbjct: 196 AMAFVASWARWLPAISQFGLGISVVSYVLTFLISI------ISRSFNHSEQWPTGKTVFG 249

Query: 265 KSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEA--RDAVRAVPIGIVGSIASCW 322
           +  N T W+      I GL   +W+    DS  HM ++     + + VP  I+ +I   +
Sbjct: 250 EFTNTTGWSSSGMAFIVGLINPLWSFAGIDSATHMVDDVGYSASRKLVPRIIIATILLGF 309

Query: 323 ILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKRWTLAFL-SFMIICQFLMGA 381
              +   IV+  C+  D   +++S     I Q++Y A G +   AF+ S  II  F+ G 
Sbjct: 310 ATAFPYAIVMFFCIT-DSTQVVSSIL--PILQIYYQATGNKSLSAFMQSCCIITGFICGV 366

Query: 382 STVVANSRQFWAFARDDALPFSNFFK-----------KVNGSVAVPIRAVWXXXXXXXXX 430
           S+    +R  W+ +R   L   +               ++ ++ +P+ A           
Sbjct: 367 SSSTWQNRILWSVSRTYHLIECDEMNAKKAQVVAKIASISPTIRIPVYAHLLSHFFVAVI 426

Query: 431 XXXXXXXEVAADALFSLSIAGMYMALIFP-ITLRLTYGKKDFRP---------GPFYMGD 480
                    A +A+ +  I+ + ++   P I +    GKK+F           G  +  +
Sbjct: 427 GCIFMGSSTAFNAIITACISILLLSYAVPCIIMVFVVGKKNFYRNIASEQQALGLSHQVE 486

Query: 481 ----FWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVI 521
                W  + N +++ + LF +I + FPY    +D   MNY  V+
Sbjct: 487 ESRASWYLVPNILTICWALFCLIFLSFPYVI-PVDSSNMNYVSVV 530

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 41/73 (56%), Gaps = 1/73 (1%)

Query: 66  EELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAG-PVGLSWGWFVAGGLILTVGIAL 124
           E+   +F+ L + G+AFS+      ++S++  GLY+G PV + +G  +     +  G++L
Sbjct: 3   EKRFTKFNWLSLLGIAFSLTSSWLGVSSSLVAGLYSGGPVLIIYGLIIGAVFTIMCGLSL 62

Query: 125 AELSSSIPTAGAV 137
            E SS +P A  V
Sbjct: 63  CEFSSMLPNASGV 75

>Kthe_YGOB_SAKL0H11484g Chr5 complement(59674..60886,60889..61346)
           [1671 bp, 556 aa] {ON} ANNOTATED BY YGOB -
          Length = 556

 Score = 63.5 bits (153), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 73/304 (24%), Positives = 119/304 (39%), Gaps = 35/304 (11%)

Query: 246 VSRSDKLNHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEA-- 303
           VSRS+  + S+  +  IFG+  N T W+      + GL   +W     DS  HM +E   
Sbjct: 246 VSRSNYSDISWPKSSDIFGQFRNTTGWSSSGMAFVVGLINPLWAFAGIDSATHMVDEVGY 305

Query: 304 RDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKR 363
           + +   VP  I+ +I   ++  +   I +  C+  D   +  S     I +++Y A G R
Sbjct: 306 KASTTLVPQAILSTIIIGFLTSFTYAIGMFFCVT-DTEKVTESIL--PILEIYYQATGNR 362

Query: 364 WTLAFLSFMIICQFLMGA----STVVANSRQFWAFARD-----DALPFSN----FFKKVN 410
             L+ L  M  C  L GA    ++V   SR  W+  +D        P       FF  VN
Sbjct: 363 -NLSVL--MQCCCILTGALCGIASVTWQSRILWSLGKDFSQVTTTRPVCKKTMGFFGTVN 419

Query: 411 GSVAVPIRAVWXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRLTYGKKD 470
             +  P+ A                    A +A+ S  I  + +    P  + L  GK++
Sbjct: 420 SKLRAPLNAHLFSQLCVAIIGCIFMGSSTAFNAIISACITLLLLTYAVPCLIVLLIGKRE 479

Query: 471 FRP-------------GPFYMGDFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNY 517
           F               G   +      I N +++ + LF +I + FPY    +  + MNY
Sbjct: 480 FYERAKSKLNVLGVNLGRVPVCSKIGQIPNVLTILWALFCLIFLSFPYSLP-VSANNMNY 538

Query: 518 TVVI 521
             V+
Sbjct: 539 VTVV 542

>YNR056C Chr14 complement(731618..733303) [1686 bp, 561 aa] {ON}
           BIO5Putative transmembrane protein involved in the
           biotin biosynthesis pathway; responsible for uptake of
           7-keto 8-aminopelargonic acid; BIO5 is in a cluster of 3
           genes (BIO3, BIO4, and BIO5) that mediate biotin
           synthesis
          Length = 561

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 123/535 (22%), Positives = 209/535 (39%), Gaps = 79/535 (14%)

Query: 65  KEELK--REFSTLQIFGVAFSIMGLLPSIASTMDGGLYAG-PVGLSWGWFVAGGLILTVG 121
           + E+K  + F+   + G+AFS+      I+++M  G+ +G P+ + +G  +A    L  G
Sbjct: 36  RSEVKFDKHFNWWSLLGIAFSLSCSWVGISASMAVGIASGGPLLIIYGLIIAAFFSLMCG 95

Query: 122 IALAELSSSIPTAGA------------------------------VYVSCYQWA-----P 146
           I+L + ++ +P +                                V++  Y         
Sbjct: 96  ISLGDFAAILPNSSGGSFWVLKMLEQESVTLKTPEYEDPSDDDEEVFLENYCQTFNVEVS 155

Query: 147 ARWRKSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVSNPDFVVTDPITYGVFAACV 206
           ++++K  S  VG L+      +  SI   L+   +    + +PD+ +     + VF    
Sbjct: 156 SKFQKVSSMVVGLLNYFGAIFTTASICSSLSMSCIGIHKLLHPDYELKH---WHVFVGYE 212

Query: 207 IAMAVLTSLASGFTSKLQTISIVSNCXXXXXXXXXXPIG-VSRSDKLNHSFNNAKFIFGK 265
              AVLT L + +++ L  IS                I  VSRSD     +  A  IFG 
Sbjct: 213 CINAVLT-LFNIYSTPLPYISQFGLYTSLLSFAMTFIICIVSRSDNTVDPWPKASNIFGS 271

Query: 266 SENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEA--RDAVRAVPIGIVGSIASCWI 323
            +N T WN      + GL   IW     DS  HM +E     +   VP  I+ +I   ++
Sbjct: 272 FDNQTGWNSSGMAFVVGLVNPIWAFVGIDSATHMIDEVGYSKSRFLVPKVIITTIIVGFV 331

Query: 324 LGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKRWTLAFLSFMIICQ-FLMGAS 382
             ++ C+ L  C+  D   ++ S     I ++FY A G R    FL  M I   F+ G +
Sbjct: 332 TSFIYCVGLFFCIT-DQTAVVESIL--PIVEIFYQATGNRNLSVFLQCMCITTGFVSGIA 388

Query: 383 TVVANSRQFWAFARDDALPF---SNFFKKVNGSVAV-------PIRAVWXXXXXXXXXXX 432
           +    SR   +F +  A PF    +   K    +AV       P+ A +           
Sbjct: 389 SGTWQSRILQSFGKSYA-PFYKEGSLGNKSLKKLAVLTPGFKSPLYAHFLSQICVTIIGC 447

Query: 433 XXXXXEVAADALFSLSIAGMYMALIFPITLRLTYGKKD-------------FRPGPFYMG 479
                  A +A+ +  I  + M+   P  + L   KK+              RP    M 
Sbjct: 448 IFMGSSTAFNAIITACITLLLMSYAVPSFIFLFVIKKEKFIHRIESDVNCVSRPNRRRM- 506

Query: 480 DFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYT-VVIGPGFWVLSLIYY 533
              S I + I + + LF ++ + FPY    +    MNYT VV    F ++S++ +
Sbjct: 507 ---SMIPHIICILWTLFCLVFLSFPYTL-PVTAGNMNYTSVVYAVVFCIISIVVF 557

>Smik_14.390 Chr14 complement(688421..690085) [1665 bp, 554 aa] {ON}
           YNR056C (REAL)
          Length = 554

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 119/535 (22%), Positives = 206/535 (38%), Gaps = 79/535 (14%)

Query: 65  KEELK--REFSTLQIFGVAFSIMGLLPSIASTMDGGLYAG-PVGLSWGWFVAGGLILTVG 121
           + E+K  + F+   + G+AFS+      I+++M  G+ +G P+ + +G  +A    L  G
Sbjct: 29  RSEVKFDKHFNWWSLLGIAFSLSCSWVGISASMAVGIASGGPLLIIYGLIIAAFFSLMCG 88

Query: 122 IALAELSSSIPTA------------------------------GAVYVSCYQWAP----- 146
           I+L + ++ +P +                              G V++  Y         
Sbjct: 89  ISLGDFAAILPNSSGGSFWVLKMLEQESVALKTPEYEDTSDDDGEVFLENYCQTANVEVC 148

Query: 147 ARWRKSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVSNPDFVVTDPITYGVFAACV 206
           ++++K  S  VG L+      +  SI   L+   +    + +PD+ +     + VF    
Sbjct: 149 SKFQKVSSMVVGLLNYFGAIFTTASICSSLSMSCIGIHKLLHPDYELKH---WHVFVGYQ 205

Query: 207 IAMAVLTSLASGFTSKLQTISIVSNCXXXXXXXXXXPIG-VSRSDKLNHSFNNAKFIFGK 265
              A+LT   + ++S L  IS                I  VSRS+     +  A  IFG 
Sbjct: 206 CINAILT-FFNIYSSPLPYISQFGLYTSLLSFAMTFIICIVSRSNNTVEKWPKASNIFGS 264

Query: 266 SENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEA--RDAVRAVPIGIVGSIASCWI 323
            +N T WN      + GL   +W     DS  HM +E     +   VP  I+ +I   ++
Sbjct: 265 FDNQTGWNSSGMAFVVGLVNPLWAFVGIDSATHMIDEVGYSRSRFLVPKVIITTIIVGFV 324

Query: 324 LGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKRWTLAFLSFMIICQ-FLMGAS 382
             ++ C+ L  C+  D   ++ S     I ++FY A G R    FL  M I   F+ G +
Sbjct: 325 TSFIYCVGLFFCIT-DKTAVVESIL--PIVEIFYQATGNRNLSVFLQCMCITTGFISGIA 381

Query: 383 TVVANSRQFWAFARDDALPFSNFFKKVNGSV----------AVPIRAVWXXXXXXXXXXX 432
           +    SR   +F +  A PF N     N S+            P+ A +           
Sbjct: 382 SGTWQSRILQSFGKSYA-PFYNEGSLGNKSLKRLSILTPKFKSPLYAHFLSQICVTIIGC 440

Query: 433 XXXXXEVAADALFSLSIAGMYMALIFP-ITLRLTYGKKDF------------RPGPFYMG 479
                  A +A+ +  I  + M+   P         K+ F            RP    M 
Sbjct: 441 IFMGSSTAFNAIITACITLLLMSYAVPSFIFVFVVNKEKFIYRIENDVNGISRPNRRRM- 499

Query: 480 DFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYT-VVIGPGFWVLSLIYY 533
              S + + I + + LF ++ + FPY    +    MNYT VV    F ++S++ +
Sbjct: 500 ---SMVPHIICILWTLFCLVFLSFPYTL-PVTAGNMNYTSVVYAVVFCIISIVVF 550

>Suva_11.49 Chr11 complement(105256..107115) [1860 bp, 619 aa] {ON}
           YKL174C (REAL)
          Length = 619

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 98/501 (19%), Positives = 203/501 (40%), Gaps = 23/501 (4%)

Query: 48  DAKNATSDQQVLAEIGYKEELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLY-AGPVGL 106
           D +N  ++     ++  K  L R      I G+   +M  +  ++++M  GL   GP+ +
Sbjct: 36  DQENEEAEHFNYDQVLDKSLLSRG----SIVGLGLGLMSPVLGMSTSMAIGLINGGPLTI 91

Query: 107 SWGWFVAGGLILTVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLC 166
             G+ ++G  I    ++L E+ S  P    ++V     AP + + + S+  G+L  +   
Sbjct: 92  MLGFLISGVCIWFSSLSLGEIVSKFPME--LHVGSAMLAPEKLKLACSWYTGWLMLIGNW 149

Query: 167 ASVCSIVYGLAQQILSAVVVSNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTI 226
               SI +  AQ  +S ++++N + +    +T+       + + ++  +   F   ++TI
Sbjct: 150 TMSTSITFAGAQLTISLILMTNSNLISEAHLTFYTVIVFYLVVTIVGLVNLKFARFIETI 209

Query: 227 SIVSNCXXXXXXXXXXPIGVSRSDKLNHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPA 286
           + V              + +        S   A F F  S   + +   +   I G   +
Sbjct: 210 NKVCVYWIIYAIIFIDILLLIFHKGKFRSLKYALFHFDNS--LSGYKSAFLSFIIGFQQS 267

Query: 287 IWTIGAYDSCLHMAEEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINS 346
            +T+  +     +A+E +   R +P G+  ++      G +  I ++  + PD + +  +
Sbjct: 268 NFTLQGFSMLPALADEVKVPERDIPRGMSNAVLLSAFSGVIFLIPIMLIL-PDNDLLFTN 326

Query: 347 PYGQGITQVFYDALGKRWTLAFLSFMIICQFLM-----GASTVVANSRQFWAFARDDALP 401
                I  +F     K      LSF ++   L      G  ++  +SR  ++F+RD A+P
Sbjct: 327 HKVLPIVNIF----TKSTASVVLSFFLVLLILGNLLFSGIGSITTSSRAVYSFSRDRAIP 382

Query: 402 FSNFFKKV--NGSVAVPIRAVWXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFP 459
               +  V  +    VP  +V                   A +A    ++  +  A   P
Sbjct: 383 HYEKWTYVEPDSQSKVPKNSVILSMVISYFLGLLALISTAAFNAFIGAAVLCLCSATFIP 442

Query: 460 ITLRLTYGKKDFRPGPFYMGDFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTV 519
           + L L   ++  R  P  +   +   IN +S+A+ L +++ V  P Q   +   TMNY +
Sbjct: 443 LVLVLFTRRRAIRSAPVKIRYKFGWFINIVSIAWLLLSMVSVCLPTQV-PVTFKTMNYAL 501

Query: 520 VIGPGFWVLSLIYYYFWQSKF 540
           ++   F +L++   YF   K+
Sbjct: 502 MVYI-FCILAITGLYFKWGKY 521

>Kwal_55.19602 s55 (43521..45197) [1677 bp, 558 aa] {ON} YNR056C
           (BIO5) - transmembrane regulator of KAPA/DAPA transport
           [contig 159] FULL
          Length = 558

 Score = 60.5 bits (145), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 104/519 (20%), Positives = 195/519 (37%), Gaps = 90/519 (17%)

Query: 67  ELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAG-PVGLSWGWFVAGGLILTVGIALA 125
           +L + F  L + G+AFS+      ++S++  G+ +G P+ + +G  +     L  G +LA
Sbjct: 21  KLSKNFGWLSLLGIAFSLTNSWLGVSSSLVVGISSGGPLLIIYGLIIGVFFTLMCGWSLA 80

Query: 126 ELSSSIP-TAGAVY---------------------------------VSCYQWAPAR--- 148
           E SS +P ++GA +                                  +C   +P R   
Sbjct: 81  EFSSLLPNSSGASFWVLKMLETVEKAKRNGLDPEVLEDASIGDTVDRGTCEISSPERKLE 140

Query: 149 -------------WRKSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVSNPDFVVTD 195
                         ++S + +VG ++      +  S+   LA  IL    + N ++ +  
Sbjct: 141 LMCTANNGEATSTIQRSTALAVGLINYFGAIFTTSSVFSSLAISILGVHSLLNEEYTLKH 200

Query: 196 PITYGVFAACVIAMAVLT--SLASGFTSKLQT-ISIVSNCXXXXXXXXXXPIGVSRSDKL 252
              + V+   VI + +++  SL     SK    +S+++               V RS   
Sbjct: 201 WHVFVVYEVLVIFLTLVSCWSLILPALSKFGLGMSLITYMLTFIVSL------VCRSSNT 254

Query: 253 NHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEA--RDAVRAV 310
             ++     IFG+ +N T W       I GL   +W     DS  HM +E     +++ V
Sbjct: 255 EVAWPKPSMIFGEFKNTTGWKSSQMAFIVGLINPLWAFAGIDSATHMVDEVGYTASMKLV 314

Query: 311 PIGIVGSIASCWILGWLICIVLLACM-DPDLNNIINSPYGQGITQVFYDALGKRWTLAFL 369
           P  I+G+I   ++  +   I +  C+ DP   +    P    I +++Y A G +    FL
Sbjct: 315 PRVIIGTILIGFVTSFTYAIGMFFCITDPAKLSDAVLP----ILELYYQATGNKNLSVFL 370

Query: 370 S-FMIICQFLMGASTVVANSRQFWAFARDDAL---------PFSNFFKKVNGSVAVPIRA 419
               I+     G ++V   SR  W+  RD +              FF  VN ++  P+ A
Sbjct: 371 QCCCIVSGITCGVASVTWQSRILWSLGRDFSTLELRQTYSKKILKFFGVVNPTLKTPLNA 430

Query: 420 VWXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPG----- 474
            +                  A +A+ +  I  + ++   P  +    G++ F        
Sbjct: 431 HFFSQLLVAIIGCIFMGSSTAFNAIITACITLLLLSYAIPCLILFMVGRRRFFKRIKKQL 490

Query: 475 --------PFYMGDFWSPIINWISVAFQLFTIIMVMFPY 505
                     + G     I N +++ + LF ++ + FPY
Sbjct: 491 TESGISGVSSFAGSRIGAIPNVLTILWTLFCLVFLSFPY 529

>AEL125C Chr5 complement(387763..389490) [1728 bp, 575 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL174C
          Length = 575

 Score = 60.1 bits (144), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 87/381 (22%), Positives = 168/381 (44%), Gaps = 27/381 (7%)

Query: 55  DQQVLAE-IGYKEELKREF-STLQIFGVAFSIMGLLPSIASTMDGGL-YAGPVGLSWGWF 111
           D+ V  E   Y+++L R   S   + G+ F +M  +  +++T+  GL + GP  +   + 
Sbjct: 36  DEPVEVEHFQYEQKLDRTLLSRRSVIGLGFGLMSPVLGMSTTLGIGLVHGGPPTILGAFA 95

Query: 112 VAGGLILTVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCS 171
           + G +     +A+ E+ S  P    ++ S    AP R+R   +Y  G L  L       S
Sbjct: 96  LCGLMSWLTALAIGEVVSKYPIE--LHGSVALLAPERYRLVAAYYTGCLILLGNWVMNAS 153

Query: 172 IVYGLAQQILSAVVVSNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSN 231
           I Y  AQ I+S + +S  D V  + +     A   +++ V   + + F S L+ I+ V  
Sbjct: 154 IQYAGAQLIISLIAISG-DLVSEENLAIWTVAVYFLSITVTGVINAKFASFLEPINTV-- 210

Query: 232 CXXXXXXXXXXPIGVSRSDKLNHSFNNAKF--IFGKSENFTDWNGGW-----SWCINGLT 284
           C             V   D L   F+   F        NF +   G+     S+ + GL 
Sbjct: 211 CIYWILY------AVVFIDVLLILFHKGSFRPFLSAFSNFDNRLSGYESMLLSFLVGGLQ 264

Query: 285 PAIWTIGAYDSCLHMAEEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNII 344
            + +T+  +     +++E ++  + +P G+  ++    + G +  + LL  M P    ++
Sbjct: 265 QSNFTLQGFSMLPALSDETQEPEKDIPKGMSQAVLVSTVCGVIYLVPLLLVM-PSPEEVM 323

Query: 345 NSPYGQGITQVFYDALGKRWTLAFLSFMIICQFLM--GASTVVANSRQFWAFARDDALPF 402
           +      I  +F  +  +   +++L  M+I   L+  G  ++  +SR  ++ +RD A+P+
Sbjct: 324 SDSRVMEIVLLFTKST-RSNIVSYLQVMLILGNLLFSGIGSITTSSRAVYSISRDHAIPY 382

Query: 403 SNFFKKVN-GSVA-VPIRAVW 421
              +  V+ GS + VP  AV+
Sbjct: 383 YELWSYVSPGSQSQVPKYAVY 403

>Skud_11.51 Chr11 complement(106683..108533) [1851 bp, 616 aa] {ON}
           YKL174C (REAL)
          Length = 616

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 98/502 (19%), Positives = 199/502 (39%), Gaps = 25/502 (4%)

Query: 48  DAKNATSDQQVLAEIGYKEELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLY-AGPVGL 106
           D +N  ++     ++  K  L R      I G+   +M  +  + ++M  GL   GP+ +
Sbjct: 36  DHENEEAEHFNYDQVLDKSLLSRS----SIVGLGLGLMSPVLGMCTSMAIGLINGGPLTI 91

Query: 107 SWGWFVAGGLILTVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLC 166
             G+ ++G       ++L E+ S  P    ++V     AP   +   S+  G+L  +   
Sbjct: 92  MLGFLISGMCTWFSSLSLGEIVSKFPME--LHVGSAMLAPKNLKLVCSWYTGWLMLIGNW 149

Query: 167 ASVCSIVYGLAQQILSAVVVSNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTI 226
               SI +  AQ  +S ++++N D +    + +       + + V+  +   F   ++TI
Sbjct: 150 TMSTSITFAGAQLTISLILMTNSDLISEAHLIFYTVIVFYLVVTVVGLVNLKFARFIETI 209

Query: 227 SIVSNCXXXXXXXXXXPIGVSRSDKLNHSFNNAKF-IFGKSENFTDWNGGWSWCINGLTP 285
           + V  C             +         F + K+ +F    N + +   +   I G   
Sbjct: 210 NKV--CVYWIVYAIIFIDILLLIFH-KGKFRSLKYALFHFDNNLSGYKSAFLSFIIGFQQ 266

Query: 286 AIWTIGAYDSCLHMAEEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIIN 345
           + +T+  +     +A+E +   R +P G+  ++      G +  I ++  + PD + +  
Sbjct: 267 SNFTLQGFSMLPALADEVKVPERDIPRGMSNAVLLSAFSGVIFLIPIMLIL-PDNDALFT 325

Query: 346 SPYGQGITQVFYDALGKRWTLAFLSFMIICQFLM-----GASTVVANSRQFWAFARDDAL 400
           +     I  +F     K      LSF ++   L      G  ++  +SR  ++F+RD A+
Sbjct: 326 NHKVLPIVNIF----TKSTDSVVLSFFLVLLILGNLLFSGIGSITTSSRAVYSFSRDHAI 381

Query: 401 PFSNFFKKV--NGSVAVPIRAVWXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIF 458
           P    +  V  +    VP  +V                   A +A    ++  +  A   
Sbjct: 382 PHYGRWTYVEPDSQSKVPKNSVILSMIISYFLGLLALISTAAFNAFIGAAVLCLCSATFI 441

Query: 459 PITLRLTYGKKDFRPGPFYMGDFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYT 518
           P+ L L   ++  R  P  +   +   IN +S+A+ L +++ V  P  Q  +   TMNY 
Sbjct: 442 PLVLVLLTRRRAIRSAPVKIRYKFGWFINIVSIAWVLLSMVSVCLP-TQVPVTFKTMNYA 500

Query: 519 VVIGPGFWVLSLIYYYFWQSKF 540
           +++   F +L +   YF   K+
Sbjct: 501 LMVYV-FCILVITGLYFKWGKY 521

>Suva_14.415 Chr14 complement(716463..718061) [1599 bp, 532 aa] {ON}
           YNR056C (REAL)
          Length = 532

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 116/518 (22%), Positives = 198/518 (38%), Gaps = 76/518 (14%)

Query: 67  ELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAG-PVGLSWGWFVAGGLILTVGIALA 125
           +  + F+   + G+AFS+      I+++M  G+ +G P+ + +G  +A    L  GI+L 
Sbjct: 10  KFDKHFNWWSLLGIAFSLSCSWVGISASMAVGIASGGPLLIIYGLIIAAFFTLMCGISLG 69

Query: 126 ELSSSIPTA--GAVYV-SCYQWAPA--------------------------------RWR 150
           + +S +P +  G+ +V    +  PA                                R +
Sbjct: 70  DFASILPNSCGGSFWVLKMLEREPATLKTPDYEDASDDDEEVFLETYCQTSNVEISSRLQ 129

Query: 151 KSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVSNPDFVVTDPITYGVFAACVIAMA 210
           K  S  VG L+      +  S+   L+   +    + +P++ +     + VF       A
Sbjct: 130 KGTSMVVGLLNYFGAIFTTASVCSSLSMSCIGIHKLLHPEYELKH---WHVFVGYQCINA 186

Query: 211 VLTSLASGFTSKLQTISIVSNCXXXXXXXXXXPIG-VSRSDKLNHSFNNAKFIFGKSENF 269
            LT + + ++S L  IS                I  VSRS+    S+  A  IFG  +N 
Sbjct: 187 TLT-VFNIYSSPLPYISQFGLYTSLLSFAMTFIICIVSRSNNTVDSWPKASNIFGNFDNQ 245

Query: 270 TDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEA--RDAVRAVPIGIVGSIASCWILGWL 327
           T W+      + GL   IW     DS  HM +E     +   VP  I+ +I   +I  ++
Sbjct: 246 TGWHSSGMAFVVGLVNPIWAFVGIDSATHMIDEVGYSKSRFLVPKVIITTIVVGFITSFI 305

Query: 328 ICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKRWTLAFLSFMIICQ-FLMGASTVVA 386
            C+ L  C+  D   ++ S     I ++FY A G R    FL  M I   ++ G ++   
Sbjct: 306 YCVGLFFCIT-DKTAVVESIL--PIVEIFYQATGNRNLSVFLQCMCITTGYVAGIASGTW 362

Query: 387 NSRQFWAFARDDALPF-------SNFFKK---VNGSVAVPIRAVWXXXXXXXXXXXXXXX 436
            SR   ++ +  A PF       +   KK   +      P+ A +               
Sbjct: 363 QSRILQSYGKSYA-PFYKEGSLGNKSLKKLATLTPGFKSPLYAHFLSQICVTIIGCIFMG 421

Query: 437 XEVAADALFSLSIAGMYMALIFP-ITLRLTYGKKDF------------RPGPFYMGDFWS 483
              A +A+ +  I  + M+   P         K++F            RP    M    S
Sbjct: 422 SSTAFNAIITACITLLLMSYAVPSFIFVFVVNKENFTSRIENEVNGISRPKTRRM----S 477

Query: 484 PIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVI 521
            I + I + + LF +I + FPY    +    MNYT V+
Sbjct: 478 IIPHIICILWTLFCLIFLSFPYTL-PVTAGNMNYTSVV 514

>Skud_14.392 Chr14 complement(699671..701266) [1596 bp, 531 aa] {ON}
           YNR056C (REAL)
          Length = 531

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 119/522 (22%), Positives = 200/522 (38%), Gaps = 78/522 (14%)

Query: 65  KEELK--REFSTLQIFGVAFSIMGLLPSIASTMDGGLYAG-PVGLSWGWFVAGGLILTVG 121
           + E+K  + F+   + G+AFS+      I+++M  G+ +G P+ + +G  +A    L  G
Sbjct: 6   RPEVKFDKHFNWWSLLGIAFSLSCSWVGISASMAVGIASGGPLLIIYGLIIAAFFSLMCG 65

Query: 122 IALAELSSSIPTAGA------------------------------VYVSCY-QWA----P 146
           I+L + +S +P +                                V++  Y Q A     
Sbjct: 66  ISLGDFASMLPNSCGGSFWVLKMLEQKSATLKTPDYEDTSDDDEEVFLENYCQTANVEVS 125

Query: 147 ARWRKSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVSNPDFVVTDPITYGVFAACV 206
           ++ ++  S  VG L+      +  SI   L+   +    + +PD+ +     + +F    
Sbjct: 126 SKVQRVSSMVVGLLNYFGAIFTTASICSSLSMSCIGIHKLLHPDYELKH---WHIFVGYQ 182

Query: 207 IAMAVLTSLASGFTSKLQTISIVSNCXXXXXXXXXXPIG-VSRSDKLNHSFNNAKFIFGK 265
              A+LT L + ++S L  IS                I  VSRS+    ++  A  IFG 
Sbjct: 183 CINAILT-LFNIYSSPLPYISQFGLYTSLLSFAMTFIICIVSRSNNTIDAWPKASNIFGS 241

Query: 266 SENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEA--RDAVRAVPIGIVGSIASCWI 323
            +N T WN      + GL   IW     DS  HM +E     +   VP  I+ +I   +I
Sbjct: 242 FDNQTGWNSSGMAFVVGLVNPIWAFVGIDSATHMIDEVGYSKSRFLVPKVIITTIIVGFI 301

Query: 324 LGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKRWTLAFLSFMIICQ-FLMGAS 382
             ++ C+ L  C+  D   ++ S     I ++FY A G R    FL  M I   F+ G +
Sbjct: 302 TSFIYCVGLFFCIT-DKTAVVESIL--PIVEIFYQATGNRNLSVFLQCMCITTGFVAGIA 358

Query: 383 TVVANSRQFWAFARDDALPFSNFFKKVNGSV----------AVPIRAVWXXXXXXXXXXX 432
           +    SR   +F +  A PF       N S+            P+ A +           
Sbjct: 359 SGTWQSRILQSFGKSYA-PFYKEDSLGNKSLKRLAMLTPGFKSPLYAHFLSQICVTVIGC 417

Query: 433 XXXXXEVAADALFSLSIAGMYMALIFP-ITLRLTYGKKDF------------RPGPFYMG 479
                  A +A+ +  I  + M+   P         K+ F            RP    M 
Sbjct: 418 IFMGSSTAFNAIITACITLLLMSYAVPSFIFVFVVDKEKFIHRIGNDVSCISRPNRRRM- 476

Query: 480 DFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVI 521
              S I + I + + LF ++ + FPY    +    MNYT V+
Sbjct: 477 ---SKIPHIICILWALFCLVFLSFPYTL-PVTAGNMNYTSVV 514

>YKL174C Chr11 complement(120380..122236) [1857 bp, 618 aa] {ON}
           TPO5Protein involved in excretion of putrescine and
           spermidine; putative polyamine transporter in the Golgi
           or post-Golgi vesicles
          Length = 618

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 98/512 (19%), Positives = 206/512 (40%), Gaps = 32/512 (6%)

Query: 44  IRYIDAKNATSDQQVLAEIGYKEELKREF-STLQIFGVAFSIMGLLPSIASTMDGGLY-A 101
           +  I  ++ + + +      Y + L +   S   I G+   +M  +  + ++M  GL   
Sbjct: 27  LHTIVHEDDSQENEEAEHFNYDQVLDKSLLSRGSIVGLGLGLMSPVLGMCTSMAIGLING 86

Query: 102 GPVGLSWGWFVAGGLILTVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLD 161
           GP+ +  G+ ++G  I    ++L E+ S  P    ++V     AP + +   S+  G+L 
Sbjct: 87  GPLTIMLGFLISGVCIWFSSLSLGEIVSKFPME--LHVGSAMLAPEKLKLVCSWYTGWLM 144

Query: 162 TLSLCASVCSIVYGLAQQILSAVVVSNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTS 221
            +       SI +  AQ  +S ++++N + +    + +       + + V+  +   F  
Sbjct: 145 LIGNWTMSTSITFAGAQLTISLILMTNSNLISEAHLIFYTVIVFYLVVTVVGLVNLKFAR 204

Query: 222 KLQTISIVSNCXXXXXXXXXXPIGVSRSDKLNHSFNNAKF------IFGKSENFTDWNGG 275
            ++TI+ V  C             +   D L   F+  KF      +F    N + +   
Sbjct: 205 FIETINKV--CVYWIIYA------IIFIDILLLVFHKGKFRSLKYALFHFDNNLSGYKSA 256

Query: 276 WSWCINGLTPAIWTIGAYDSCLHMAEEARDAVRAVPIGIVGSIASCWILGWLICIVLLAC 335
           +   I G   + +T+  +     +A+E +   + +P G+  ++      G +  I ++  
Sbjct: 257 FLSFIIGFQQSNFTLQGFSMLPALADEVKVPEKDIPRGMSNAVLLSAFSGVIFLIPIMLI 316

Query: 336 MDPDLNNIINSPYGQGITQVFYDALGKRWTLAFLSFMIICQFLM-----GASTVVANSRQ 390
           + PD + +  +     I  +F     K      LSF ++   L      G  ++  +SR 
Sbjct: 317 L-PDNDLLFTNHKVLPIVNIF----TKSTDSVVLSFFLVLLILGNLLFSGIGSITTSSRA 371

Query: 391 FWAFARDDALPFSNFFKKV--NGSVAVPIRAVWXXXXXXXXXXXXXXXXEVAADALFSLS 448
            ++F+RD A+P+ + +  V  +    VP  +V                   A +A    +
Sbjct: 372 VYSFSRDQAIPYYDKWTYVEPDSQSKVPKNSVVLSMIISYFLGLLALISTAAFNAFIGAA 431

Query: 449 IAGMYMALIFPITLRLTYGKKDFRPGPFYMGDFWSPIINWISVAFQLFTIIMVMFPYQQH 508
           +  +  A   P+ L L   ++  R  P  +   +   IN +S+ + L +++ V  P  Q 
Sbjct: 432 VLCLCSATFIPLVLVLFTRRRAIRSAPVKIRYKFGWFINIVSIVWLLLSMVSVCLP-TQV 490

Query: 509 NIDKDTMNYTVVIGPGFWVLSLIYYYFWQSKF 540
            +   TMNY +++   F +L +   YF   K+
Sbjct: 491 PVTFKTMNYALMVYV-FCILVITGLYFKWGKY 521

>Smik_11.55 Chr11 complement(105857..107716) [1860 bp, 619 aa] {ON}
           YKL174C (REAL)
          Length = 619

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 93/467 (19%), Positives = 186/467 (39%), Gaps = 30/467 (6%)

Query: 69  KREFSTLQIFGVAFSIMGLLPSIASTMDGGLY-AGPVGLSWGWFVAGGLILTVGIALAEL 127
           K   S   I G+   +M  +  + ++M  GL   GP  +  G+ ++G  I    ++L E+
Sbjct: 53  KSLLSRSSIVGLGLGLMSPVLGMCTSMAIGLINGGPFTIMLGFLISGVCIWFSSLSLGEI 112

Query: 128 SSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVS 187
            S  P    ++V     AP   +   S+  G+L  +       SI +  AQ  +S ++++
Sbjct: 113 VSKFPME--LHVGSAMLAPETLKLVCSWYTGWLMLIGNWTMSTSITFAGAQLTISLILMT 170

Query: 188 NPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCXXXXXXXXXXPIGVS 247
           N D +      + +F   ++   V+T++        + I I++               + 
Sbjct: 171 NSDLISE---AHLIFYTVIVFYLVVTAVGLVNLKFARFIEIINKVCVYWIIYA-----II 222

Query: 248 RSDKLNHSFNNAKF------IFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAE 301
             D L   F+  KF      +F    N + +   +   I G   + +T+  +     +A+
Sbjct: 223 FIDILLLVFHKGKFRSLKYALFHFDNNLSGYKSAFISFIIGFQQSNFTLQGFSMLPALAD 282

Query: 302 EARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALG 361
           E +   R +P G+  ++      G +  I ++  + PD + +  +     I  +F     
Sbjct: 283 EVKVPERDIPRGMSNAVLLSAFSGVIFLIPIMIIL-PDNDLLFTNHKVLPIVNIF----T 337

Query: 362 KRWTLAFLSFMIICQFLM-----GASTVVANSRQFWAFARDDALPFSNFFKKV--NGSVA 414
           K      LSF ++   L      G  ++  +SR  ++F+RD A+P+ + +  V  +    
Sbjct: 338 KSTDSVVLSFFLVLLILGNLLFSGIGSITTSSRAVYSFSRDQAIPYYDKWTYVEPDSQSK 397

Query: 415 VPIRAVWXXXXXXXXXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPG 474
           VP  +V                   A +A    ++  +  A   P+ L L   ++  R  
Sbjct: 398 VPKNSVILSMIISYFLGLLALISTAAFNAFIGAAVLCLCSATFIPLVLVLFTRRRAIRSA 457

Query: 475 PFYMGDFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVI 521
           P  +   +   IN +S+ + L +++ V  P  Q  +   TMNY +V+
Sbjct: 458 PVKIRYKFGWFINIVSIVWLLLSMVSVCLP-TQLPVTFKTMNYALVV 503

>KLLA0B00385g Chr2 complement(25847..27541) [1695 bp, 564 aa] {ON}
           similar to uniprot|P53744 Saccharomyces cerevisiae
           YNR056C BIO5 Putative transmembrane protein involved in
           the biotin biosynthesis pathway responsible for uptake
           of 7-keto 8-aminopelargonic acid BIO5 is in a cluster of
           3 genes (BIO3 BIO4 and BIO5) that mediate biotin
           synthesis
          Length = 564

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 86/409 (21%), Positives = 165/409 (40%), Gaps = 47/409 (11%)

Query: 147 ARWRKSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVSNPDFVVTDPITYGVFAACV 206
           + ++K+++ +VG ++      +  SIV  L   I+    + +P F +    T+       
Sbjct: 150 SSFQKNMAIAVGLINYFGCVFTTASIVSALVYSIMGIHSILHPSFELKQWHTF------- 202

Query: 207 IAMAVLTSLASGFTSKLQTISIVSN----CXXXXXXXXXXPIGVSRSDKLNHS-FNNAKF 261
           I   +LT   + F    + +  +S+                  VSRS+ ++   +  ++ 
Sbjct: 203 ILYEILTVFLTVFNCNYRCLPFLSSFGLAMSLLSYAITFILCLVSRSNSISEQPWPKSED 262

Query: 262 IFGKSENFTDW-NGGWSWCINGLTPAIWTIGAYDSCLHMAEEARD--AVRAVPIGIVGSI 318
           IF K  N T W + G ++ ++ + P +W+    DS  HM +E     A   VP  I+ +I
Sbjct: 263 IFYKFHNNTGWKSNGMAFVVSLINP-LWSFVGIDSATHMVDEVGHVAAQVLVPKVIITTI 321

Query: 319 ASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKRWTLAFL-SFMIICQF 377
              +I  +   I L  C+  D   ++ S     +  ++Y A G R    F+ +  I+   
Sbjct: 322 FIGFITSFSYSIALFYCVR-DTAAVLESI--APVVTIYYQATGNRNLAVFMQASTIVAGL 378

Query: 378 LMGASTVVANSRQFWAFARD------DALPFSNF----FKKVNGSVAVPIRAVWXXXXXX 427
             G ++    SR  W+ +R+      D +  S F    F  ++    VP+ A +      
Sbjct: 379 TCGVASGTWQSRMLWSLSREMETMRPDGI-LSGFVTARFATIDSVNKVPLYAHFFSQALV 437

Query: 428 XXXXXXXXXXEVAADALFSLSIAGMYMALIFPITLRLTYGKKDF--------------RP 473
                       A +A+ S ++  + ++   P  + L  G+  F               P
Sbjct: 438 VIIGCIMLGSTKAFNAIVSAAVTLLIVSYAIPSLILLVRGRNKFIAKCERETANETDIVP 497

Query: 474 GPFYM-GDFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVI 521
             + M    W  I + ++VA+ LF ++M+ FPY +  +    MNY  V+
Sbjct: 498 NKYSMWLKKWGVIPHTLTVAYALFCVVMLSFPYVKP-VTSSNMNYVSVV 545

>NCAS0J01180 Chr10 (204451..206208) [1758 bp, 585 aa] {ON} Anc_4.195
          Length = 585

 Score = 38.5 bits (88), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 63/155 (40%), Gaps = 15/155 (9%)

Query: 254 HSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEARDAVRAVPIG 313
           H+F++A   F  +EN T +       +  L   IW+   Y +  +   E +D VR + I 
Sbjct: 240 HNFHDA---FAGTENATAYG-----IVTALYNVIWSFVGYSNVNYALGEVKDPVRTLKIA 291

Query: 314 IVGSIASCWILGWLICIVLLACMDPDLNNIINSPY--GQGITQVFYDALGKRWTLAFLSF 371
              S+    I+   + +   A +  +   +I+S          + +   GK+   AF+  
Sbjct: 292 GPTSMVFIAIVYIFVNVAYFAVVPKE--KLISSKLVLAADFFDIVFGEHGKKAAAAFVGL 349

Query: 372 MIICQFLMGASTVVANSRQFWAFARDDALPFSNFF 406
             +   L   S + +  R      R+  LPFSNFF
Sbjct: 350 SALGNVL---SVIFSQGRIIQQLGREGVLPFSNFF 381

>ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {ON}
           conserved hypothetical protein
          Length = 567

 Score = 38.1 bits (87), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 46/93 (49%), Gaps = 6/93 (6%)

Query: 47  IDAKNATSDQQVLAEIGYKEELKREFSTLQIFGVAFSIM---GLLPSIASTMDGGLYAGP 103
           +D  N+ SD     +   +E L R  S   +  +A + +   GL  S A +++ G   GP
Sbjct: 41  VDTNNSVSDDPESQDAVIRERLNRSLSPRHVNMIAIAGVIGTGLFLSTAKSLNAG---GP 97

Query: 104 VGLSWGWFVAGGLILTVGIALAELSSSIPTAGA 136
             L   + + GG+I    ++L E+S+ +P +G+
Sbjct: 98  GSLLINYVIMGGVIYLTMLSLGEMSTFMPISGS 130

>Skud_7.353 Chr7 (586707..588431) [1725 bp, 574 aa] {ON} YGR055W
           (REAL)
          Length = 574

 Score = 37.7 bits (86), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 61/156 (39%), Gaps = 15/156 (9%)

Query: 253 NHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEARDAVRAVPI 312
           +H+F NA   F  +E  T +       +N L   IW+   Y +  +   E R+ VR + I
Sbjct: 238 SHNFRNA---FEGTETATAYG-----IVNALYSVIWSFVGYSNVNYALGEVRNPVRTLKI 289

Query: 313 GIVGSIASCWILGWLICIVLLACMDPDLNNIINSPY--GQGITQVFYDALGKRWTLAFLS 370
               S+    I+   + I   A +  D   +I+S          + +    KR   A + 
Sbjct: 290 AGPTSMVFLAIVYIFVNIAYFAVVPKD--KLISSKLILAADFFDIVFGGTAKRAAAALVG 347

Query: 371 FMIICQFLMGASTVVANSRQFWAFARDDALPFSNFF 406
              +   L   S + +  R      R+  LPFSNFF
Sbjct: 348 LSALGNVL---SVIFSQGRIIQQLGREGVLPFSNFF 380

>ABL003C Chr2 complement(390865..392550) [1686 bp, 561 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR055W
           (MUP1)
          Length = 561

 Score = 37.7 bits (86), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 53/128 (41%), Gaps = 5/128 (3%)

Query: 280 INGLTPAIWTIGAYDSCLHMAEEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPD 339
           +N L   IW+   Y +  +   E ++ VR + I    S+A    L  L+ +   A +  +
Sbjct: 243 VNALYQVIWSFVGYSNVNYALGEVKNPVRTLKIAGPSSLAVLGTLYLLVNVAFFAVVPME 302

Query: 340 LNNIINSPYGQGITQVFYD-ALGKRWTLAFLSFMIICQFLMGASTVVANSRQFWAFARDD 398
               I    G  +T  F+D A G +   A   F+ +       S + +  R      R+ 
Sbjct: 303 ----ILKDAGMNLTPKFFDIAFGDKARRASAIFIGLSALGNVCSVIFSQGRIVQQLGREG 358

Query: 399 ALPFSNFF 406
            LPF++FF
Sbjct: 359 VLPFTSFF 366

>YGR055W Chr7 (599417..601141) [1725 bp, 574 aa] {ON}  MUP1High
           affinity methionine permease, integral membrane protein
           with 13 putative membrane-spanning regions; also
           involved in cysteine uptake
          Length = 574

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 75/368 (20%), Positives = 134/368 (36%), Gaps = 30/368 (8%)

Query: 47  IDAKNATSD----QQVLAEIGYKEELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAG 102
           +DA N  SD    QQ   E+   ++ +++   L   G+  + M      A +       G
Sbjct: 35  VDADNGASDFEAGQQFATEL---DQGEKQLGILSCIGLICNRMLGTGVFAVSSTIYTLCG 91

Query: 103 PVGLSWGWFVAGGLILTVGIAL-AELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLD 161
            VGL+   +  G +I   G+ +  E  ++IP  G             + ++I     F  
Sbjct: 92  SVGLALIMWAVGAIIAISGLYVYMEFGTAIPKNGG---------EKNYLEAIFRKPKFFI 142

Query: 162 TLSLCASVCSIVYGLAQQILSAVV-VSNPDFVVTDPITYGVFAACVIAMAVLTSLASGFT 220
           T    A +  + +     I +A++ ++  D  VT     G+  A V    ++ SL     
Sbjct: 143 TCMYAAYIFFLGWAAGNSINTAIMFLTAADTEVTKWNQRGIGVAVVFFAFLINSLNVKIG 202

Query: 221 SKLQTISIVSNCXXXXXXXXXXPIGVSRSDKLNHSFNNAKFIFGKSENFTDWNGGWSWCI 280
             LQ I  +              + +    K  +  +N +  F  +E  T +       +
Sbjct: 203 LYLQNILGIFKIGIVLFISITGWVALGGGLKDGYQSHNFRNAFEGTETATAYG-----IV 257

Query: 281 NGLTPAIWTIGAYDSCLHMAEEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDL 340
           N L   IW+   Y +  +   E ++ VR + I    S+    I+   + I   A +  D 
Sbjct: 258 NALYSVIWSFVGYSNVNYALGEVKNPVRTLKIAGPTSMVFLAIIYIFVNIAYFAVVPKD- 316

Query: 341 NNIINSPY--GQGITQVFYDALGKRWTLAFLSFMIICQFLMGASTVVANSRQFWAFARDD 398
             +I+S          + +    KR   A +    +   L   S + +  R      R+ 
Sbjct: 317 -KLISSKLILAADFFDIVFGGQAKRAAAALVGLSALGNVL---SVIFSQGRIIQQLGREG 372

Query: 399 ALPFSNFF 406
            LPFSNFF
Sbjct: 373 VLPFSNFF 380

>ZYRO0B08030g Chr2 complement(626820..628556) [1737 bp, 578 aa] {ON}
           similar to uniprot|P50276 Saccharomyces cerevisiae
           YGR055W MUP1 High affinity methionine permease integral
           membrane protein with 13 putative membrane-spanning
           regions also involved in cysteine uptake
          Length = 578

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 65/309 (21%), Positives = 114/309 (36%), Gaps = 23/309 (7%)

Query: 102 GPVGLSWGWFVAGGLILTVGIAL-AELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFL 160
           G VGL+   +V GG+I   G+ +  E  ++IP  G             + + I     FL
Sbjct: 79  GSVGLALIMWVIGGIISLAGLYVYMEYGTAIPKNG---------GEKNYLEFIFKKPRFL 129

Query: 161 DTLSLCASVCSIVYGLAQQILSAVV-VSNPDFVVTDPITYGVFAACVIAMAVLTSLASGF 219
            T    A V  + +     I +AV+ ++  D  +T+    G+  A +     +  +    
Sbjct: 130 VTSMYAAYVFFLGWAAGNSINTAVMFLTAGDAKITEWNQRGIGVAVIFFAFAVNFINVKV 189

Query: 220 TSKLQTISIVSNCXXXXXXXXXXPIGVSRSDKLNHSFNNAKFIFGKSENFTDWNGGWSWC 279
              LQ I  V              + ++      H  NN K  F  +EN + +       
Sbjct: 190 GLYLQNILGVIKVGIVIFIAVSGWVALAGGTNHGHHTNNLKNAFEGTENASAYG-----V 244

Query: 280 INGLTPAIWTIGAYDSCLHMAEEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPD 339
           +N L   IW+   Y +  +   E ++ VR + I    S+ +  IL   + I   A +  +
Sbjct: 245 VNALYNVIWSFVGYSNVNYALGEVKNPVRTLKIAGPVSLITIAILYIFVNISYFAVVPKE 304

Query: 340 LNNIINSP--YGQGITQVFYDALGKRWTLAFLSFMIICQFLMGASTVVANSRQFWAFARD 397
              +I+S          + +   G+    AF+    +   L   S + +  R      R+
Sbjct: 305 --KLISSKLVLAADYFDIIFHGKGREVAAAFVGLSALGNVL---SVIFSQGRIIQQLGRE 359

Query: 398 DALPFSNFF 406
             LPF N F
Sbjct: 360 GILPFPNLF 368

>NDAI0J01930 Chr10 (480261..482033) [1773 bp, 590 aa] {ON} Anc_4.195
          Length = 590

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 62/156 (39%), Gaps = 15/156 (9%)

Query: 253 NHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEARDAVRAVPI 312
           +H+F++A   F  +E  T +       +  L   IW+   Y +  +   E +D VR + I
Sbjct: 236 SHNFHDA---FAGTETATAYG-----VVTALYNVIWSFVGYSNVNYALGEVKDPVRTLKI 287

Query: 313 GIVGSIASCWILGWLICIVLLACMDPDLNNIINSPY--GQGITQVFYDALGKRWTLAFLS 370
               S+    I+   + I   A +  +   +I+S          + +    KR   AF+ 
Sbjct: 288 AGPTSMIFLAIIYIFVNIAYFAVVPKE--KLISSKLVLAADFFDIVFGGHAKRAAAAFVG 345

Query: 371 FMIICQFLMGASTVVANSRQFWAFARDDALPFSNFF 406
              +   L   S + +  R      R+  LPFSNFF
Sbjct: 346 LSALGNVL---SVIFSQGRIIQQLGREGVLPFSNFF 378

>NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {ON}
           Anc_8.342
          Length = 837

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 59/141 (41%), Gaps = 19/141 (13%)

Query: 7   STSSSTK--DMISARKSNVDIGVGNVAELR----SITSAHGAPIRYIDAKNATSDQQVLA 60
           S SS T+  D  S R   +D G+ N  +      SIT+ H    R          +++  
Sbjct: 194 SNSSMTRVIDNTSYRNMAIDEGIDNTTKEETPALSITTDHSNETREPHKMLGFDLEKLFD 253

Query: 61  E-IGYKEELKREFSTLQI----FGVAFSIMGLLPSIASTMDGGLY--AGPVGLSWGWFVA 113
           +  G K  ++R      I     G  FS+   L S      G  +  AGP G   G+ ++
Sbjct: 254 KSKGGKNHIRRSLKVRHIQMLSIGTCFSVGFFLTS------GKAFSAAGPFGTLVGFILS 307

Query: 114 GGLILTVGIALAELSSSIPTA 134
           G ++L   ++  ELS+ IP A
Sbjct: 308 GSIVLATLLSFTELSTLIPVA 328

>NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 27/123 (21%), Positives = 60/123 (48%), Gaps = 6/123 (4%)

Query: 53  TSDQQVLAEIGYKEELKREFS--TLQIFGVAFSI-MGLLPSIASTMDGGLYAGPVGLSWG 109
           T+D+    E   +E+L R      + +  +A  I  GL  S + ++  G   GP  L   
Sbjct: 35  TTDENYDPEANIREDLTRALKPRVVNMISIAGIIGTGLYLSTSKSLHTG---GPASLFMN 91

Query: 110 WFVAGGLILTVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASV 169
           + + GG++    +AL E+S+ +P +G+  V   ++    +  ++ ++  F D +S+ + +
Sbjct: 92  YTIMGGVVYLTLLALGEMSTYMPISGSFCVYARKFGSESFACALMWNYWFNDAVSVASDL 151

Query: 170 CSI 172
            ++
Sbjct: 152 TAL 154

>Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265W
           (REAL)
          Length = 547

 Score = 35.4 bits (80), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 68/159 (42%), Gaps = 23/159 (14%)

Query: 6   MSTSSSTKDMISARKSNVDIGVGNVAELRSITSAHGAPIRYIDAKNATSDQQVLAEIGYK 65
           MS SS  K+ + A     D+      ++RS        + +       +D+  L + G K
Sbjct: 1   MSISSQDKEKVKATAYEADV---EDCDIRSTDETLKQGVLH-------NDRTKLKQ-GLK 49

Query: 66  EELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAGPVGLSWGWFVAGGLILTVGIALA 125
           E   +  + + +FG      GL  S   T+      GPVGL   +   G ++    IA+A
Sbjct: 50  ERHIKMLTLVGVFGT-----GLFLSSGGTLKK---TGPVGLLIAYLFVGIVVGCNQIAIA 101

Query: 126 ELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLS 164
           E++S +P  GA      Q+      +S+ ++ G++ T S
Sbjct: 102 EVASFMPATGATIRHAEQFID----ESVGFTFGWISTYS 136

>Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON}
           YPL265W (REAL)
          Length = 558

 Score = 35.0 bits (79), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 61/148 (41%), Gaps = 17/148 (11%)

Query: 17  SARKSNVDIGVGNVAELRSITSAHGAPIRYIDAKNATSDQQVLAEIGYKEELKREFSTLQ 76
           S  K    I   +V E   I S      R +   + T  +Q     G KE   +  + + 
Sbjct: 11  SQEKVKPKIYEEDVDEEHDIVSVEETVKRGVLHNDRTKLKQ-----GLKERHIKMLTLVG 65

Query: 77  IFGVAFSIMGLLPSIASTMDGGLYAGPVGLSWGWFVAGGLILTVGIALAELSSSIPTAGA 136
           +FG      GL  S   T+      GPVGL   +   G ++    IA+AE++S +P  GA
Sbjct: 66  VFGT-----GLFLSSGGTLKK---TGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGA 117

Query: 137 VYVSCYQWAPARWRKSISYSVGFLDTLS 164
                 Q+      +S+ ++ G++ T S
Sbjct: 118 TIRHAEQFID----ESVGFTFGWISTYS 141

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score = 34.7 bits (78), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 24/35 (68%)

Query: 101 AGPVGLSWGWFVAGGLILTVGIALAELSSSIPTAG 135
           AGP G+  GW +AG +I  + +++AEL+ + P AG
Sbjct: 117 AGPAGILIGWIIAGSMIYCMVMSVAELAIAFPVAG 151

>Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii AFR698C
          Length = 606

 Score = 34.7 bits (78), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 60/139 (43%), Gaps = 17/139 (12%)

Query: 1   MATGYMSTSSSTKDMI---SARKSNVDIGVGNVAELRS-ITSAHGAPIRYIDAKNATSDQ 56
           + +G + T S T +     S +KS+ +   G+  + R  + S   AP R        +DQ
Sbjct: 25  VKSGNVLTGSDTTEFFEKASVQKSDFEYFEGDETKFRRFVNSFKKAPGR-------ENDQ 77

Query: 57  QVLAEIGYKEELKREFSTLQIFGVAFSI---MGLLPSIASTMDGGLYAGPVGLSWGWFVA 113
           + L +    E+LK+      +  ++       GLL      +  G   GP GL+ G+FV 
Sbjct: 78  ESLQDNNKHEKLKQTIRPRHVVMISLGTGIGTGLLVGTGKALYNG---GPGGLAVGFFVM 134

Query: 114 GGLILTVGIALAELSSSIP 132
           G  +  V  A  E++ + P
Sbjct: 135 GTCVYCVIQAAGEMAVNYP 153

>KNAG0D04070 Chr4 (733476..735290) [1815 bp, 604 aa] {ON} Anc_4.195
           YGR055W
          Length = 604

 Score = 34.7 bits (78), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 34/156 (21%), Positives = 62/156 (39%), Gaps = 15/156 (9%)

Query: 253 NHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEARDAVRAVPI 312
           +H+F+NA   F  ++  T +       +N L   IW+   Y +  +   E +D VR + I
Sbjct: 241 SHNFHNA---FEGTDKATAYG-----IVNALYNVIWSFVGYSNVNYALGEVKDPVRTLKI 292

Query: 313 GIVGSIASCWILGWLICIVLLACMDPDLNNIINSPY--GQGITQVFYDALGKRWTLAFLS 370
               S+    ++   + I   A +  D   +++S          + +    KR   AF+ 
Sbjct: 293 AGPTSLVFLAVVYIFVNIAYFAVVPKD--KLVSSKLILAADFFDICFGGHAKRAAAAFVG 350

Query: 371 FMIICQFLMGASTVVANSRQFWAFARDDALPFSNFF 406
              +   +   S + +  R      R+  LPFS FF
Sbjct: 351 LSALGNVM---SVIFSQGRIIQQLGREGVLPFSKFF 383

>Suva_7.337 Chr7 (574716..576443) [1728 bp, 575 aa] {ON} YGR055W
           (REAL)
          Length = 575

 Score = 34.7 bits (78), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 61/156 (39%), Gaps = 15/156 (9%)

Query: 253 NHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEARDAVRAVPI 312
           +H+F NA   F  +E  T +       +N L   IW+   Y +  +   E ++ VR + I
Sbjct: 238 SHNFRNA---FEGTETATAYG-----IVNALYSVIWSFVGYSNVNYALGEVKNPVRTLKI 289

Query: 313 GIVGSIASCWILGWLICIVLLACMDPDLNNIINSPY--GQGITQVFYDALGKRWTLAFLS 370
               S+    I+   + I   A +  +   +I+S          + +    KR   A + 
Sbjct: 290 AGPTSMVFLAIVYIFVNIAYFAVVPKE--KLISSKLVLAADFFDIVFGGQAKRAAAALVG 347

Query: 371 FMIICQFLMGASTVVANSRQFWAFARDDALPFSNFF 406
              +   L   S + +  R      R+  LPFSNFF
Sbjct: 348 LSALGNVL---SVIFSQGRIIQQLGREGVLPFSNFF 380

>Smik_6.139 Chr6 (225355..227079) [1725 bp, 574 aa] {ON} YGR055W
           (REAL)
          Length = 574

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 61/156 (39%), Gaps = 15/156 (9%)

Query: 253 NHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEARDAVRAVPI 312
           +H+F NA   F  +E  T +       +N L   IW+   Y +  +   E ++ VR + I
Sbjct: 238 SHNFRNA---FEGTETATAYG-----IVNALYSVIWSFVGYSNVNYALGEVKNPVRTLKI 289

Query: 313 GIVGSIASCWILGWLICIVLLACMDPDLNNIINSPY--GQGITQVFYDALGKRWTLAFLS 370
               S+    I+   + I   A +  D   +++S          + +    KR   A + 
Sbjct: 290 AGPTSMVFLAIIYIFVNIAYFAVVPKD--KLVSSKLILAADFFDIVFGGHAKRAAAALVG 347

Query: 371 FMIICQFLMGASTVVANSRQFWAFARDDALPFSNFF 406
              +   L   S + +  R      R+  LPFS+FF
Sbjct: 348 LSALGNVL---SVIFSQGRIIQQLGREGVLPFSDFF 380

>KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly
           similar to uniprot|P53388 Saccharomyces cerevisiae
           YPL265W Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-
           glutamate and L-aspartate
          Length = 541

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 53/111 (47%), Gaps = 13/111 (11%)

Query: 54  SDQQVLAEIGYKEELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAGPVGLSWGWFVA 113
           +D+  L + G KE   +  + + +FG      GL  S   T+     AGP G+   + V 
Sbjct: 45  NDRTRLKQ-GLKERHIKMLTLVGVFGT-----GLFLSSGGTLKK---AGPAGMFLAYVVV 95

Query: 114 GGLILTVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLS 164
           G ++    IA+AE++S +P  GA      Q+      +S+ ++ G++ T S
Sbjct: 96  GIVVGCNQIAIAEVASFMPATGATIRHAEQFID----ESVGFTFGWISTYS 142

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 38/74 (51%), Gaps = 2/74 (2%)

Query: 101 AGPVGLSWGWFVAGGLILTVGIALAELSSSIPTAGA--VYVSCYQWAPARWRKSISYSVG 158
           AGP G+  GW + G +I  + +A+ EL+ + P AG    Y S +      +  +  Y++G
Sbjct: 109 AGPAGILIGWALTGTMIYCMVMAMGELAVTFPVAGGYTTYASRFVDESFGFAFNTVYAMG 168

Query: 159 FLDTLSLCASVCSI 172
           +L TL L     SI
Sbjct: 169 WLITLPLEIVAASI 182

>CAGL0K04367g Chr11 (413033..414781) [1749 bp, 582 aa] {ON} highly
           similar to uniprot|P50276 Saccharomyces cerevisiae
           YGR055w high-affinity methionine permease
          Length = 582

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 61/156 (39%), Gaps = 15/156 (9%)

Query: 253 NHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEARDAVRAVPI 312
           +H+F+NA   F  +   T +       +N L   IW+   Y +  +   E +D VR + I
Sbjct: 236 SHNFHNA---FEGTNKATAYG-----VVNALYNVIWSFVGYSNVNYALGEVKDPVRTLKI 287

Query: 313 GIVGSIASCWILGWLICIVLLACMDPDLNNIINSPY--GQGITQVFYDALGKRWTLAFLS 370
               S+    I+   + I   A +  +   +I+S          + +    KR   A + 
Sbjct: 288 AGPTSMVCLAIIYIFVNIAYFAVVPKE--KLISSKLILAADFFDICFGGHSKRVAAALVG 345

Query: 371 FMIICQFLMGASTVVANSRQFWAFARDDALPFSNFF 406
              +   +   S + +  R      R+  LPFSNFF
Sbjct: 346 LSALGNVM---SVIFSQGRIIQQLGREGVLPFSNFF 378

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 22/36 (61%)

Query: 101 AGPVGLSWGWFVAGGLILTVGIALAELSSSIPTAGA 136
           AGP G+  GW + G +I T+ +AL EL+   P +G 
Sbjct: 121 AGPAGILIGWSITGTMIFTMVMALGELAVMFPVSGG 156

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 22/36 (61%)

Query: 101 AGPVGLSWGWFVAGGLILTVGIALAELSSSIPTAGA 136
           AGP G+  GW + G +I T+ +AL EL+   P +G 
Sbjct: 121 AGPAGILIGWGITGTMIFTMVMALGELAVVFPVSGG 156

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 51/114 (44%), Gaps = 15/114 (13%)

Query: 31  AELRSITSAHG----APIRYIDAKNAT-SDQQVLAEIGYKEELKREFSTLQIFGVAFSIM 85
           +EL S+T A+      P    DA+ A   D+QV      K ELK+    +   G      
Sbjct: 52  SELASLTHAYSRSRVEPEHDEDAEEADYEDKQV------KRELKQRHIGMIALGGTIG-T 104

Query: 86  GLLPSIASTMDGGLYAGPVGLSWGWFVAGGLILTVGIALAELSSSIPTAGAVYV 139
           GL   IA+ +     AGPVG    +   G ++  V  AL E+++ IP   ++ V
Sbjct: 105 GLFVGIATPLAD---AGPVGALIAYIFMGSIVYFVTQALGEMATFIPVTSSITV 155

>TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {ON} 
          Length = 604

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 55/126 (43%), Gaps = 16/126 (12%)

Query: 43  PIRYIDAKNATSDQQV---LAEIGYKEELKREFSTLQIFGVAFS---IMGLLPSIASTMD 96
           P   +D    T D+Q+   LA   YK+ L +   T+   G        +GL  S+AS   
Sbjct: 66  PYSELDGDKYTKDEQIQMTLAAQPYKKSLHQRHLTMIAIGGTLGTGLFIGLGYSLAS--- 122

Query: 97  GGLYAGPVGLSWGWFVAGGLILTVGIALAELSSSIPTAG--AVYVSCYQWAPARWRKSIS 154
                GP  L  G+ + G  +  V  + AELS   P +G  A +VS +      +  S +
Sbjct: 123 -----GPASLLIGFLIVGTSMFCVVQSAAELSCQYPVSGSYATHVSRFLDESLGFTVSTN 177

Query: 155 YSVGFL 160
           Y++ +L
Sbjct: 178 YALAWL 183

>KNAG0B05820 Chr2 (1144434..1146164) [1731 bp, 576 aa] {ON}
           Anc_4.195 YGR055W
          Length = 576

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 34/159 (21%), Positives = 62/159 (38%), Gaps = 11/159 (6%)

Query: 248 RSDKLNHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEARDAV 307
           +++  +H+F+NA   F  + N T +       +N L   IW+   Y +  +   E ++ V
Sbjct: 227 KNNYQSHNFHNA---FEGTGNATAYG-----VVNALYNVIWSFIGYSNINYALGEVKNPV 278

Query: 308 RAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKRWTLA 367
           R++ I    S+    I+   + I   A +  +               + +    KR   A
Sbjct: 279 RSLRIAGPTSLIFLAIIYIFVNIAYFAVVPKETLRTSKLILVADFFDIVFGHRAKRAASA 338

Query: 368 FLSFMIICQFLMGASTVVANSRQFWAFARDDALPFSNFF 406
            +    +   L   S + A  R      R+  LPFS+FF
Sbjct: 339 IVGLSALGNVL---SVIFAQGRIIQQLGREGVLPFSSFF 374

>CAGL0B02838g Chr2 complement(274984..276693) [1710 bp, 569 aa] {ON}
           highly similar to uniprot|P50276 Saccharomyces
           cerevisiae YGR055w MUP1
          Length = 569

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 61/156 (39%), Gaps = 15/156 (9%)

Query: 253 NHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEARDAVRAVPI 312
           +H+F+NA   F  +   T +       +N L   IW+   Y +  +   E ++ VR + I
Sbjct: 225 SHNFHNA---FEGTNKATAYG-----VVNALYNVIWSFVGYSNVNYALGEVKNPVRTLKI 276

Query: 313 GIVGSIASCWILGWLICIVLLACMDPDLNNIINSPY--GQGITQVFYDALGKRWTLAFLS 370
               S+    I+   + I   A +  D   +I+S          + +    KR   A + 
Sbjct: 277 AGPTSLICLAIIYIFVNIAYFAVVPKD--KLISSKLILAADFFDICFGGHAKRVAAALVG 334

Query: 371 FMIICQFLMGASTVVANSRQFWAFARDDALPFSNFF 406
              +   +   S + +  R      R+  LPFSNFF
Sbjct: 335 LSALGNVM---SVIFSQGRIIQQLGREGVLPFSNFF 367

>Kpol_1042.14 s1042 (34979..36739) [1761 bp, 586 aa] {ON}
           (34979..36739) [1761 nt, 587 aa]
          Length = 586

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 33/157 (21%), Positives = 58/157 (36%), Gaps = 10/157 (6%)

Query: 252 LNHSFNNAKF--IFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEARDAVRA 309
           L H +    F   F  +EN T +       +N L   IW+   Y +  +   E +D VR 
Sbjct: 229 LKHGYKTDNFHNAFEGTENATAYG-----IVNALYNVIWSFVGYSNVNYALGEVKDPVRT 283

Query: 310 VPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKRWTLAFL 369
           + I    S+    I+   + I   A +  +               + + + GK+   A +
Sbjct: 284 LKIAGPTSMVFVAIIYIFVNIAYFAVVPKETLRSSKLILAADFFDIVFGSSGKKAASAIV 343

Query: 370 SFMIICQFLMGASTVVANSRQFWAFARDDALPFSNFF 406
               +   +   + V +  R      R+  LPFS+FF
Sbjct: 344 GLSALGNVM---AVVFSQGRIIQQLGREGVLPFSSFF 377

>Ecym_2450 Chr2 (875875..877563) [1689 bp, 562 aa] {ON} similar to
           Ashbya gossypii ABL003C
          Length = 562

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 58/147 (39%), Gaps = 8/147 (5%)

Query: 265 KSENFTDWNGGWS-----WCINGLTPAIWTIGAYDSCLHMAEEARDAVRAVPIGIVGSIA 319
           K++NF D   G         +N L   IW+   Y +  +   E R+ V+ + +    S+ 
Sbjct: 220 KTDNFHDAFSGTESATAYGVVNALYNVIWSFVGYSNVNYALGEVRNPVKTLKVAGPISLI 279

Query: 320 SCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKRWTLAFLSFMIICQFLM 379
              +L   + I   A +  +   II S       + F  A G+R   A   F+ +     
Sbjct: 280 VLAVLYMFVNIAYFAVVPRE--TIIGSELTLA-AEFFRIAFGERAKKAAAIFIALSALGN 336

Query: 380 GASTVVANSRQFWAFARDDALPFSNFF 406
            +S + +  R      R+  LPFS FF
Sbjct: 337 VSSVIFSQGRIIQQLGREGVLPFSGFF 363

>Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON}
           YPL265W (REAL)
          Length = 496

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 56/124 (45%), Gaps = 18/124 (14%)

Query: 47  IDAKNATSDQQVL------AEIGYKEELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLY 100
           ++  + T+ Q VL       + G KE   +  + + +FG      GL  S   T+     
Sbjct: 29  LECGSETAKQGVLYNDRTRLKQGLKERHIKMLTLVGVFGT-----GLFLSSGGTLKK--- 80

Query: 101 AGPVGLSWGWFVAGGLILTVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFL 160
            GPVGL   +   G ++    IA+AE++S +P  GA      Q+      +S+ ++ G++
Sbjct: 81  IGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIRHAEQFID----ESVGFTFGWI 136

Query: 161 DTLS 164
            T S
Sbjct: 137 STYS 140

>NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 24/123 (19%), Positives = 59/123 (47%), Gaps = 6/123 (4%)

Query: 53  TSDQQVLAEIGYKEELKREFSTLQIFGVAFSIM---GLLPSIASTMDGGLYAGPVGLSWG 109
           T+++    E   +E+L+R      I  ++ + +   GL  S A ++  G   GP  L   
Sbjct: 39  TTEEDYDPEANIREDLQRALKPRHINMISIAGVIGTGLYLSTAKSLYQG---GPASLFMN 95

Query: 110 WFVAGGLILTVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASV 169
           + + GG++    + L E+S+ +P +G+      ++    +  ++ ++  F D +S+ + +
Sbjct: 96  YTIMGGVVYLTLLCLGEMSTYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVSVASDM 155

Query: 170 CSI 172
            ++
Sbjct: 156 TAL 158

>KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}
           YFL055W
          Length = 571

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 28/150 (18%), Positives = 65/150 (43%), Gaps = 19/150 (12%)

Query: 32  ELRSITSAHGAPIRYIDAKNATSDQQVLAEIGYKEELKREFSTLQIFGVAFSIMGLLPSI 91
           +++++ S H   +  + +  +        E   +E+LKR+ S   I  +         SI
Sbjct: 33  KVKAVYSTHSV-LEGVHSLESIESASFDPESNIREDLKRDLSPRHINMI---------SI 82

Query: 92  ASTMDGGLY---------AGPVGLSWGWFVAGGLILTVGIALAELSSSIPTAGAVYVSCY 142
           A  +  GLY          GP  L   + + GG++    + L E+S+ +P +G+      
Sbjct: 83  AGVIGTGLYLSTSKSLHVGGPASLFMNYSIFGGVVYLTMMCLGEMSTYMPISGSFCSYAK 142

Query: 143 QWAPARWRKSISYSVGFLDTLSLCASVCSI 172
           ++    +  ++ ++  F D +S+ + + ++
Sbjct: 143 KFGSESFACALMWNYWFNDAVSVASDLTAL 172

>KAFR0A06250 Chr1 complement(1262105..1263832) [1728 bp, 575 aa]
           {ON} Anc_4.195 YGR055W
          Length = 575

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 63/156 (40%), Gaps = 15/156 (9%)

Query: 253 NHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEARDAVRAVPI 312
           +H+F+NA   F  +EN + +       +  L   IW+   Y +  +   E ++ VR + +
Sbjct: 234 SHNFHNA---FDGTENASAYG-----IVTALYNVIWSYVGYSNVNYALGEVKNPVRTLKL 285

Query: 313 GIVGSIASCWILGWLICIVLLACMDPDLNNIINSPY--GQGITQVFYDALGKRWTLAFLS 370
               S+    I+   + I   A +  D   +++S          + +    ++   AF+ 
Sbjct: 286 AGPTSLIFITIIYIFVNIAYFAVVPKD--KLVSSKLVLAADFFDIVFGGNARKAAAAFVG 343

Query: 371 FMIICQFLMGASTVVANSRQFWAFARDDALPFSNFF 406
              +   L   S + +  R      R+  LPFSNFF
Sbjct: 344 LSALGNVL---SVIFSQGRIIQQLGREGVLPFSNFF 376

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 45/93 (48%), Gaps = 6/93 (6%)

Query: 47  IDAKNATSDQQVLAEIGYKEELKREFST--LQIFGVAFSI-MGLLPSIASTMDGGLYAGP 103
           +D     +D Q +A +  +  L+R+     LQ+  +  +I  GL    +  +     AGP
Sbjct: 63  VDLDPNLTDAQKIAILTSQSPLQRKLKNRHLQMIAIGGAIGTGLFIGSSKALRT---AGP 119

Query: 104 VGLSWGWFVAGGLILTVGIALAELSSSIPTAGA 136
            G+  GW +   +IL + ++L E++ + P +G 
Sbjct: 120 AGILIGWGLMATMILCMCLSLGEMAVTFPVSGG 152

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 46/100 (46%), Gaps = 7/100 (7%)

Query: 44  IRYIDAKNATSDQQVLAEIG-YKEELKREFSTLQIFGVAFSIM---GLLPSIASTMDGGL 99
           I+  DA + T D+++L     +  E+KRE     I  +A       GL   I++ ++   
Sbjct: 37  IQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLED-- 94

Query: 100 YAGPVGLSWGWFVAGGLILTVGIALAELSSSIPTAGAVYV 139
            +GPVG    +   G L   V  +L E+++ IP   +  V
Sbjct: 95  -SGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTV 133

>Ecym_7299 Chr7 (630846..632495) [1650 bp, 549 aa] {ON} similar to
           Ashbya gossypii AGL026W
          Length = 549

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 10/62 (16%)

Query: 47  IDAKNATSDQQVLAEIG-YKEELKREFSTLQIFGVAFS---------IMGLLPSIASTMD 96
           +D   + +D++VL E   YK  +K  FS L+++G+AF+         +    PS+  T++
Sbjct: 308 MDVGESDNDKEVLKEHNSYKFAIKLAFSDLKVWGIAFTVSLLVAASGVQNFFPSVVGTLN 367

Query: 97  GG 98
            G
Sbjct: 368 YG 369

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 57/132 (43%), Gaps = 11/132 (8%)

Query: 10  SSTKDMISARKSNVDIGVGNVAELRSITS--AHGAPIRYIDAKNATSDQQVLAEIGYKEE 67
           SS K  I+ RKS +      +  L S ++   HG    + D ++ T + Q   +   K  
Sbjct: 53  SSDKPPITLRKSKLS----EIGSLHSGSNLHQHGTTSLHDDEESDTEEAQ-YQDTRVKRA 107

Query: 68  LKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAGPVGLSWGWFVAGGLILTVGIALAEL 127
           LK+    +   G      GL   IA+ +     AGPVG    +   G ++  V  +L E+
Sbjct: 108 LKQRHIGMIALGGTIG-TGLFVGIATPLSN---AGPVGSLIAYIFMGSVVYFVTQSLGEM 163

Query: 128 SSSIPTAGAVYV 139
           ++ IP   ++ V
Sbjct: 164 ATFIPVTSSITV 175

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 6/85 (7%)

Query: 54  SDQQVLAEIGYKEELKREFST--LQIFGVAFSI-MGLLPSIASTMDGGLYAGPVGLSWGW 110
           +D + +A +     LKR   +  LQ+  +  +I  GL       +     AGP G+  GW
Sbjct: 62  TDAEKMAILTANAPLKRTLKSRHLQMIAIGGAIGTGLFVGSGKALAT---AGPAGILIGW 118

Query: 111 FVAGGLILTVGIALAELSSSIPTAG 135
            + G +I  + +A+ EL+ + P AG
Sbjct: 119 ALTGTMIYCMVMAMGELAVTFPIAG 143

>TPHA0B01060 Chr2 complement(241062..242822) [1761 bp, 586 aa] {ON}
           Anc_4.195 YGR055W
          Length = 586

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 32/152 (21%), Positives = 57/152 (37%), Gaps = 11/152 (7%)

Query: 255 SFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEARDAVRAVPIGI 314
           +F+NA   F  +EN T +       +N L   IW+   Y +  +   E ++ VR + I  
Sbjct: 236 NFHNA---FAGTENATAYG-----VVNALYNVIWSFVGYSNVNYALGEVKNPVRTLKIAG 287

Query: 315 VGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKRWTLAFLSFMII 374
             S+    I+   + I   A +  +               + +   GK+     +    +
Sbjct: 288 PTSMVFVSIIYIFVNIAYFAVVPKETLKSSKLVLAADFFDIVFGESGKKAASVIVGLSAL 347

Query: 375 CQFLMGASTVVANSRQFWAFARDDALPFSNFF 406
              L   S + +  R      R+  LPFS+FF
Sbjct: 348 GNVL---SVIFSQGRIIQQLGREGVLPFSSFF 376

>CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar to
           uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1 or
           uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
          Length = 550

 Score = 31.6 bits (70), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 36/170 (21%), Positives = 74/170 (43%), Gaps = 23/170 (13%)

Query: 6   MSTSSSTKDMISARKSNVDIGVGNVAELRSITSAHGAPIRYIDAKNATSDQQVLAEIGYK 65
           MS+S S ++ +      VD G   + E+ S           +D     SD     E   +
Sbjct: 1   MSSSISDREAV-----KVDSGKQEIYEVSS----------SLDIDELRSDFD--PEQNIR 43

Query: 66  EELKREFSTLQIFGVAFSIM---GLLPSIASTMDGGLYAGPVGLSWGWFVAGGLILTVGI 122
           E+L R  S   I  ++ + +   GL  S A ++  G   GP  L   + + GG++    +
Sbjct: 44  EDLTRALSPRHINMISIAGIIGTGLYLSTAKSLHNG---GPASLFMNYTIIGGVVYLTML 100

Query: 123 ALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSI 172
            L E+S+ +P +G+      ++    +  ++ ++  F D +S+ + + ++
Sbjct: 101 CLGEMSTFMPISGSFCSYARKFGSESFACALMWNYWFNDAVSVASDLTAL 150

>Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score = 31.6 bits (70), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 32/147 (21%), Positives = 63/147 (42%), Gaps = 12/147 (8%)

Query: 1   MATGYMSTSSSTKDMISARKSNVDIGVGNVAELRSITSAHGAPIRYIDAKNATSDQQVLA 60
           MA  ++S+     + +  RKS  +  VG  ++  + +S+H +   + D  +  S++ +  
Sbjct: 1   MAEDFISSVKYPSEELKERKSTSEF-VGYKSKQLTSSSSHNSDTSHHDDNHQYSNRNIFQ 59

Query: 61  EI--GYKEELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLY---------AGPVGLSWG 109
                +K  L   F T  +         ++ +I  ++  GL+          GP+G+  G
Sbjct: 60  RCVDSFKPPLDGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLG 119

Query: 110 WFVAGGLILTVGIALAELSSSIPTAGA 136
           W +AG  I+     L E++   P  GA
Sbjct: 120 WTIAGSQIIGTIHGLGEITVRFPVVGA 146

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score = 31.6 bits (70), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 40/87 (45%), Gaps = 6/87 (6%)

Query: 54  SDQQVLAEIGYKEELK-REFSTLQIFGVAFSIMGLLPSIASTMDGGLYAGPVGLSWGWFV 112
            D++ L      ++L  R   TL + G   +  GL  +  S+++ G   GP  L  GW +
Sbjct: 131 KDEETLLATDMNKDLSVRHLLTLAVGGAIGT--GLFVNSGSSLNTG---GPASLVIGWVI 185

Query: 113 AGGLILTVGIALAELSSSIPTAGAVYV 139
               + TV  +L EL+++ P  G   V
Sbjct: 186 VSTALFTVINSLGELAAAFPVVGGFSV 212

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score = 31.2 bits (69), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 49/105 (46%), Gaps = 8/105 (7%)

Query: 41  GAPIRYIDAKNATSDQQVLAEIGYKEELK-REFSTLQIFGVAFSIMGLLPSIASTMDGGL 99
           G+  + ++  ++TS +    +  Y ++L  R   TL + G   +  GL  +  + +  G 
Sbjct: 49  GSETKALENLDSTSQEVEDQDARYNKDLSVRHLLTLAVGGAIGT--GLFVNSGAALTTG- 105

Query: 100 YAGPVGLSWGWFVAGGLILTVGIALAELSSSIPTAGA--VYVSCY 142
             GP  L   W +    + T+  AL ELSS+ P  G   VY+S +
Sbjct: 106 --GPGSLVIDWVIISTCLFTIVNALGELSSTFPVVGGFNVYISRF 148

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score = 31.2 bits (69), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 22/36 (61%)

Query: 101 AGPVGLSWGWFVAGGLILTVGIALAELSSSIPTAGA 136
           AGP G+  GW V G +I ++ +A+ EL+   P +G 
Sbjct: 120 AGPAGILIGWTVTGTMIYSMVMAVGELAVVFPVSGG 155

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.137    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,830,871
Number of extensions: 2174685
Number of successful extensions: 6855
Number of sequences better than 10.0: 160
Number of HSP's gapped: 6768
Number of HSP's successfully gapped: 168
Length of query: 578
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 463
Effective length of database: 40,294,809
Effective search space: 18656496567
Effective search space used: 18656496567
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 68 (30.8 bits)