Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E14784gsingletonON72723803e-49
CAGL0K08976g8.702ON79344700.093
NCAS0D01210singletonON87654630.91
Skud_15.1955.622ON61540584.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E14784g
         (72 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E14784g Chr5 (1221254..1221472) [219 bp, 72 aa] {ON} no sim...   150   3e-49
CAGL0K08976g Chr11 (896389..898770) [2382 bp, 793 aa] {ON} simil...    32   0.093
NCAS0D01210 Chr4 (220793..223423) [2631 bp, 876 aa] {ON}               29   0.91 
Skud_15.195 Chr15 (346693..348540) [1848 bp, 615 aa] {ON} YOR030...    27   4.6  

>SAKL0E14784g Chr5 (1221254..1221472) [219 bp, 72 aa] {ON} no
          similarity
          Length = 72

 Score =  150 bits (380), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 72/72 (100%), Positives = 72/72 (100%)

Query: 1  MHEYERADQNITVMISCVTGAFMKQDTFSTAAKLTTDLLSFQTLCTNGSTMPEFSNVKVT 60
          MHEYERADQNITVMISCVTGAFMKQDTFSTAAKLTTDLLSFQTLCTNGSTMPEFSNVKVT
Sbjct: 1  MHEYERADQNITVMISCVTGAFMKQDTFSTAAKLTTDLLSFQTLCTNGSTMPEFSNVKVT 60

Query: 61 VLWKLPVLSIKN 72
          VLWKLPVLSIKN
Sbjct: 61 VLWKLPVLSIKN 72

>CAGL0K08976g Chr11 (896389..898770) [2382 bp, 793 aa] {ON} similar
           to uniprot|Q08693 Saccharomyces cerevisiae YOR256c
          Length = 793

 Score = 31.6 bits (70), Expect = 0.093,   Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 21/44 (47%)

Query: 15  ISCVTGAFMKQDTFSTAAKLTTDLLSFQTLCTNGSTMPEFSNVK 58
           +S   G+F   D F   A+LT DL  F+      S+MP  S  K
Sbjct: 151 VSGTRGSFADHDAFLNYARLTADLSKFERDLEYLSSMPHMSGTK 194

>NCAS0D01210 Chr4 (220793..223423) [2631 bp, 876 aa] {ON} 
          Length = 876

 Score = 28.9 bits (63), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 27/54 (50%), Gaps = 7/54 (12%)

Query: 20  GAFMKQDTFSTAAKLTTDLLSFQTLCTNGSTMPEFSNVKVTVLWKLPVL-SIKN 72
           G F+++D F     LT  LL FQ++C         SN   TV   LP+L S KN
Sbjct: 537 GGFLEEDDFILIEDLTEILLPFQSVCE------MLSNDACTVKSTLPLLVSYKN 584

>Skud_15.195 Chr15 (346693..348540) [1848 bp, 615 aa] {ON} YOR030W
           (REAL)
          Length = 615

 Score = 26.9 bits (58), Expect = 4.6,   Method: Composition-based stats.
 Identities = 13/40 (32%), Positives = 19/40 (47%)

Query: 18  VTGAFMKQDTFSTAAKLTTDLLSFQTLCTNGSTMPEFSNV 57
           +TG F+  +  S     T +  SF   C NG   P FS++
Sbjct: 93  LTGGFISLELPSLVYNYTLNYPSFLIRCDNGGVNPNFSHI 132

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.128    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,968,235
Number of extensions: 205534
Number of successful extensions: 462
Number of sequences better than 10.0: 4
Number of HSP's gapped: 462
Number of HSP's successfully gapped: 4
Length of query: 72
Length of database: 53,481,399
Length adjustment: 45
Effective length of query: 27
Effective length of database: 48,321,429
Effective search space: 1304678583
Effective search space used: 1304678583
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 59 (27.3 bits)