Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E10934g2.153ON1131135871e-79
KLTH0B05148g2.153ON1111074265e-55
Kwal_33.147762.153ON1111134222e-54
KLLA0F24024g2.153ON1221084135e-53
CAGL0I02728g2.153ON111994056e-52
Ecym_82052.153ON1141153832e-48
ZYRO0G06534g2.153ON1121003787e-48
ABR130W2.153ON111993632e-45
NDAI0B043302.153ON127963642e-45
Kpol_505.202.153ON1121133562e-44
Skud_8.1772.153ON1301153563e-44
Suva_15.3132.153ON132933503e-43
Smik_8.1942.153ON129933478e-43
YHR116W (COX23)2.153ON151933462e-42
KAFR0F007302.153ON1081003414e-42
TDEL0B051502.153ON119923414e-42
TPHA0F018702.153ON180953283e-39
KNAG0H035202.153ON109993162e-38
NCAS0B070002.153ON108912936e-35
TBLA0B012402.153ON119931948e-20
Suva_10.665.205ON7226700.094
Smik_12.545.205ON6926611.8
YLL009C (COX17)5.205ON6926602.2
Ecym_82875.205ON5826584.3
Kpol_1036.1048.370ON68725615.5
Kpol_2002.1035.205ON6326576.0
KAFR0D018505.205ON6327567.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E10934g
         (113 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E10934g Chr5 (916050..916391) [342 bp, 113 aa] {ON} highly ...   230   1e-79
KLTH0B05148g Chr2 (426037..426372) [336 bp, 111 aa] {ON} similar...   168   5e-55
Kwal_33.14776 s33 complement(812440..812775) [336 bp, 111 aa] {O...   167   2e-54
KLLA0F24024g Chr6 (2239420..2239788) [369 bp, 122 aa] {ON} simil...   163   5e-53
CAGL0I02728g Chr9 complement(242221..242556) [336 bp, 111 aa] {O...   160   6e-52
Ecym_8205 Chr8 complement(422048..422392) [345 bp, 114 aa] {ON} ...   152   2e-48
ZYRO0G06534g Chr7 complement(518228..518566) [339 bp, 112 aa] {O...   150   7e-48
ABR130W Chr2 (641041..641376) [336 bp, 111 aa] {ON} Syntenic hom...   144   2e-45
NDAI0B04330 Chr2 (1087146..1087529) [384 bp, 127 aa] {ON} Anc_2....   144   2e-45
Kpol_505.20 s505 (55992..56330) [339 bp, 112 aa] {ON} (55992..56...   141   2e-44
Skud_8.177 Chr8 (315505..315897) [393 bp, 130 aa] {ON} YHR116W (...   141   3e-44
Suva_15.313 Chr15 (544054..544452) [399 bp, 132 aa] {ON} YHR116W...   139   3e-43
Smik_8.194 Chr8 (318092..318481) [390 bp, 129 aa] {ON} YHR116W (...   138   8e-43
YHR116W Chr8 (341665..342120) [456 bp, 151 aa] {ON}  COX23Mitoch...   137   2e-42
KAFR0F00730 Chr6 complement(143260..143586) [327 bp, 108 aa] {ON...   135   4e-42
TDEL0B05150 Chr2 complement(906670..907029) [360 bp, 119 aa] {ON...   135   4e-42
TPHA0F01870 Chr6 (427543..428085) [543 bp, 180 aa] {ON} Anc_2.15...   130   3e-39
KNAG0H03520 Chr8 (656843..657172) [330 bp, 109 aa] {ON} Anc_2.15...   126   2e-38
NCAS0B07000 Chr2 (1331938..1332264) [327 bp, 108 aa] {ON} Anc_2....   117   6e-35
TBLA0B01240 Chr2 complement(262962..263321) [360 bp, 119 aa] {ON...    79   8e-20
Suva_10.66 Chr10 complement(136168..136383) [216 bp, 72 aa] {ON}...    32   0.094
Smik_12.54 Chr12 complement(118226..118432) [207 bp, 69 aa] {ON}...    28   1.8  
YLL009C Chr12 complement(131205..131414) [210 bp, 69 aa] {ON}  C...    28   2.2  
Ecym_8287 Chr8 (585041..585217) [177 bp, 58 aa] {ON} similar to ...    27   4.3  
Kpol_1036.104 s1036 (268670..270733) [2064 bp, 687 aa] {ON} (268...    28   5.5  
Kpol_2002.103 s2002 complement(245135..245326) [192 bp, 63 aa] {...    27   6.0  
KAFR0D01850 Chr4 complement(371230..371421) [192 bp, 63 aa] {ON}...    26   7.7  

>SAKL0E10934g Chr5 (916050..916391) [342 bp, 113 aa] {ON} highly
           similar to gnl|GLV|CAGL0I02728g Candida glabrata
           CAGL0I02728g and similar to YHR116W uniprot|P38824
           Saccharomyces cerevisiae YHR116W COX23 Mitochondrial
           intermembrane space protein that functions in
           mitochondrial copper homeostasis essential for
           functional cytochrome oxidase expression homologous to
           Cox17p
          Length = 113

 Score =  230 bits (587), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 113/113 (100%), Positives = 113/113 (100%)

Query: 1   MSNESQKVEPAPENSDPQLETDKEKVNFTPQANDTSSFKFYPDNPESTLNKFRFAAKDPS 60
           MSNESQKVEPAPENSDPQLETDKEKVNFTPQANDTSSFKFYPDNPESTLNKFRFAAKDPS
Sbjct: 1   MSNESQKVEPAPENSDPQLETDKEKVNFTPQANDTSSFKFYPDNPESTLNKFRFAAKDPS 60

Query: 61  RYFDPCQESSKMSFKCLEMNNYDRDMCKEYFDAYRECKKQWLQSRRENRSQWE 113
           RYFDPCQESSKMSFKCLEMNNYDRDMCKEYFDAYRECKKQWLQSRRENRSQWE
Sbjct: 61  RYFDPCQESSKMSFKCLEMNNYDRDMCKEYFDAYRECKKQWLQSRRENRSQWE 113

>KLTH0B05148g Chr2 (426037..426372) [336 bp, 111 aa] {ON} similar to
           uniprot|P38824 Saccharomyces cerevisiae YHR116W COX23
           Mitochondrial intermembrane space protein that functions
           in mitochondrial copper homeostasis essential for
           functional cytochrome oxidase expression homologous to
           Cox17p
          Length = 111

 Score =  168 bits (426), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 78/107 (72%), Positives = 93/107 (86%), Gaps = 1/107 (0%)

Query: 7   KVEPAPENSDPQLETDKEKVNFTPQANDTSSFKFYPDNPESTLNKFRFAAKDPSRYFDPC 66
           K  PA EN+DPQL+ DK KV++ P+  ++ SFKFYPDNPES+ NK+RFAAKD S+++DPC
Sbjct: 6   KTAPA-ENADPQLQVDKTKVDYAPKNTESGSFKFYPDNPESSFNKYRFAAKDASQFYDPC 64

Query: 67  QESSKMSFKCLEMNNYDRDMCKEYFDAYRECKKQWLQSRRENRSQWE 113
           QESSKMS KCLE+NNYDR MC+EYFDAYRECKKQWLQ+RR NRSQWE
Sbjct: 65  QESSKMSMKCLELNNYDRSMCQEYFDAYRECKKQWLQARRRNRSQWE 111

>Kwal_33.14776 s33 complement(812440..812775) [336 bp, 111 aa] {ON}
           YHR116W - Hypothetical ORF [contig 101] FULL
          Length = 111

 Score =  167 bits (422), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 79/113 (69%), Positives = 97/113 (85%), Gaps = 2/113 (1%)

Query: 1   MSNESQKVEPAPENSDPQLETDKEKVNFTPQANDTSSFKFYPDNPESTLNKFRFAAKDPS 60
           M+ E+Q  +PA EN+DPQL+ DK K+++ PQ     S+KFYPDNPES+ NKFRFAAKD S
Sbjct: 1   MAEENQ-TKPA-ENADPQLQVDKSKIDYAPQDAKAGSYKFYPDNPESSFNKFRFAAKDVS 58

Query: 61  RYFDPCQESSKMSFKCLEMNNYDRDMCKEYFDAYRECKKQWLQSRRENRSQWE 113
           +++DPCQESSKMS KCLE+N+YDR MC+EYFDAYRECKKQWLQ+RR+NRSQWE
Sbjct: 59  QFYDPCQESSKMSMKCLELNDYDRSMCQEYFDAYRECKKQWLQARRKNRSQWE 111

>KLLA0F24024g Chr6 (2239420..2239788) [369 bp, 122 aa] {ON} similar
           to uniprot|P38824 Saccharomyces cerevisiae YHR116W COX23
           Mitochondrial intermembrane space protein that functions
           in mitochondrial copper homeostasis essential for
           functional cytochrome oxidase expression homologous to
           Cox17p
          Length = 122

 Score =  163 bits (413), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 74/108 (68%), Positives = 89/108 (82%)

Query: 6   QKVEPAPENSDPQLETDKEKVNFTPQANDTSSFKFYPDNPESTLNKFRFAAKDPSRYFDP 65
           Q+ E   EN DP LE +K KVNFTP+  D +++KFYPD+PESTLN++RFA K  S Y+DP
Sbjct: 15  QQPEKVAENVDPSLELNKTKVNFTPEKTDVNTYKFYPDDPESTLNRYRFAVKGASEYYDP 74

Query: 66  CQESSKMSFKCLEMNNYDRDMCKEYFDAYRECKKQWLQSRRENRSQWE 113
           CQESSKMSFKCLE+NNYDRD+C +YFDAYRECKKQWL++RRE R  WE
Sbjct: 75  CQESSKMSFKCLELNNYDRDLCHDYFDAYRECKKQWLKARREKREFWE 122

>CAGL0I02728g Chr9 complement(242221..242556) [336 bp, 111 aa] {ON}
           similar to uniprot|P38824 Saccharomyces cerevisiae
           YHR116w
          Length = 111

 Score =  160 bits (405), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 68/99 (68%), Positives = 89/99 (89%)

Query: 14  NSDPQLETDKEKVNFTPQANDTSSFKFYPDNPESTLNKFRFAAKDPSRYFDPCQESSKMS 73
           N DP ++TDK+KV++ P+  DT+ +++YPDNPESTLNK+RFA KD S+Y+DPCQES+KMS
Sbjct: 12  NYDPHVQTDKDKVDYAPKGVDTTEYRYYPDNPESTLNKYRFAMKDHSQYYDPCQESAKMS 71

Query: 74  FKCLEMNNYDRDMCKEYFDAYRECKKQWLQSRRENRSQW 112
           FKCLE+N+YDRD CKEYFDAYRECKKQWL++RR++R+ W
Sbjct: 72  FKCLELNDYDRDQCKEYFDAYRECKKQWLEARRKDRTNW 110

>Ecym_8205 Chr8 complement(422048..422392) [345 bp, 114 aa] {ON}
           similar to Ashbya gossypii ABR130W
          Length = 114

 Score =  152 bits (383), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 94/115 (81%), Gaps = 3/115 (2%)

Query: 1   MSNESQKVEPAPENSDPQ--LETDKEKVNFTPQANDTSSFKFYPDNPESTLNKFRFAAKD 58
           MS E  K +  P  S P+  + TDK KVNFTP +NDTS+F+FYPD+PE+TLN+F+F +K 
Sbjct: 1   MSKEPPK-DHIPSQSPPKGNVVTDKTKVNFTPTSNDTSTFQFYPDDPEATLNRFKFYSKG 59

Query: 59  PSRYFDPCQESSKMSFKCLEMNNYDRDMCKEYFDAYRECKKQWLQSRRENRSQWE 113
            S Y+DPC+ESSKMSFKCLE+NNYDR +C +YFDAYRECKKQWL++RRE+ S+W+
Sbjct: 60  ASMYYDPCEESSKMSFKCLELNNYDRSLCHDYFDAYRECKKQWLKARREDNSKWQ 114

>ZYRO0G06534g Chr7 complement(518228..518566) [339 bp, 112 aa] {ON}
           similar to uniprot|P38824 Saccharomyces cerevisiae
           YHR116W COX23 Mitochondrial intermembrane space protein
           that functions in mitochondrial
          Length = 112

 Score =  150 bits (378), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 84/100 (84%)

Query: 14  NSDPQLETDKEKVNFTPQANDTSSFKFYPDNPESTLNKFRFAAKDPSRYFDPCQESSKMS 73
           N DPQL  + +KV++ PQ +    F++YPD PES+L+++RFA KD S+YFDPCQESS+MS
Sbjct: 13  NLDPQLVVEPKKVDYAPQGDSPDKFQYYPDKPESSLSRYRFAVKDASQYFDPCQESSRMS 72

Query: 74  FKCLEMNNYDRDMCKEYFDAYRECKKQWLQSRRENRSQWE 113
           F CL+ NNYDR+MCKEYFDAYRECKKQWL++RRENRS WE
Sbjct: 73  FNCLDRNNYDREMCKEYFDAYRECKKQWLRARRENRSLWE 112

>ABR130W Chr2 (641041..641376) [336 bp, 111 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR116W
          Length = 111

 Score =  144 bits (363), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 67/99 (67%), Positives = 81/99 (81%), Gaps = 1/99 (1%)

Query: 14  NSDPQLETDKEKVNFTPQANDTSSFKFYPDNPESTLNKFRFAAKDPSRYFDPCQESSKMS 73
           N DP ++TD+  VNFTP + D SSF+FYPDN ES L ++R AAK PS+Y DPCQES+ MS
Sbjct: 13  NPDPSVQTDRAAVNFTP-STDASSFQFYPDNLESPLARYRXAAKGPSQYXDPCQESANMS 71

Query: 74  FKCLEMNNYDRDMCKEYFDAYRECKKQWLQSRRENRSQW 112
            KCLE NNYDRD+C+EYFDAYRECKKQWL +RR++ SQW
Sbjct: 72  MKCLERNNYDRDLCREYFDAYRECKKQWLSARRKDNSQW 110

>NDAI0B04330 Chr2 (1087146..1087529) [384 bp, 127 aa] {ON} Anc_2.153
           YHR116W
          Length = 127

 Score =  144 bits (364), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 65/96 (67%), Positives = 78/96 (81%)

Query: 18  QLETDKEKVNFTPQANDTSSFKFYPDNPESTLNKFRFAAKDPSRYFDPCQESSKMSFKCL 77
           Q  T K+ VNFTP   DTS+FK+YPD+PE  +NK++F  KD S Y+DPCQESS+MSFKCL
Sbjct: 31  QQNTTKDTVNFTPDEKDTSTFKYYPDDPEEGMNKYKFMMKDTSEYYDPCQESSQMSFKCL 90

Query: 78  EMNNYDRDMCKEYFDAYRECKKQWLQSRRENRSQWE 113
           + NN+DRD C EYFDAYRECKKQWL +RR NRSQW+
Sbjct: 91  DRNNFDRDKCHEYFDAYRECKKQWLMARRNNRSQWQ 126

>Kpol_505.20 s505 (55992..56330) [339 bp, 112 aa] {ON}
           (55992..56330) [339 nt, 113 aa]
          Length = 112

 Score =  141 bits (356), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 86/113 (76%), Gaps = 1/113 (0%)

Query: 1   MSNESQKVEPAPENSDPQLETDKEKVNFTPQANDTSSFKFYPDNPESTLNKFRFAAKDPS 60
           MS ES+    +P   D  LETDK KV+F  + +D    KFYPDNPESTL K+RF  K+ S
Sbjct: 1   MSKESKDKLDSPSALDSTLETDKSKVDFANK-DDKKDLKFYPDNPESTLAKYRFITKETS 59

Query: 61  RYFDPCQESSKMSFKCLEMNNYDRDMCKEYFDAYRECKKQWLQSRRENRSQWE 113
           +Y+DPCQES++MSF CL+ NNYD+  C+ YFDAYRECKKQWL++RR++RSQWE
Sbjct: 60  QYYDPCQESAQMSFNCLDRNNYDKSKCRAYFDAYRECKKQWLRARRQDRSQWE 112

>Skud_8.177 Chr8 (315505..315897) [393 bp, 130 aa] {ON} YHR116W
           (REAL)
          Length = 130

 Score =  141 bits (356), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 90/115 (78%), Gaps = 3/115 (2%)

Query: 2   SNESQKVEPAPENSDPQLE---TDKEKVNFTPQANDTSSFKFYPDNPESTLNKFRFAAKD 58
            + S  +EP+P  ++P      TD+ KVN+ P+ ND SSF++YPD+PE+ +NK++FA K 
Sbjct: 16  GSSSINLEPSPPLAEPAPRGPITDRTKVNYVPKNNDPSSFQYYPDDPENPINKYKFALKA 75

Query: 59  PSRYFDPCQESSKMSFKCLEMNNYDRDMCKEYFDAYRECKKQWLQSRRENRSQWE 113
            S+Y+DPC+ESSK+SF+CLE N+YDR  C+EYFDAYRECKKQWL +RR+NR QWE
Sbjct: 76  DSQYYDPCEESSKLSFQCLERNDYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 130

>Suva_15.313 Chr15 (544054..544452) [399 bp, 132 aa] {ON} YHR116W
           (REAL)
          Length = 132

 Score =  139 bits (350), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 61/93 (65%), Positives = 80/93 (86%)

Query: 21  TDKEKVNFTPQANDTSSFKFYPDNPESTLNKFRFAAKDPSRYFDPCQESSKMSFKCLEMN 80
           TD+ KVN+ PQ+ND SSF++YPD+PE+ +NK++FA K  S+Y+DPC+ESSK+SF+CLE N
Sbjct: 40  TDRSKVNYVPQSNDPSSFQYYPDDPENPVNKYKFALKGDSQYYDPCEESSKLSFQCLERN 99

Query: 81  NYDRDMCKEYFDAYRECKKQWLQSRRENRSQWE 113
           +YDR  C++YFDAYRECKKQWL +RR NR QWE
Sbjct: 100 SYDRTKCQDYFDAYRECKKQWLTARRNNRQQWE 132

>Smik_8.194 Chr8 (318092..318481) [390 bp, 129 aa] {ON} YHR116W
           (REAL)
          Length = 129

 Score =  138 bits (347), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 60/93 (64%), Positives = 80/93 (86%)

Query: 21  TDKEKVNFTPQANDTSSFKFYPDNPESTLNKFRFAAKDPSRYFDPCQESSKMSFKCLEMN 80
           TD+ KVN+ P+++D SSF++YPD+PE+ +NK++FA K  S+Y+DPC+ESSK+SF+CLE N
Sbjct: 37  TDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLERN 96

Query: 81  NYDRDMCKEYFDAYRECKKQWLQSRRENRSQWE 113
           +YDR  C+EYFDAYRECKKQWL +RR NR QWE
Sbjct: 97  DYDRSKCQEYFDAYRECKKQWLTARRNNRQQWE 129

>YHR116W Chr8 (341665..342120) [456 bp, 151 aa] {ON}
           COX23Mitochondrial intermembrane space protein that
           functions in mitochondrial copper homeostasis, essential
           for functional cytochrome oxidase expression; homologous
           to Cox17p; contains twin cysteine-x9-cysteine motifs
          Length = 151

 Score =  137 bits (346), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 60/93 (64%), Positives = 81/93 (87%)

Query: 21  TDKEKVNFTPQANDTSSFKFYPDNPESTLNKFRFAAKDPSRYFDPCQESSKMSFKCLEMN 80
           TD+ KVN+ P+++D SSF++YPD+PE+ +NK++FA K  S+Y+DPC+ESSK+SF+CLE N
Sbjct: 59  TDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLERN 118

Query: 81  NYDRDMCKEYFDAYRECKKQWLQSRRENRSQWE 113
           +YDR  C+EYFDAYRECKKQWL +RR+NR QWE
Sbjct: 119 DYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 151

>KAFR0F00730 Chr6 complement(143260..143586) [327 bp, 108 aa] {ON}
           Anc_2.153 YHR116W
          Length = 108

 Score =  135 bits (341), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 82/100 (82%), Gaps = 2/100 (2%)

Query: 16  DPQLETDKEKVNFTPQ--ANDTSSFKFYPDNPESTLNKFRFAAKDPSRYFDPCQESSKMS 73
           DP+L TDK KVNF  +    +T+ FK+YPD+PES  ++ +F  K P++Y+DPCQES+++S
Sbjct: 9   DPKLVTDKTKVNFVQEDPGTNTTKFKYYPDDPESAYHRDQFRTKQPTKYYDPCQESAQLS 68

Query: 74  FKCLEMNNYDRDMCKEYFDAYRECKKQWLQSRRENRSQWE 113
           FKCLE+NNYDR +CK+YFDAYRECKKQWL +R+ +RS+WE
Sbjct: 69  FKCLELNNYDRSLCKDYFDAYRECKKQWLNARKTDRSKWE 108

>TDEL0B05150 Chr2 complement(906670..907029) [360 bp, 119 aa] {ON}
           Anc_2.153 YHR116W
          Length = 119

 Score =  135 bits (341), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 57/92 (61%), Positives = 77/92 (83%)

Query: 22  DKEKVNFTPQANDTSSFKFYPDNPESTLNKFRFAAKDPSRYFDPCQESSKMSFKCLEMNN 81
           D  KV++ P+  D S F++YP+NPES +N+  FA K PS+Y+DPCQES++MS  CL+ N+
Sbjct: 28  DSSKVDYAPKGQDPSKFQYYPENPESGVNRLMFAIKGPSQYYDPCQESAQMSLNCLDRND 87

Query: 82  YDRDMCKEYFDAYRECKKQWLQSRRENRSQWE 113
           Y++D+CKEYFDAYRECKKQWL+SRR++RSQWE
Sbjct: 88  YNKDLCKEYFDAYRECKKQWLKSRRQDRSQWE 119

>TPHA0F01870 Chr6 (427543..428085) [543 bp, 180 aa] {ON} Anc_2.153
           YHR116W
          Length = 180

 Score =  130 bits (328), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 77/95 (81%), Gaps = 2/95 (2%)

Query: 16  DPQLETDKEKVNFT-PQAN-DTSSFKFYPDNPESTLNKFRFAAKDPSRYFDPCQESSKMS 73
           DP L T+KE V+FT P    + + FKFYPDNPES+  K+RF +KD S+Y+DPC ES+KMS
Sbjct: 79  DPSLVTNKESVDFTKPDITLNENRFKFYPDNPESSFAKYRFMSKDSSQYYDPCDESAKMS 138

Query: 74  FKCLEMNNYDRDMCKEYFDAYRECKKQWLQSRREN 108
           FKCL+MN+YDRD C+ YFDAYRECKKQWL++RR N
Sbjct: 139 FKCLDMNDYDRDKCRAYFDAYRECKKQWLRARRNN 173

>KNAG0H03520 Chr8 (656843..657172) [330 bp, 109 aa] {ON} Anc_2.153
           YHR116W
          Length = 109

 Score =  126 bits (316), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 56/99 (56%), Positives = 74/99 (74%), Gaps = 2/99 (2%)

Query: 17  PQLE--TDKEKVNFTPQANDTSSFKFYPDNPESTLNKFRFAAKDPSRYFDPCQESSKMSF 74
           P +E  + KE V+F P   +   F+++PD P+S  +K++F  K  S+++DPCQESSKMSF
Sbjct: 11  PAVEGVSGKETVDFAPLGGNPDEFRYFPDTPDSITHKYKFQTKGDSKFYDPCQESSKMSF 70

Query: 75  KCLEMNNYDRDMCKEYFDAYRECKKQWLQSRRENRSQWE 113
            CLE N+YDR  CK YFDAYRECKKQWL++RR N+SQWE
Sbjct: 71  TCLEQNDYDRSKCKAYFDAYRECKKQWLKARRANKSQWE 109

>NCAS0B07000 Chr2 (1331938..1332264) [327 bp, 108 aa] {ON} Anc_2.153
           YHR116W
          Length = 108

 Score =  117 bits (293), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 69/91 (75%)

Query: 23  KEKVNFTPQANDTSSFKFYPDNPESTLNKFRFAAKDPSRYFDPCQESSKMSFKCLEMNNY 82
           K+ VNFTP   +  S+K++PD+P   LNK++F  K  S Y+DPCQE S+MS KCLE N +
Sbjct: 17  KQDVNFTPDEKNPGSYKYFPDDPVQGLNKYKFIMKGDSEYYDPCQECSEMSRKCLERNPF 76

Query: 83  DRDMCKEYFDAYRECKKQWLQSRRENRSQWE 113
           D+  C+EYFDAYR+CKK W+++RRENR QWE
Sbjct: 77  DKSQCQEYFDAYRDCKKMWMKTRRENRKQWE 107

>TBLA0B01240 Chr2 complement(262962..263321) [360 bp, 119 aa] {ON}
           Anc_2.153 YHR116W
          Length = 119

 Score = 79.3 bits (194), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 34/93 (36%), Positives = 61/93 (65%), Gaps = 3/93 (3%)

Query: 19  LETDKEKVNFTPQA--NDTSSFKFYPDNPESTLNKFRFAAKDPSRYFDPCQESSKMSFKC 76
           ++ D   V+F      N  ++F+++PD P ST+ +F FA K+ S+++DPC ES++MS +C
Sbjct: 25  VQNDPTNVSFVHHDPDNHVTTFQYFPDKPTSTMTRFNFADKESSKFYDPCHESAQMSVRC 84

Query: 77  LEMNNYD-RDMCKEYFDAYRECKKQWLQSRREN 108
           +  +  D + +C E+F AYR+CKK W+ +++  
Sbjct: 85  MTDHPDDHKTVCAEFFAAYRDCKKAWIDAKKRG 117

>Suva_10.66 Chr10 complement(136168..136383) [216 bp, 72 aa] {ON}
           YLL009C (REAL)
          Length = 72

 Score = 31.6 bits (70), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 16/26 (61%)

Query: 76  CLEMNNYDRDMCKEYFDAYRECKKQW 101
           C+  N  D D CKE+ D Y+EC K +
Sbjct: 39  CILFNGQDSDKCKEFIDKYKECMKGY 64

>Smik_12.54 Chr12 complement(118226..118432) [207 bp, 69 aa] {ON}
           YLL009C (REAL)
          Length = 69

 Score = 28.1 bits (61), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 16/26 (61%)

Query: 76  CLEMNNYDRDMCKEYFDAYRECKKQW 101
           C+  N  D + CKE+ + Y+EC K +
Sbjct: 36  CILFNGQDSEKCKEFIEKYKECMKGY 61

>YLL009C Chr12 complement(131205..131414) [210 bp, 69 aa] {ON}
           COX17Copper metallochaperone that transfers copper to
           Sco1p and Cox11p for eventual delivery to cytochrome c
           oxidase; contains twin cysteine-x9-cysteine motifs
          Length = 69

 Score = 27.7 bits (60), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 16/26 (61%)

Query: 76  CLEMNNYDRDMCKEYFDAYRECKKQW 101
           C+  N  D + CKE+ + Y+EC K +
Sbjct: 36  CILFNGQDSEKCKEFIEKYKECMKGY 61

>Ecym_8287 Chr8 (585041..585217) [177 bp, 58 aa] {ON} similar to
           Ashbya gossypii AAL161W
          Length = 58

 Score = 26.9 bits (58), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 13/26 (50%)

Query: 76  CLEMNNYDRDMCKEYFDAYRECKKQW 101
           CL  N  +   CKE  D YR C K +
Sbjct: 29  CLLFNGLESTKCKELVDKYRSCMKGY 54

>Kpol_1036.104 s1036 (268670..270733) [2064 bp, 687 aa] {ON}
           (268670..270733) [2064 nt, 688 aa]
          Length = 687

 Score = 28.1 bits (61), Expect = 5.5,   Method: Composition-based stats.
 Identities = 11/25 (44%), Positives = 17/25 (68%)

Query: 1   MSNESQKVEPAPENSDPQLETDKEK 25
           ++N S+K EP PE +D +  TD +K
Sbjct: 171 LANASKKAEPTPEKTDAKETTDAKK 195

>Kpol_2002.103 s2002 complement(245135..245326) [192 bp, 63 aa] {ON}
           complement(245135..245326) [192 nt, 64 aa]
          Length = 63

 Score = 26.6 bits (57), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 14/26 (53%)

Query: 76  CLEMNNYDRDMCKEYFDAYRECKKQW 101
           CL  N  +   CKE+ D Y+ C K +
Sbjct: 33  CLLFNGQESTSCKEFIDKYKSCMKGF 58

>KAFR0D01850 Chr4 complement(371230..371421) [192 bp, 63 aa] {ON}
           Anc_5.205 YLL009C
          Length = 63

 Score = 26.2 bits (56), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 14/27 (51%)

Query: 75  KCLEMNNYDRDMCKEYFDAYRECKKQW 101
           +CL     D   CKEY + YR C K +
Sbjct: 33  QCLLFKGADDGKCKEYIEKYRMCMKSF 59

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.126    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 14,372,509
Number of extensions: 609147
Number of successful extensions: 1770
Number of sequences better than 10.0: 76
Number of HSP's gapped: 1758
Number of HSP's successfully gapped: 76
Length of query: 113
Length of database: 53,481,399
Length adjustment: 83
Effective length of query: 30
Effective length of database: 43,964,121
Effective search space: 1318923630
Effective search space used: 1318923630
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 59 (27.3 bits)