Re-run this search with the SEG filter switched on (default)

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E07722g2.284ON79179142090.0
Kwal_27.115422.284ON79180919610.0
KLTH0G10318g2.284ON79081718350.0
KLLA0E08405g2.284ON77784017420.0
Suva_9.1042.284ON80583316440.0
KAFR0J013702.284ON78083416270.0
Skud_9.782.284ON80984416000.0
YIL095W (PRK1)2.284ON81086715890.0
NDAI0B035602.284ON75680815830.0
NCAS0B062602.284ON72380615750.0
Smik_9.842.284ON80886415700.0
Ecym_33232.284ON74877115280.0
ADL217W2.284ON75068015140.0
TDEL0G021502.284ON66150414690.0
KAFR0H033302.284ON36933113251e-177
Skud_14.3092.284ON63930913251e-173
NDAI0G006402.284ON62131513231e-173
NCAS0G038102.284ON66150913221e-172
YNL020C (ARK1)2.284ON63830913201e-172
TPHA0C033802.284ON69750813231e-172
ZYRO0A01848g2.284ON70449213221e-172
Suva_14.3272.284ON63238713031e-170
Smik_14.3112.284ON63730912981e-169
CAGL0G02607g2.284ON68835812851e-166
TBLA0B059302.284ON71731812471e-160
KNAG0H020202.284ON59231512351e-160
TPHA0D015402.284ON70770912201e-156
Kpol_1039.332.284ON70133312141e-156
TBLA0B069402.284ON144331812461e-153
CAGL0J03432g2.284ON62231111431e-146
KNAG0A054302.284ON78831611491e-145
Kpol_251.43.273ON8383538308e-98
SAKL0D03234g3.273ON8583398282e-97
KAFR0A010403.273ON9123498182e-95
Kpol_1052.223.273ON11013368174e-94
Ecym_26503.273ON8943448059e-94
TBLA0E025903.273ON10613168112e-93
KLTH0C07260g3.273ON9013408032e-93
KNAG0J008203.273ON10913658122e-93
CAGL0H10208g3.273ON10273208074e-93
Kwal_27.109453.273ON9353407955e-92
NDAI0A057003.273ON11573528038e-92
NCAS0A105903.273ON10953427991e-91
KNAG0H012203.273ON9133477901e-91
Suva_4.2973.273ON11073517948e-91
KAFR0C004303.273ON9493227878e-91
Smik_2.1913.273ON11083517931e-90
YBR059C (AKL1)3.273ON11083517931e-90
Skud_2.1793.273ON10903517912e-90
TPHA0M011203.273ON7883477752e-90
ZYRO0E06864g3.273ON11153497912e-90
TDEL0D035203.273ON10493477822e-89
KLLA0F18612g3.273ON8143097641e-88
TPHA0A040303.273ON10543247742e-88
AGR027C3.273ON9613387685e-88
CAGL0K11990g3.273ON9913677695e-88
TBLA0I019303.273ON13613167481e-83
Kwal_56.242746.262ON3463382653e-24
KAFR0A050906.31ON6682672701e-23
SAKL0A03344g6.262ON3643542602e-23
TDEL0A067506.262ON3723522495e-22
Kpol_1023.266.31ON7392712504e-21
Skud_16.426.262ON3643352416e-21
Suva_16.706.262ON3643412406e-21
KLTH0H03080g6.262ON3463312396e-21
SAKL0H06754g8.668ON8843112487e-21
Suva_16.1608.668ON9183092488e-21
YPL236C (ENV7)6.262ON3643352353e-20
ZYRO0E07876g6.262ON3693382292e-19
KNAG0F001701.24ON5433322323e-19
KLTH0F16676g5.406ON8782102343e-19
Smik_6.4416.262ON3643352265e-19
CAGL0M02299g8.668ON8933472326e-19
NDAI0C026806.31ON7502752308e-19
Skud_16.1328.668ON9242972318e-19
KNAG0D048107.86ON14401772301e-18
Kpol_1072.198.668ON8962982291e-18
CAGL0J11638g6.31ON7462752282e-18
Kwal_55.215455.406ON8652532282e-18
Smik_6.3478.668ON9172972282e-18
YPL150W8.668ON9012972273e-18
Kpol_1037.206.31ON7042742263e-18
NCAS0D021006.31ON7262742253e-18
TPHA0F024306.31ON7982752254e-18
ZYRO0D05500g7.86ON12621792255e-18
KLLA0F11319g8.668ON8431962236e-18
TBLA0A047207.86ON12621832247e-18
ACR133C8.668ON8512382237e-18
Kwal_26.87518.668ON8482092237e-18
Kwal_26.73551.271ON14462372231e-17
KLLA0C06138g6.31ON7082762211e-17
ZYRO0F18062g1.24ON4712702181e-17
KNAG0E008506.31ON7112742201e-17
Skud_3.391.52ON10172342211e-17
Kpol_2002.241.24ON4872702181e-17
ZYRO0F07194g8.668ON9383002202e-17
Skud_10.1191.271ON14812792202e-17
TDEL0G043806.31ON7222742182e-17
Smik_13.1596.31ON7052752182e-17
Suva_15.2975.406ON10742732183e-17
NCAS0A002801.24ON5352832153e-17
YJL095W (BCK1)1.271ON14782792183e-17
CAGL0K02167g8.140ON11623082183e-17
KLLA0E21693g5.406ON10162652174e-17
KAFR0D049505.406ON10082842174e-17
KAFR0G012001.24ON5072702145e-17
TDEL0A061408.668ON8613552165e-17
Suva_3.1901.52ON10242312165e-17
Suva_13.1636.31ON7052782156e-17
KNAG0F002901.52ON11252892166e-17
TPHA0E038501.24ON4822692126e-17
TDEL0H036407.86ON12371842158e-17
Smik_1.793.177ON9742672148e-17
Smik_8.1805.406ON10732732149e-17
ACL006W6.31ON7082772139e-17
Kpol_1055.242.496ON9372692131e-16
Skud_13.1546.31ON7053322121e-16
NCAS0C016708.668ON8962082131e-16
Skud_8.1635.406ON10762732131e-16
TBLA0A071501.52ON13912992131e-16
Ecym_21536.262ON3633522061e-16
KLTH0D11044g8.668ON8493672121e-16
YMR001C (CDC5)6.31ON7052782111e-16
TPHA0J004206.31ON7072762111e-16
TDEL0C067801.24ON4682702092e-16
YHR102W (KIC1)5.406ON10802732122e-16
Smik_10.1471.271ON14782982122e-16
KLLA0F14190g1.271ON13382532122e-16
CAGL0L03520g1.271ON14472822122e-16
ZYRO0C07480g6.31ON7742742102e-16
TPHA0G016308.668ON8712012112e-16
NDAI0F045201.24ON4892722082e-16
KNAG0F029006.31ON6492592102e-16
Kpol_463.81.271ON14472382112e-16
TBLA0B082503.92ON13472172112e-16
TBLA0A035705.406ON9752502103e-16
NCAS0B037408.279ON10492342103e-16
NCAS0C041008.141ON9053332093e-16
YAR019C (CDC15)3.177ON9742672094e-16
YDR523C (SPS1)1.24ON4902752064e-16
Kpol_1044.37.86ON9321792084e-16
Ecym_30356.31ON7402772084e-16
ACL104C5.406ON9472412084e-16
TPHA0E036401.52ON11372352094e-16
KLTH0G05214g5.591ON6531942074e-16
NCAS0B044906.222ON3491862024e-16
Kwal_33.131121.24ON5052922055e-16
KAFR0D012207.86ON10551912085e-16
TBLA0B004906.31ON7872752075e-16
Suva_6.1691.271ON14842792085e-16
SAKL0C01716g1.52ON12152322085e-16
CAGL0L11550g5.406ON10722632085e-16
SAKL0G01848g5.406ON8852422075e-16
CAGL0F00913g7.86ON12061862085e-16
CAGL0K08514g2.479ON14892342086e-16
Skud_1.723.177ON9742642067e-16
Kpol_1031.105.406ON11272582077e-16
KAFR0G026906.31ON7132712057e-16
Smik_3.541.52ON10322382068e-16
KLTH0F01672g1.52ON11642252069e-16
NCAS0B086001.52ON11172352069e-16
KLLA0C01650g1.52ON11122352051e-15
KLTH0D03454g1.271ON14332372061e-15
CAGL0I07513g3.92ON10762502051e-15
KAFR0K007007.86ON13811912051e-15
KNAG0B043205.406ON10272722041e-15
Smik_4.7673.92ON7582002031e-15
Skud_5.2498.140ON11472652041e-15
ZYRO0A06446g5.406ON9432392041e-15
SAKL0E01584g6.31ON6952772031e-15
CAGL0H06259g7.86ON13361902041e-15
TDEL0A025502.479ON13692342041e-15
CAGL0K05709g1.52ON11032362042e-15
YCL024W (KCC4)1.52ON10372362032e-15
Smik_4.8031.24ON4902752002e-15
Kwal_56.224766.31ON6972742022e-15
KNAG0J016708.668ON10091992032e-15
KAFR0C014403.92ON10952442032e-15
KLTH0C10912g6.31ON6972742012e-15
KLLA0F07623g7.86ON12291932022e-15
NDAI0C017005.406ON10202362022e-15
Kwal_26.71547.86ON12131922022e-15
KNAG0D008306.262ON3873031973e-15
SAKL0H07084g8.654ON9192582013e-15
KAFR0D033902.496ON7982542013e-15
Suva_1.863.177ON9742742013e-15
KLTH0C09548g3.92ON9931922013e-15
TDEL0D014001.271ON14292592013e-15
Skud_4.7971.24ON4852751983e-15
ABL034W2.479ON14252552013e-15
NCAS0A094701.271ON15152792013e-15
Skud_16.3403.338ON3882201963e-15
Suva_2.7031.24ON4852751983e-15
NDAI0E023908.668ON8832072004e-15
NDAI0H024707.86ON14111832014e-15
TDEL0D053203.92ON10572292004e-15
CAGL0M11396g8.279ON11922232004e-15
NCAS0H019405.406ON10152322004e-15
NDAI0G054701.271ON15552782014e-15
CAGL0K02673g2.496ON9152792004e-15
ZYRO0D06776g8.279ON12042272004e-15
KAFR0B028008.279ON10952272004e-15
NDAI0F016006.222ON4121961955e-15
Kpol_431.92.479ON15522002005e-15
Kpol_1065.36.222ON3762731945e-15
Suva_2.6871.52ON11282271996e-15
NDAI0G034508.141ON9483221986e-15
Suva_7.838.140ON5693131977e-15
TPHA0G032002.479ON15341991997e-15
KLLA0C12485g3.92ON9252311987e-15
TBLA0D022308.141ON11542981987e-15
NDAI0A038702.496ON8953191987e-15
SAKL0A04246g6.222ON4002201938e-15
ZYRO0E07018g6.222ON3671861928e-15
ZYRO0G15290g1.271ON14872591988e-15
TPHA0I009201.271ON14342931988e-15
TDEL0E021805.406ON9872361978e-15
Ecym_24342.496ON11222711989e-15
Suva_11.1232.479ON15262341989e-15
KLTH0D10714g8.654ON8722611979e-15
Smik_4.7891.52ON11362271979e-15
ZYRO0G03366g2.479ON16162341989e-15
AFR696C1.52ON11422321979e-15
Ecym_26407.86ON13251811979e-15
Kwal_26.78612.496ON9552701961e-14
NDAI0K021002.496ON9092741961e-14
ZYRO0F17402g1.52ON11892611961e-14
AFR335C3.92ON10331951961e-14
TDEL0A027202.496ON9152761961e-14
TDEL0F040608.279ON11262191961e-14
Skud_4.7831.52ON11352271961e-14
KAFR0H025108.668ON8792631951e-14
Skud_4.7643.92ON7561991951e-14
KAFR0D041001.52ON11172881961e-14
Skud_1.447.86ON13561771961e-14
KNAG0A065402.479ON14322341961e-14
TPHA0D011408.654ON6222731942e-14
TPHA0H004208.140ON10382261952e-14
NDAI0A006601.52ON10222281952e-14
TBLA0B038608.668ON9882081952e-14
YAL017W (PSK1)7.86ON13561771952e-14
YDR507C (GIN4)1.52ON11422271952e-14
Kwal_56.226933.92ON9842011952e-14
TBLA0I011502.479ON17452411952e-14
Sklu_YGOB_Anc_2.4962.496ON6192491932e-14
Skud_11.1262.479ON15182341952e-14
Kwal_47.183075.591ON6212751932e-14
SAKL0C00946g1.24ON5642681932e-14
NCAS0F015807.86ON13821831952e-14
Suva_2.6663.92ON7642011942e-14
NOTE: 1 genes in the same pillar as SAKL0E07722g were not hit in these BLAST results
LIST: Kpol_1003.35

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E07722g
         (791 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...  1625   0.0  
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...   759   0.0  
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...   711   0.0  
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...   675   0.0  
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...   637   0.0  
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...   631   0.0  
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...   620   0.0  
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...   616   0.0  
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...   614   0.0  
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...   611   0.0  
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...   609   0.0  
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...   593   0.0  
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...   587   0.0  
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...   570   0.0  
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...   514   e-177
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...   514   e-173
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284    514   e-173
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...   513   e-172
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...   513   e-172
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...   514   e-172
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...   513   e-172
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...   506   e-170
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...   504   e-169
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...   499   e-166
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...   484   e-160
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...   480   e-160
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...   474   e-156
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...   472   e-156
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...   484   e-153
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...   444   e-146
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...   447   e-145
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...   324   8e-98
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...   323   2e-97
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...   319   2e-95
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...   319   4e-94
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...   314   9e-94
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...   317   2e-93
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...   313   2e-93
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...   317   2e-93
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...   315   4e-93
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...   310   5e-92
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...   313   8e-92
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...   312   1e-91
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...   308   1e-91
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...   310   8e-91
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...   307   8e-91
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...   310   1e-90
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...   310   1e-90
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...   309   2e-90
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...   303   2e-90
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...   309   2e-90
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....   305   2e-89
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...   298   1e-88
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....   302   2e-88
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...   300   5e-88
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...   300   5e-88
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...   292   1e-83
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...   106   3e-24
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}            108   1e-23
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...   104   2e-23
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...   100   5e-22
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....   100   4e-21
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    97   6e-21
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    97   6e-21
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    97   6e-21
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...   100   7e-21
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...   100   8e-21
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    95   3e-20
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    93   2e-19
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    94   3e-19
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    95   3e-19
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    92   5e-19
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    94   6e-19
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...    93   8e-19
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    94   8e-19
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    93   1e-18
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    93   1e-18
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    92   2e-18
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    92   2e-18
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    92   2e-18
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    92   3e-18
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....    92   3e-18
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      91   3e-18
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    91   4e-18
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    91   5e-18
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    91   6e-18
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    91   7e-18
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    91   7e-18
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    91   7e-18
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...    91   1e-17
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    90   1e-17
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    89   1e-17
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...    89   1e-17
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    90   1e-17
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    89   1e-17
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    89   2e-17
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    89   2e-17
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    89   2e-17
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    89   2e-17
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...    89   3e-17
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        87   3e-17
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    89   3e-17
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    89   3e-17
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    88   4e-17
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....    88   4e-17
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    87   5e-17
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    88   5e-17
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    88   5e-17
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    87   6e-17
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...    88   6e-17
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    86   6e-17
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    87   8e-17
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    87   8e-17
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...    87   9e-17
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...    87   9e-17
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    87   1e-16
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    86   1e-16
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    87   1e-16
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...    87   1e-16
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...    87   1e-16
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    84   1e-16
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    86   1e-16
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    86   1e-16
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...    86   1e-16
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    85   2e-16
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...    86   2e-16
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    86   2e-16
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...    86   2e-16
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    86   2e-16
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    86   2e-16
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    86   2e-16
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    85   2e-16
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               86   2e-16
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    86   2e-16
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    86   2e-16
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    86   3e-16
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    86   3e-16
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     85   3e-16
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    85   4e-16
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    84   4e-16
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    85   4e-16
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    85   4e-16
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    85   4e-16
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    85   4e-16
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    84   4e-16
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     82   4e-16
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...    84   5e-16
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    85   5e-16
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    84   5e-16
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    85   5e-16
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    85   5e-16
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...    85   5e-16
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    84   5e-16
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    85   5e-16
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    85   6e-16
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    84   7e-16
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...    84   7e-16
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    84   7e-16
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    84   8e-16
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    84   9e-16
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    84   9e-16
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    84   1e-15
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...    84   1e-15
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    84   1e-15
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    84   1e-15
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...    83   1e-15
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    83   1e-15
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    83   1e-15
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    83   1e-15
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    83   1e-15
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    83   1e-15
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    83   1e-15
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...    83   2e-15
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    83   2e-15
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    82   2e-15
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...    82   2e-15
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    83   2e-15
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    83   2e-15
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...    82   2e-15
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    82   2e-15
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...    82   2e-15
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    82   2e-15
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    80   3e-15
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    82   3e-15
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    82   3e-15
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    82   3e-15
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    82   3e-15
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    82   3e-15
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    81   3e-15
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    82   3e-15
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    82   3e-15
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    80   3e-15
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    81   3e-15
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    82   4e-15
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    82   4e-15
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    82   4e-15
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    82   4e-15
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....    82   4e-15
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    82   4e-15
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    82   4e-15
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    82   4e-15
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    82   4e-15
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    80   5e-15
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    82   5e-15
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    79   5e-15
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    81   6e-15
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     81   6e-15
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    80   7e-15
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    81   7e-15
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    81   7e-15
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    81   7e-15
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     81   7e-15
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    79   8e-15
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    79   8e-15
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    81   8e-15
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    81   8e-15
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    80   8e-15
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    81   9e-15
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    81   9e-15
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    80   9e-15
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    80   9e-15
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    81   9e-15
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    80   9e-15
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    80   9e-15
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    80   1e-14
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    80   1e-14
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    80   1e-14
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    80   1e-14
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    80   1e-14
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    80   1e-14
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    80   1e-14
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    80   1e-14
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...    80   1e-14
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    80   1e-14
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    80   1e-14
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    80   1e-14
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    79   2e-14
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    80   2e-14
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     80   2e-14
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    80   2e-14
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    80   2e-14
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...    80   2e-14
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    80   2e-14
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    80   2e-14
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    79   2e-14
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    80   2e-14
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    79   2e-14
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    79   2e-14
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    80   2e-14
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    79   2e-14
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    79   2e-14
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    79   2e-14
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    79   2e-14
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    79   2e-14
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    79   2e-14
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    79   2e-14
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    79   3e-14
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    77   3e-14
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    79   3e-14
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    79   3e-14
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    79   3e-14
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    77   3e-14
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    79   3e-14
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    79   3e-14
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    79   3e-14
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    79   3e-14
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    79   3e-14
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    79   4e-14
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    78   4e-14
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    77   4e-14
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...    78   4e-14
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    79   4e-14
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    79   4e-14
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    77   4e-14
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    78   4e-14
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    79   4e-14
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    78   4e-14
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       79   4e-14
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    78   4e-14
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    79   5e-14
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    78   5e-14
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    78   5e-14
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    78   5e-14
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    78   5e-14
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    78   5e-14
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    78   5e-14
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    78   5e-14
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    76   6e-14
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    77   6e-14
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    78   6e-14
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    77   6e-14
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    78   6e-14
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    78   7e-14
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    77   7e-14
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    78   8e-14
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    78   8e-14
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    77   9e-14
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    77   9e-14
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    77   9e-14
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    77   9e-14
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    77   9e-14
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    77   9e-14
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    77   1e-13
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    76   1e-13
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    77   1e-13
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    77   1e-13
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    77   1e-13
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    77   1e-13
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    77   1e-13
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    77   1e-13
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    77   1e-13
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              77   1e-13
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    77   1e-13
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    77   1e-13
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    77   1e-13
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    75   1e-13
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    77   1e-13
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    77   1e-13
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    77   1e-13
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    77   1e-13
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    77   1e-13
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    77   1e-13
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    77   1e-13
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    77   1e-13
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    76   2e-13
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    77   2e-13
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    76   2e-13
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     76   2e-13
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    77   2e-13
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    76   2e-13
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    76   2e-13
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    76   2e-13
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    76   2e-13
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    75   2e-13
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    76   2e-13
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    74   2e-13
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    76   2e-13
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    76   2e-13
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    74   2e-13
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    76   2e-13
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    76   3e-13
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    76   3e-13
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    76   3e-13
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    76   3e-13
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    75   3e-13
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    75   3e-13
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    75   3e-13
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    75   3e-13
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    75   3e-13
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    75   3e-13
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    75   4e-13
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    75   4e-13
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    74   4e-13
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    75   4e-13
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    74   4e-13
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    75   4e-13
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    75   4e-13
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    75   5e-13
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    75   5e-13
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    75   5e-13
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    75   5e-13
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    75   5e-13
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    74   5e-13
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    75   5e-13
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    75   6e-13
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    74   6e-13
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    75   6e-13
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    74   7e-13
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    74   7e-13
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    74   7e-13
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    74   7e-13
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    74   8e-13
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....    74   8e-13
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    74   8e-13
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    74   8e-13
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    74   9e-13
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    74   1e-12
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    74   1e-12
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    74   1e-12
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    74   1e-12
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    74   1e-12
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    74   1e-12
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    74   1e-12
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    72   1e-12
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    74   1e-12
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              74   1e-12
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    73   1e-12
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    74   1e-12
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    74   1e-12
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    74   1e-12
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    73   1e-12
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    74   1e-12
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    74   1e-12
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    74   1e-12
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    73   1e-12
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    72   1e-12
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    73   1e-12
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     73   2e-12
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    72   2e-12
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    73   2e-12
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    73   2e-12
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    72   2e-12
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    73   2e-12
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    73   2e-12
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    73   2e-12
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    73   2e-12
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    74   2e-12
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    73   2e-12
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    73   2e-12
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    72   2e-12
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    73   2e-12
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    72   2e-12
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    71   2e-12
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    73   2e-12
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    73   2e-12
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    73   2e-12
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    73   2e-12
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    72   2e-12
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    73   2e-12
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    72   2e-12
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    73   2e-12
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    73   2e-12
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    72   2e-12
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    72   3e-12
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    72   3e-12
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    71   3e-12
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    72   3e-12
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    72   3e-12
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    72   3e-12
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    72   3e-12
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    72   3e-12
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    72   4e-12
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    72   4e-12
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    72   4e-12
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    71   4e-12
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    72   4e-12
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    72   4e-12
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    72   4e-12
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    70   5e-12
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    72   5e-12
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    70   5e-12
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     72   5e-12
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    72   6e-12
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    72   6e-12
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    71   6e-12
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    71   6e-12
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    71   6e-12
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    71   6e-12
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    71   7e-12
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    70   7e-12
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    70   7e-12
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    71   7e-12
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    71   7e-12
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    71   7e-12
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    70   7e-12
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    71   7e-12
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    70   7e-12
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    70   7e-12
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    71   8e-12
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    71   8e-12
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    70   8e-12
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    70   9e-12
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    71   9e-12
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    71   9e-12
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    70   1e-11
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    70   1e-11
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    70   1e-11
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    70   1e-11
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    70   1e-11
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    70   1e-11
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    70   1e-11
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    70   1e-11
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    70   1e-11
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    70   1e-11
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    70   1e-11
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    70   1e-11
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    70   1e-11
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    70   1e-11
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    70   1e-11
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    70   1e-11
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    69   2e-11
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    69   2e-11
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    69   2e-11
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    70   2e-11
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    69   2e-11
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    70   2e-11
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               69   2e-11
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    70   2e-11
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...    69   2e-11
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    70   2e-11
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    70   2e-11
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    69   2e-11
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    70   2e-11
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    69   2e-11
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    70   2e-11
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    68   2e-11
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    69   2e-11
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               69   2e-11
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    70   2e-11
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    70   2e-11
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    69   2e-11
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    69   2e-11
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    69   2e-11
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    69   3e-11
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    69   3e-11
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    69   3e-11
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    69   3e-11
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    69   3e-11
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    68   3e-11
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    68   3e-11
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               69   3e-11
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    69   3e-11
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    68   3e-11
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    69   3e-11
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    68   3e-11
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    68   4e-11
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    69   4e-11
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    69   4e-11
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    69   4e-11
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    69   4e-11
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       67   4e-11
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    69   4e-11
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    68   4e-11
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    68   5e-11
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    67   5e-11
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    67   5e-11
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    67   6e-11
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    68   6e-11
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    68   6e-11
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    68   6e-11
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    67   6e-11
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    67   6e-11
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    68   6e-11
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    68   6e-11
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    67   7e-11
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    68   7e-11
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    67   7e-11
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    68   7e-11
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    67   8e-11
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    68   8e-11
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    66   8e-11
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    66   8e-11
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    68   8e-11
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    67   8e-11
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    67   9e-11
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    68   9e-11
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    67   9e-11
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    66   9e-11
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    67   1e-10
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    67   1e-10
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    66   1e-10
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    67   1e-10
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    67   1e-10
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    67   1e-10
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    67   1e-10
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    67   1e-10
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    67   1e-10
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    67   1e-10
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    67   1e-10
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    67   1e-10
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    67   1e-10
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    66   1e-10
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    67   1e-10
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               66   1e-10
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     66   1e-10
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    67   1e-10
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    66   1e-10
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    67   1e-10
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    66   1e-10
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    67   1e-10
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    66   1e-10
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    67   1e-10
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    66   1e-10
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    66   1e-10
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    66   1e-10
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    66   1e-10
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    67   1e-10
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    67   1e-10
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    67   1e-10
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    67   1e-10
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    66   2e-10
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    67   2e-10
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    66   2e-10
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    67   2e-10
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    67   2e-10
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    67   2e-10
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    67   2e-10
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               67   2e-10
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    67   2e-10
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    66   2e-10
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    65   2e-10
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    67   2e-10
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    65   2e-10
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    66   2e-10
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    66   2e-10
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    66   2e-10
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     65   2e-10
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    66   2e-10
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    65   2e-10
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    65   2e-10
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    67   2e-10
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    66   2e-10
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    65   2e-10
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    66   2e-10
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    66   2e-10
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    66   2e-10
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    66   2e-10
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    66   2e-10
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    66   2e-10
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    65   2e-10
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    66   3e-10
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    65   3e-10
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    65   3e-10
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    66   3e-10
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    66   3e-10
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    66   3e-10
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    65   3e-10
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     65   3e-10
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    66   3e-10
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    65   3e-10
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    65   3e-10
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    65   3e-10
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    65   3e-10
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    65   3e-10
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    65   3e-10
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    65   4e-10
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    66   4e-10
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    66   4e-10
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    65   4e-10
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    65   4e-10
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    65   4e-10
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    65   4e-10
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    65   4e-10
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               64   4e-10
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    64   4e-10
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    64   4e-10
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    64   4e-10
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    65   4e-10
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    64   4e-10
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    65   4e-10
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    65   5e-10
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    65   5e-10
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    65   5e-10
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    65   5e-10
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    65   5e-10
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    64   5e-10
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    65   5e-10
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    65   5e-10
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    64   5e-10
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    64   5e-10
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    65   5e-10
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    65   5e-10
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    65   5e-10
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    65   6e-10
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....    65   6e-10
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    65   6e-10
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    64   6e-10
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    65   6e-10
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    65   6e-10
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    65   7e-10
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    64   7e-10
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    65   7e-10
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    64   7e-10
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    64   7e-10
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    65   7e-10
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    64   7e-10
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    64   7e-10
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    64   8e-10
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    64   8e-10
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    64   8e-10
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    64   8e-10
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    64   8e-10
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    64   8e-10
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    64   8e-10
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    64   8e-10
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    64   9e-10
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     64   9e-10
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    64   9e-10
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    64   9e-10
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    64   9e-10
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    64   9e-10
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    64   9e-10
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    64   9e-10
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    64   9e-10
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    64   1e-09
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    64   1e-09
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      64   1e-09
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    64   1e-09
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    64   1e-09
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    63   1e-09
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    63   1e-09
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    64   1e-09
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    64   1e-09
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    64   1e-09
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    63   1e-09
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    64   1e-09
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    64   1e-09
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    64   1e-09
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    63   1e-09
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              64   1e-09
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    64   1e-09
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    63   1e-09
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    63   1e-09
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    64   1e-09
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    64   1e-09
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    64   1e-09
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    62   1e-09
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    64   1e-09
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    64   1e-09
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    63   2e-09
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    63   2e-09
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    62   2e-09
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    64   2e-09
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    62   2e-09
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    63   2e-09
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    63   2e-09
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    64   2e-09
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    64   2e-09
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    63   2e-09
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    64   2e-09
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    63   2e-09
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    62   2e-09
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    63   2e-09
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              64   2e-09
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    63   2e-09
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    63   2e-09
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     62   2e-09
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    63   2e-09
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    62   2e-09
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    62   2e-09
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    63   2e-09
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    61   2e-09
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    62   2e-09
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    62   2e-09
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    62   2e-09
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    63   2e-09
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    63   2e-09
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    63   2e-09
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               63   3e-09
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    61   3e-09
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    63   3e-09
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    63   3e-09
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    63   3e-09
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    62   3e-09
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    63   3e-09
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    62   3e-09
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    63   3e-09
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    63   3e-09
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    62   3e-09
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    63   3e-09
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    62   3e-09
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    62   3e-09
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    62   3e-09
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    61   3e-09
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    62   3e-09
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    62   3e-09
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     62   3e-09
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    62   3e-09
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    62   3e-09
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    62   3e-09
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    62   3e-09
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    62   3e-09
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    62   3e-09
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    62   3e-09
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    62   3e-09
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     61   3e-09
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    62   3e-09
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               62   3e-09
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    62   3e-09
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    62   3e-09
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    62   4e-09
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    60   4e-09
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    62   4e-09
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    62   4e-09
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              60   4e-09
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    62   4e-09
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    62   4e-09
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    62   4e-09
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    60   4e-09
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    62   4e-09
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    61   4e-09
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    62   4e-09
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    62   4e-09
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    62   4e-09
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    62   5e-09
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    62   5e-09
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    62   5e-09
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    62   5e-09
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    61   5e-09
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    62   5e-09
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    62   5e-09
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    61   5e-09
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    62   5e-09
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    62   5e-09
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    62   5e-09
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    62   5e-09
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    62   5e-09
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    62   5e-09
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    61   5e-09
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    62   5e-09
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    61   5e-09
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    59   5e-09
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    62   5e-09
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    62   6e-09
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    61   6e-09
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    62   6e-09
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    62   6e-09
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    60   6e-09
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    62   6e-09
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    62   6e-09
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    60   6e-09
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    61   6e-09
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              62   6e-09
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    62   6e-09
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    61   7e-09
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    61   7e-09
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    61   7e-09
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    61   7e-09
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    61   7e-09
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    61   7e-09
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    62   7e-09
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    60   8e-09
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    60   8e-09
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    61   8e-09
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    60   8e-09
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    61   8e-09
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    60   8e-09
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    61   8e-09
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    61   8e-09
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    61   8e-09
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    61   8e-09
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    60   8e-09
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    61   9e-09
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    61   9e-09
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    61   9e-09
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    61   9e-09
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    61   9e-09
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    61   9e-09
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    59   1e-08
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    61   1e-08
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    59   1e-08
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    60   1e-08
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    60   1e-08
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    60   1e-08
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    60   1e-08
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    60   1e-08
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    60   1e-08
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    61   1e-08
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    60   1e-08
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    61   1e-08
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    61   1e-08
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    60   1e-08
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    60   1e-08
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               60   1e-08
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    60   1e-08
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    60   1e-08
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    60   1e-08
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    60   1e-08
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    60   1e-08
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    60   1e-08
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    60   1e-08
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    60   1e-08
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    60   1e-08
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    60   1e-08
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     60   1e-08
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    60   1e-08
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    59   1e-08
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    60   1e-08
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    60   1e-08
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    60   1e-08
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    60   1e-08
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    59   1e-08
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    60   2e-08
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    60   2e-08
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    60   2e-08
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    59   2e-08
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    60   2e-08
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    60   2e-08
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    60   2e-08
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    60   2e-08
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    60   2e-08
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    60   2e-08
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    60   2e-08
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    60   2e-08
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              60   2e-08
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    60   2e-08
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    59   2e-08
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    60   2e-08
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              60   2e-08
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    60   2e-08
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    60   2e-08
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    59   2e-08
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    58   2e-08
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    58   2e-08
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    58   2e-08
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    59   2e-08
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    59   2e-08
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    59   2e-08
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    60   2e-08
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    59   2e-08
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    59   2e-08
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    59   3e-08
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...    59   3e-08
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...    59   3e-08
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    59   3e-08
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    59   3e-08
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    58   3e-08
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    59   3e-08
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    59   3e-08
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    59   3e-08
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    59   3e-08
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    59   3e-08
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    59   3e-08
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    59   3e-08
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    59   3e-08
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    59   3e-08
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    59   3e-08
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    59   3e-08
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    59   3e-08
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    59   3e-08
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    58   3e-08
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...    59   3e-08
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    59   3e-08
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    59   3e-08
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    59   3e-08
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    59   3e-08
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    59   3e-08
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    59   3e-08
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    59   3e-08
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    57   4e-08
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    59   4e-08
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    59   4e-08
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    57   4e-08
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    59   4e-08
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     59   4e-08
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...    59   4e-08
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    59   4e-08
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    59   4e-08
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    58   5e-08
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    59   5e-08
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    59   5e-08
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    57   5e-08
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    58   5e-08
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    58   5e-08
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    58   5e-08
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    59   6e-08
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    58   6e-08
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    58   6e-08
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...    58   6e-08
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    58   6e-08
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    58   6e-08
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    58   7e-08
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    58   7e-08
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    58   7e-08
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    58   7e-08
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    58   7e-08
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    58   7e-08
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    57   8e-08
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    57   8e-08
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    58   8e-08
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    58   9e-08
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    58   9e-08
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    58   9e-08
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    58   1e-07
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    57   1e-07
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    57   1e-07
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    57   1e-07
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    57   1e-07
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    57   1e-07
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    57   1e-07
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    56   1e-07
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    57   1e-07
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    57   1e-07
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    57   1e-07
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    57   1e-07
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    57   1e-07
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    57   1e-07
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    57   1e-07
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    57   1e-07
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    57   1e-07
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    57   1e-07
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    57   1e-07
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    57   1e-07
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    57   1e-07
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    57   2e-07
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    57   2e-07
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    57   2e-07
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    56   2e-07
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       57   2e-07
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    57   2e-07
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...    57   2e-07
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    57   2e-07
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    57   2e-07
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     57   2e-07
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    56   2e-07
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    57   2e-07
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    56   2e-07
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    57   2e-07
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    57   2e-07
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    56   2e-07
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    56   2e-07
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    57   2e-07
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    56   2e-07
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    56   2e-07
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    56   2e-07
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    57   2e-07
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    56   2e-07
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    57   2e-07
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    56   2e-07
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    56   2e-07
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    56   3e-07
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    56   3e-07
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    56   3e-07
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    57   3e-07
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    56   3e-07
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    56   3e-07
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    56   3e-07
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              56   3e-07
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    56   3e-07
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    56   3e-07
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    56   3e-07
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    55   3e-07
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    55   3e-07
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    56   3e-07
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    55   3e-07
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    56   3e-07
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    55   3e-07
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    56   3e-07
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    55   3e-07
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    56   3e-07
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    56   3e-07
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    56   3e-07
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    55   3e-07
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    55   3e-07
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     55   3e-07
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    56   3e-07
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    56   3e-07
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    55   3e-07
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    55   3e-07
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    56   4e-07
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    56   4e-07
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    56   4e-07
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    55   4e-07
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    55   4e-07
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    55   4e-07
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    55   4e-07
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    55   4e-07
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    55   4e-07
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    56   4e-07
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    55   4e-07
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    55   4e-07
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    55   4e-07
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    55   4e-07
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    55   4e-07
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    55   4e-07
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              55   4e-07
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    55   4e-07
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    55   5e-07
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    55   5e-07
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    55   5e-07
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    55   5e-07
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    55   5e-07
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    55   5e-07
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    54   5e-07
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    54   5e-07
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    55   5e-07
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    54   5e-07
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    55   5e-07
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    55   6e-07
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    55   6e-07
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    55   6e-07
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    55   6e-07
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    55   6e-07
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    55   6e-07
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    55   6e-07
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    55   6e-07
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    55   6e-07
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    55   6e-07
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    54   6e-07
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    55   6e-07
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    55   7e-07
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    55   7e-07
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    54   7e-07
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    55   7e-07
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    55   7e-07
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    54   7e-07
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    55   7e-07
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    55   7e-07
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    54   7e-07
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    54   7e-07
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    55   7e-07
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    55   8e-07
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    54   8e-07
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    54   8e-07
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...    55   8e-07
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    54   8e-07
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     55   8e-07
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    55   8e-07
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    55   8e-07
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    54   8e-07
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    54   8e-07
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    54   8e-07
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    55   9e-07
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    55   9e-07
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    54   9e-07
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    54   9e-07
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    54   9e-07
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    51   9e-07
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    54   9e-07
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    54   9e-07
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    55   9e-07
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    54   9e-07
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    54   9e-07
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    54   1e-06
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    54   1e-06
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    54   1e-06
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    54   1e-06
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    54   1e-06
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    54   1e-06
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    54   1e-06
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       54   1e-06
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    54   1e-06
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     54   1e-06
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    54   1e-06
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    54   1e-06
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    54   1e-06
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    54   1e-06
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    54   1e-06
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    54   1e-06
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    54   1e-06
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    54   1e-06
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...    54   1e-06
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    54   1e-06
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}              54   1e-06
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    54   1e-06
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...    54   1e-06
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    54   1e-06
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    54   1e-06
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    54   1e-06
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    54   1e-06
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    54   1e-06
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...    54   1e-06
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    54   1e-06
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    54   1e-06
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    53   1e-06
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    54   1e-06
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    54   1e-06
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    53   1e-06
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    54   1e-06
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    54   1e-06
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    54   1e-06
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    54   2e-06
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    54   2e-06
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    54   2e-06
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    54   2e-06
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    54   2e-06
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    54   2e-06
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    54   2e-06
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    54   2e-06
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    54   2e-06
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    54   2e-06
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    53   2e-06
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    54   2e-06
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    53   2e-06
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    54   2e-06
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    53   2e-06
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    53   2e-06
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...    54   2e-06
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    53   2e-06
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     53   2e-06
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    53   2e-06
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    52   2e-06
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    53   2e-06
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    52   2e-06
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    53   2e-06
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    53   2e-06
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    53   2e-06
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    53   2e-06
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    53   2e-06
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    53   2e-06
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    53   2e-06
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    53   2e-06
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    52   2e-06
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    53   2e-06
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    53   2e-06
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    53   2e-06
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    53   2e-06
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    52   2e-06
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    53   3e-06
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    53   3e-06
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    53   3e-06
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    53   3e-06
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    52   3e-06
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    52   3e-06
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    52   3e-06
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    52   3e-06
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    53   3e-06
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    53   3e-06
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    53   3e-06
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    52   3e-06
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    53   3e-06
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    53   3e-06
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    53   3e-06
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    52   3e-06
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    52   3e-06
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    53   3e-06
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    53   3e-06
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    52   3e-06
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    52   3e-06
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    53   3e-06
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    52   3e-06
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    53   3e-06
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    52   3e-06
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    52   3e-06
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    52   3e-06
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    52   4e-06
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    52   4e-06
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    52   4e-06
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    52   4e-06
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    52   4e-06
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    52   4e-06
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    52   4e-06
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    52   4e-06
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    52   4e-06
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    52   4e-06
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    52   4e-06
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    52   4e-06
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    52   4e-06
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    52   4e-06
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    52   4e-06
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    52   4e-06
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    52   5e-06
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    51   5e-06
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    52   5e-06
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    52   5e-06
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...    52   5e-06
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    52   5e-06
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    52   5e-06
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    52   5e-06
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    52   5e-06
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    52   5e-06
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    52   5e-06
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    52   5e-06
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    51   5e-06
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    52   5e-06
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    52   5e-06
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    52   5e-06
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    52   6e-06
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    51   6e-06
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    52   6e-06
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    52   6e-06
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     52   6e-06
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    52   6e-06
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    52   6e-06
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    52   6e-06
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    51   6e-06
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    51   6e-06
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    51   6e-06
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    51   7e-06
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    51   7e-06
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    52   7e-06
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...    52   7e-06
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    50   7e-06
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    51   7e-06
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    51   7e-06
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    51   7e-06
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    51   7e-06
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    51   7e-06
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    51   7e-06
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    51   7e-06
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    52   7e-06
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    51   7e-06
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    51   7e-06
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    51   8e-06
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    51   8e-06
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    51   8e-06
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    52   8e-06
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    51   8e-06
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    51   8e-06
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    51   8e-06
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...    51   8e-06
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    51   8e-06
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    51   9e-06
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    52   9e-06
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    51   9e-06
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    51   9e-06
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    51   9e-06
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    50   9e-06
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    50   9e-06
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    50   9e-06
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    51   9e-06
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    51   9e-06
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    51   9e-06
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    51   1e-05
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    51   1e-05
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    50   1e-05
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               51   1e-05
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    51   1e-05
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    51   1e-05
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    51   1e-05
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    51   1e-05
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    50   1e-05
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    50   1e-05
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    51   1e-05
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    51   1e-05
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    51   1e-05
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    51   1e-05
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    51   1e-05
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...    50   1e-05
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...    51   1e-05
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    50   1e-05
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    51   1e-05
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    51   1e-05
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    51   1e-05
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    51   1e-05
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    50   1e-05
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    50   1e-05
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    50   1e-05
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    50   1e-05
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               51   1e-05
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    51   1e-05
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    50   1e-05
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    50   1e-05
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162     50   1e-05
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    50   2e-05
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    50   2e-05
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    50   2e-05
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    50   2e-05
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    50   2e-05
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    50   2e-05
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    50   2e-05
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    50   2e-05
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    50   2e-05
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    50   2e-05
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    50   2e-05
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    50   2e-05
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    49   2e-05
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     50   2e-05
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    50   2e-05
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    50   2e-05
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    50   2e-05
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    50   2e-05
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    50   2e-05
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    50   2e-05
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    50   2e-05
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    50   2e-05
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    50   2e-05
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    50   2e-05
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    50   2e-05
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    50   2e-05
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    50   2e-05
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    50   2e-05
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    50   2e-05
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    49   2e-05
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    50   2e-05
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    49   2e-05
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...    50   2e-05
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    49   2e-05
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    50   2e-05
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    50   2e-05
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    49   2e-05
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    50   2e-05
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    50   2e-05
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    50   2e-05
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    49   2e-05
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    50   2e-05
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    50   2e-05
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    50   2e-05
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    50   2e-05
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    50   2e-05
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    50   2e-05
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    50   2e-05
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    50   2e-05
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    50   2e-05
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    49   2e-05
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    50   2e-05
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    50   2e-05
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    50   2e-05
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    50   2e-05
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    50   2e-05
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    50   3e-05
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    49   3e-05
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    50   3e-05
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    49   3e-05
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    49   3e-05
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    50   3e-05
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    49   3e-05
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             50   3e-05
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    50   3e-05
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    49   3e-05
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    49   3e-05
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    50   3e-05
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    50   3e-05
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    49   3e-05
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    49   3e-05
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    49   3e-05
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    49   3e-05
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    49   3e-05
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    49   3e-05
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    49   3e-05
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    49   3e-05
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    49   3e-05
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    49   4e-05
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    49   4e-05
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     49   4e-05
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    49   4e-05
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               49   4e-05
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    49   4e-05
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    49   4e-05
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    49   4e-05
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    49   4e-05
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    49   4e-05
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    49   4e-05
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    49   4e-05
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    49   4e-05
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    49   4e-05
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    49   4e-05
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     49   4e-05
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    49   4e-05
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    49   4e-05
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    49   5e-05
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    49   5e-05
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    49   5e-05
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    49   5e-05
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    49   5e-05
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    49   5e-05
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    49   5e-05
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    49   5e-05
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    49   5e-05
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    49   5e-05
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    49   5e-05
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...    49   5e-05
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    49   5e-05
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    48   5e-05
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    49   5e-05
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    48   5e-05
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    49   5e-05
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    47   5e-05
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    49   5e-05
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    49   6e-05
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    48   6e-05
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    49   6e-05
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    48   6e-05
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    48   7e-05
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    48   7e-05
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    49   7e-05
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    48   7e-05
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    49   7e-05
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    49   7e-05
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    49   7e-05
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    48   7e-05
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    48   8e-05
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    48   8e-05
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    48   8e-05
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...    48   8e-05
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    48   8e-05
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    48   8e-05
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    48   9e-05
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    48   9e-05
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    48   9e-05
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    48   9e-05
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    48   9e-05
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    47   9e-05
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    48   9e-05
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    48   9e-05
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    48   9e-05
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    48   1e-04
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    48   1e-04
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    48   1e-04
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    47   1e-04
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    48   1e-04
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    48   1e-04
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    47   1e-04
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    48   1e-04
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    48   1e-04
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    47   1e-04
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    48   1e-04
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     47   1e-04
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    48   1e-04
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    48   1e-04
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    48   1e-04
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    48   1e-04
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    47   1e-04
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    47   1e-04
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    48   1e-04
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    47   1e-04
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    48   1e-04
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      48   1e-04
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    48   1e-04
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               47   1e-04
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      48   1e-04
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    47   1e-04
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    47   1e-04
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    48   1e-04
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    48   1e-04
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    48   1e-04
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    48   1e-04
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    47   1e-04
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    47   1e-04
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    47   1e-04
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    47   1e-04
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    47   1e-04
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    47   1e-04
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    47   1e-04
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    47   1e-04
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    47   1e-04
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    47   1e-04
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    47   2e-04
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    47   2e-04
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    47   2e-04
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               47   2e-04
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    47   2e-04
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    47   2e-04
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    47   2e-04
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    47   2e-04
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    47   2e-04
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    47   2e-04
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    47   2e-04
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    46   2e-04
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    47   2e-04
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    47   2e-04
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...    47   2e-04
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    47   2e-04
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    47   2e-04
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    47   2e-04
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    47   2e-04
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    47   2e-04
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...    47   2e-04
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    47   2e-04
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    46   2e-04
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    46   2e-04
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    46   2e-04
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    47   2e-04
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    47   2e-04
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    47   2e-04
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    47   2e-04
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    46   2e-04
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    47   2e-04
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    46   2e-04
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    47   2e-04
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    47   3e-04
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    47   3e-04
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...    46   3e-04
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    46   3e-04
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      46   3e-04
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...    46   3e-04
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    46   3e-04
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    45   3e-04
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    46   3e-04
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    46   3e-04
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    46   3e-04
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    46   3e-04
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    46   3e-04
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...    46   3e-04
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    46   3e-04
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    46   3e-04
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    46   3e-04
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    46   3e-04
TBLA0B08810 Chr2 (2094401..2095375) [975 bp, 324 aa] {ON} Anc_2....    45   3e-04
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...    46   3e-04
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    46   3e-04
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    46   4e-04
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    46   4e-04
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...    46   4e-04
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    46   4e-04
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    46   4e-04
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    45   4e-04
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    46   4e-04
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    46   4e-04
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    46   4e-04
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    46   4e-04
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    46   4e-04
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    45   4e-04
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    46   4e-04
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    46   4e-04
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    46   4e-04
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    45   4e-04
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    45   4e-04
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    45   4e-04
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    45   4e-04
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               46   4e-04
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...    45   4e-04
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    45   5e-04
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    45   5e-04
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    46   5e-04
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    45   5e-04
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    45   5e-04
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    45   5e-04
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    45   5e-04
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    45   6e-04
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    45   6e-04
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    45   6e-04
TBLA0B06620 Chr2 complement(1556378..1559671) [3294 bp, 1097 aa]...    45   6e-04
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    45   6e-04
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    45   6e-04
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    45   6e-04
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    45   7e-04
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    45   7e-04
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    45   7e-04
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    45   7e-04
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    45   7e-04
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    45   7e-04
Suva_13.319 Chr13 (525309..526421) [1113 bp, 370 aa] {ON} YMR139...    45   7e-04
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    45   7e-04
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    45   8e-04
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    45   8e-04
Smik_13.338 Chr13 (528578..529690) [1113 bp, 370 aa] {ON} YMR139...    44   8e-04
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    45   9e-04
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    45   9e-04
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    45   9e-04
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    45   0.001
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...    45   0.001
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    44   0.001
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    44   0.001
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    44   0.001
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    44   0.001
YMR139W Chr13 (546125..547237) [1113 bp, 370 aa] {ON}  RIM11Prot...    44   0.001
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    44   0.001
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    44   0.001
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     44   0.001
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...    44   0.001
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    44   0.001
KAFR0B04630 Chr2 (964764..966302) [1539 bp, 512 aa] {ON} Anc_1.3...    44   0.001
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               44   0.001
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    44   0.001
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    44   0.001
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    44   0.001
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    44   0.001
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...    44   0.001
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    44   0.001
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    44   0.001
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    43   0.001
Skud_13.300 Chr13 (519521..520633) [1113 bp, 370 aa] {ON} YMR139...    44   0.002
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    43   0.002
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    44   0.002
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    44   0.002
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    44   0.002
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    44   0.002
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    44   0.002
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    44   0.002
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    44   0.002
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    44   0.002
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    44   0.002
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    43   0.002
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    44   0.002
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    43   0.002
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    44   0.002
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    44   0.002
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    43   0.002
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    43   0.002
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    43   0.002
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    43   0.002
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    44   0.002
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    43   0.002
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    43   0.002
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    43   0.003
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    43   0.003
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    43   0.003
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    43   0.003
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    43   0.003
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    42   0.003
NCAS0B07200 Chr2 complement(1363351..1364940) [1590 bp, 529 aa] ...    43   0.003
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    42   0.003
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    43   0.003
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    42   0.003
Suva_15.332 Chr15 complement(575263..575547,575959..576084,57614...    43   0.003
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...    42   0.004
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    43   0.004
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    43   0.004
NDAI0B04530 Chr2 complement(1128472..1130094) [1623 bp, 540 aa] ...    42   0.004
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    42   0.004
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    42   0.004
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    42   0.004
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    42   0.004
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    42   0.005
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    42   0.005
Skud_8.196 Chr8 complement(346056..346463,346494..347684) [1599 ...    42   0.005
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    42   0.006
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    42   0.006
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    42   0.006
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    42   0.006
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    42   0.006
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    42   0.006
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    42   0.007
KNAG0F01490 Chr6 (270931..272604) [1674 bp, 557 aa] {ON} Anc_2.1...    42   0.007
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    41   0.008
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    42   0.008
YHR135C Chr8 complement(372694..374310) [1617 bp, 538 aa] {ON}  ...    42   0.008
NCAS0G02120 Chr7 (381894..383465) [1572 bp, 523 aa] {ON} Anc_2.105     41   0.009
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    42   0.009
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    42   0.009
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    42   0.009
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    41   0.009
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....    41   0.010
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    42   0.010
TPHA0I01240 Chr9 (283537..285210) [1674 bp, 557 aa] {ON} Anc_2.1...    41   0.011
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    41   0.011
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    41   0.012
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    41   0.012
NDAI0F03150 Chr6 complement(757283..758923) [1641 bp, 546 aa] {O...    41   0.012
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    40   0.013
CAGL0J05940g Chr10 (562687..564147) [1461 bp, 486 aa] {ON} simil...    41   0.013
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    41   0.013
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    41   0.013
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    41   0.014
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...    41   0.014
AFR040W Chr6 (505602..507245) [1644 bp, 547 aa] {ON} Syntenic ho...    40   0.015
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    40   0.015
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    41   0.015
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    40   0.017
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    40   0.018
Smik_16.346 Chr16 (617471..618802) [1332 bp, 443 aa] {ON} YPR106...    40   0.019
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    40   0.019
CAGL0G06138g Chr7 complement(585585..587204) [1620 bp, 539 aa] {...    40   0.022
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    40   0.022
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    40   0.023
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    40   0.024
Skud_7.266 Chr7 (458004..460217) [2214 bp, 737 aa] {ON} YGL021W ...    40   0.024
Skud_16.391 Chr16 (704392..705723) [1332 bp, 443 aa] {ON} YPR106...    40   0.026
KAFR0A07320 Chr1 complement(1478564..1480033) [1470 bp, 489 aa] ...    40   0.026
Kpol_1027.20 s1027 complement(43412..44974) [1563 bp, 520 aa] {O...    40   0.028
Suva_14.185 Chr14 complement(340104..341789) [1686 bp, 561 aa] {...    40   0.028
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    39   0.028
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    40   0.030
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    40   0.030
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    40   0.032
Skud_14.179 Chr14 complement(334239..335924) [1686 bp, 561 aa] {...    40   0.033
Smik_8.216 Chr8 complement(349478..351145) [1668 bp, 555 aa] {ON...    39   0.034
Smik_14.174 Chr14 complement(323054..324709) [1656 bp, 551 aa] {...    39   0.035
YNL154C Chr14 complement(343636..345276) [1641 bp, 546 aa] {ON} ...    39   0.038
KNAG0H03710 Chr8 complement(687550..689184) [1635 bp, 544 aa] {O...    39   0.043
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    39   0.044
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    39   0.045
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    39   0.046
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    39   0.048
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    39   0.049
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    39   0.049
TBLA0D00250 Chr4 (61918..63618) [1701 bp, 566 aa] {ON} Anc_2.105...    39   0.050
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    39   0.052
SAKL0E12100g Chr5 complement(1004036..1005622) [1587 bp, 528 aa]...    39   0.054
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...    39   0.054
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    39   0.056
KLLA0D11044g Chr4 complement(942458..944068) [1611 bp, 536 aa] {...    39   0.057
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    39   0.067
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    39   0.067
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    39   0.072
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}               38   0.084
KLTH0B06204g Chr2 complement(502282..503778) [1497 bp, 498 aa] {...    38   0.087
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      38   0.094
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    38   0.096
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    38   0.10 
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    38   0.10 
CAGL0F03905g Chr6 complement(377962..380088) [2127 bp, 708 aa] {...    38   0.10 
TDEL0F00910 Chr6 (157379..159070) [1692 bp, 563 aa] {ON} Anc_2.1...    38   0.11 
Kwal_33.14596 s33 (735962..737464) [1503 bp, 500 aa] {ON} YNL154...    38   0.11 
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    38   0.11 
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...    38   0.11 
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    38   0.13 
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    37   0.14 
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    37   0.16 
Ecym_8100 Chr8 complement(214001..216547) [2547 bp, 848 aa] {ON}...    37   0.16 
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    37   0.17 
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    37   0.17 
YGL021W Chr7 (454785..457067) [2283 bp, 760 aa] {ON}  ALK1Protei...    37   0.18 
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    37   0.18 
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    37   0.18 
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    37   0.18 
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...    37   0.19 
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...    37   0.20 
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    37   0.21 
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    37   0.25 
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...    37   0.26 
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    37   0.26 
NDAI0E03210 Chr5 complement(686073..687317) [1245 bp, 414 aa] {O...    36   0.29 
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    36   0.32 
ADL053C Chr4 complement(589599..591014) [1416 bp, 471 aa] {ON} S...    36   0.34 
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    37   0.35 
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    36   0.40 
Kpol_1032.58 s1032 (133258..135336) [2079 bp, 692 aa] {ON} (1332...    36   0.44 
Ecym_2618 Chr2 (1196140..1197453) [1314 bp, 437 aa] {ON} similar...    36   0.44 
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    36   0.44 
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    36   0.46 
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    36   0.46 
YJL057C Chr10 complement(328118..330121) [2004 bp, 667 aa] {ON} ...    36   0.49 
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    36   0.52 
Suva_6.133 Chr6 (221952..223955) [2004 bp, 667 aa] {ON} YJL057C ...    36   0.55 
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    35   0.56 
ADL043C Chr4 complement(612088..614109) [2022 bp, 673 aa] {ON} S...    35   0.57 
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    35   0.63 
Skud_12.48 Chr12 complement(97218..99422) [2205 bp, 734 aa] {ON}...    35   0.65 
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    35   0.66 
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    35   0.71 
KAFR0D04250 Chr4 (837888..839207) [1320 bp, 439 aa] {ON} Anc_3.4...    35   0.72 
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    35   0.72 
CAGL0J05082g Chr10 (483782..485743) [1962 bp, 653 aa] {ON} simil...    35   0.75 
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    35   0.84 
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    35   0.89 
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    35   0.92 
SAKL0H24508g Chr8 (2123140..2124606) [1467 bp, 488 aa] {ON} unip...    35   0.95 
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    35   0.97 
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    35   0.98 
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    35   0.99 
KAFR0F00520 Chr6 (111106..112659) [1554 bp, 517 aa] {ON} Anc_2.1...    35   1.0  
Suva_12.258 Chr12 complement(423091..424422) [1332 bp, 443 aa] {...    35   1.1  
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    35   1.1  
Suva_10.55 Chr10 complement(110943..113177) [2235 bp, 744 aa] {O...    35   1.2  
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    34   1.2  
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    35   1.2  
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    34   1.3  
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    34   1.3  
TDEL0G01540 Chr7 complement(303940..306300) [2361 bp, 786 aa] {O...    34   1.4  
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    34   1.4  
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...    34   1.5  
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               34   1.7  
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    34   1.7  
ZYRO0G08316g Chr7 (677123..679465) [2343 bp, 780 aa] {ON} simila...    34   1.8  
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...    34   1.8  
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    34   1.8  
Kwal_47.17314 s47 complement(347091..348356) [1266 bp, 421 aa] {...    34   1.8  
YLL019C Chr12 complement(105686..107899) [2214 bp, 737 aa] {ON} ...    34   1.9  
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    34   1.9  
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    33   1.9  
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    34   2.1  
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    33   2.2  
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    33   2.8  
Kwal_26.7237 s26 complement(276089..277318) [1230 bp, 409 aa] {O...    33   2.9  
CAGL0H06787g Chr8 (676925..678154) [1230 bp, 409 aa] {ON} highly...    33   3.3  
Ecym_8392 Chr8 (803292..804806) [1515 bp, 504 aa] {ON} similar t...    33   3.5  
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             33   3.8  
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    32   4.4  
Kwal_47.18151 s47 (709368..710612) [1245 bp, 414 aa] {ON} YIL042...    32   4.7  
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    33   5.2  
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    33   5.4  
KLLA0E13531g Chr5 (1193481..1194902) [1422 bp, 473 aa] {ON} some...    32   8.2  
KLTH0E06952g Chr5 complement(639783..641045) [1263 bp, 420 aa] {...    32   8.4  

>SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 791

 Score = 1625 bits (4209), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 791/791 (100%), Positives = 791/791 (100%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVP 60
           MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVP
Sbjct: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVP 60

Query: 61  DKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFM 120
           DKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFM
Sbjct: 61  DKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFM 120

Query: 121 NTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSV 180
           NTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSV
Sbjct: 121 NTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSV 180

Query: 181 CGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCY 240
           CGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCY
Sbjct: 181 CGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCY 240

Query: 241 YTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQG 300
           YTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQG
Sbjct: 241 YTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQG 300

Query: 301 VPCPVKNFYLERKMLLQQQQQQQQQLQPLRHSVSQPQMEAITLPITLQPHPQKVLASAQV 360
           VPCPVKNFYLERKMLLQQQQQQQQQLQPLRHSVSQPQMEAITLPITLQPHPQKVLASAQV
Sbjct: 301 VPCPVKNFYLERKMLLQQQQQQQQQLQPLRHSVSQPQMEAITLPITLQPHPQKVLASAQV 360

Query: 361 SYANTGLTASPTAQQKLLYSRSQPLPARNDPFLNLDKSNLLPPKTKLEFPELKYNKEQLN 420
           SYANTGLTASPTAQQKLLYSRSQPLPARNDPFLNLDKSNLLPPKTKLEFPELKYNKEQLN
Sbjct: 361 SYANTGLTASPTAQQKLLYSRSQPLPARNDPFLNLDKSNLLPPKTKLEFPELKYNKEQLN 420

Query: 421 GIPATTPYATQRRSVSPVRNGRGDISKILKSNPTSVDRLSSYVDSETQTFETIEPLSRSV 480
           GIPATTPYATQRRSVSPVRNGRGDISKILKSNPTSVDRLSSYVDSETQTFETIEPLSRSV
Sbjct: 421 GIPATTPYATQRRSVSPVRNGRGDISKILKSNPTSVDRLSSYVDSETQTFETIEPLSRSV 480

Query: 481 SRSVSRGSASSASSQDSVEEQSTGGSFTRRIGDKLKRIISNEPRNTSPIRSRQNTGGSTR 540
           SRSVSRGSASSASSQDSVEEQSTGGSFTRRIGDKLKRIISNEPRNTSPIRSRQNTGGSTR
Sbjct: 481 SRSVSRGSASSASSQDSVEEQSTGGSFTRRIGDKLKRIISNEPRNTSPIRSRQNTGGSTR 540

Query: 541 SAFSTLRRGTSSNFSSDRSKRNSVDFSVRRLGSGGNKVRVSSSKSIEEKGNTNKFENKGH 600
           SAFSTLRRGTSSNFSSDRSKRNSVDFSVRRLGSGGNKVRVSSSKSIEEKGNTNKFENKGH
Sbjct: 541 SAFSTLRRGTSSNFSSDRSKRNSVDFSVRRLGSGGNKVRVSSSKSIEEKGNTNKFENKGH 600

Query: 601 NRSVSTSSITSDLNKYEGKAGSVSRGYNQAHSPIKMSANRESRNSIQKRVHDLLKNSQDS 660
           NRSVSTSSITSDLNKYEGKAGSVSRGYNQAHSPIKMSANRESRNSIQKRVHDLLKNSQDS
Sbjct: 601 NRSVSTSSITSDLNKYEGKAGSVSRGYNQAHSPIKMSANRESRNSIQKRVHDLLKNSQDS 660

Query: 661 PVRKTAPDFGEFSSFPQDHAADHTISDKVIDVHNVTSSPVVQKATLDTTHQSNTVVSPTR 720
           PVRKTAPDFGEFSSFPQDHAADHTISDKVIDVHNVTSSPVVQKATLDTTHQSNTVVSPTR
Sbjct: 661 PVRKTAPDFGEFSSFPQDHAADHTISDKVIDVHNVTSSPVVQKATLDTTHQSNTVVSPTR 720

Query: 721 KHFTRTREKPVPPPKPVRLRPKPPPKPFHLKVKNLVIPKKGRYSNRANTLSDEVDIDDLE 780
           KHFTRTREKPVPPPKPVRLRPKPPPKPFHLKVKNLVIPKKGRYSNRANTLSDEVDIDDLE
Sbjct: 721 KHFTRTREKPVPPPKPVRLRPKPPPKPFHLKVKNLVIPKKGRYSNRANTLSDEVDIDDLE 780

Query: 781 EDFKKRYPSAI 791
           EDFKKRYPSAI
Sbjct: 781 EDFKKRYPSAI 791

>Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {ON}
           YIL095W (PRK1) - probable serine/threonine-protein
           kinase [contig 27] FULL
          Length = 791

 Score =  759 bits (1961), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/809 (54%), Positives = 553/809 (68%), Gaps = 36/809 (4%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNS-SSIACLKRVLV 59
           M+QP    Y  GT LTVGSH+ARIIKYLTSGGFAHIYSAEISP DPNS  ++ACLKRVLV
Sbjct: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60

Query: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119
           PDK SLN LRAEVDAMKLL+ +K VVSYIDSHAAKS   +GSYEVFLLMEYC+ GGLIDF
Sbjct: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120

Query: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179
           MNTRLQNRL E EVLKIMS ++QG+AAMHAL PPLIHRDIKIENVLIS+D  FKVCDFGS
Sbjct: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180

Query: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239
           VCGVIRPPKN QE +YVQ+DILKNTTAQYRSPEMIDLYRG P++EKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240

Query: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299
           YYTTPFEK G+ AILHS+FQFPAYPQYSD+LKNLIS +L ENP QRPNICQ+L EVSRIQ
Sbjct: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300

Query: 300 GVPCPVKNFYLERKMLLQQQQQQQQQLQ----PLRHSVSQPQMEAITLPITLQP--HPQK 353
            VPCP++NFYL R M  QQQQ QQQQ       + HS+SQP+M+    P+ L P  H Q 
Sbjct: 301 NVPCPLRNFYLLRSMQQQQQQHQQQQQTFPSVEVHHSLSQPRMDLKNGPV-LTPFKHAQS 359

Query: 354 VLASAQVSYANTGLTASPTAQQKLLY-SRSQPLPA--RNDPFLNLDKSNLLPPKTKLEFP 410
                  ++    +  S      +L   ++QP+    R+DPF ++D+  +L  K  L+  
Sbjct: 360 SALRTSKTFDGAAMNGSINNYVPVLKPHQAQPVQQNYRSDPFTSIDRRTVLQEKIPLQPA 419

Query: 411 ELKYNK--EQLNGIPATTPYATQRRSVSPVRNGRGDISKILKSNPTSVDRLSSYVDSETQ 468
              + +       +P T   + +R S SP   GRGDIS I+ +NPT+VD    Y++S  Q
Sbjct: 420 SADFQRLSRAQTFVPVTK--SPKRSSASPSFGGRGDISMIVSANPTNVDPTPIYLNSSVQ 477

Query: 469 TFETIEPLSRSVSRSVSRGSASSASSQDSVEEQSTGGSFTRRIGDKLKRIISNEPRNTSP 528
           T      L   +S+  +R S SS SS +S+E QSTGGSF+R  G +LK++ + E R+ SP
Sbjct: 478 TDNPGSDL--YLSKQNTRLSESSTSSSESIETQSTGGSFSRTFGRRLKKVFTGEKRSISP 535

Query: 529 IRSRQNTGGSTRSAFSTLRRGTSSNFSSDR--SKRNSVDFSVRRLGSGGNKVRVSSSKSI 586
           I+SRQNTG S +SAF+TLRRG SS        SK+N+VD +     S G K RV+SS SI
Sbjct: 536 IKSRQNTGESVKSAFATLRRGFSSGSHKGEQLSKKNTVDVTTNGSSSNGYKFRVTSSDSI 595

Query: 587 EEKGNTNKFENKG----HNRSVSTSSITSDLNKYEGKAGSVSRGYNQAHSPIKMSANRES 642
           EE       EN G    H+R  S++SI SDL+  +  +G+ ++ Y ++HSP+K+S + ++
Sbjct: 596 EE-------ENSGFIYSHSRKASSTSIVSDLDSLQDDSGTNAKKYYRSHSPVKLSGSSDA 648

Query: 643 RNSIQKRVHDLLKNSQDSPVRKTAPDFGEFSSFPQDHAADHTISDKVIDVHNVTSSPVVQ 702
           R+SIQKRV +LLK+SQDSPV+K+A  +GE S      + +       +         VV 
Sbjct: 649 RSSIQKRVQNLLKSSQDSPVKKSAHGYGEVSEKEDKESPEQFTGKPAVAEARPIKRTVVP 708

Query: 703 KATLDTTHQSNTVVSPTRKHFTRTREKPVPPPKPVRLRPKPPPKPFHLKVKNLVIPKKGR 762
                ++ + +++V PT K+   T  K +  P  V  +PK P KP HLK   ++  K G 
Sbjct: 709 PPKRYSSVEFSSIV-PTAKN---TTAKDIEQPIRVHHKPKRPTKPPHLKADRII--KHGS 762

Query: 763 YSNRANTLSDEVDIDDLEEDFKKRYPSAI 791
            +      S +++I++LE+DF++R+PSA+
Sbjct: 763 STTENPRHSSDLEIEELEKDFQRRFPSAV 791

>KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p- Sla1p-End3p
           protein complex
          Length = 790

 Score =  711 bits (1835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/817 (54%), Positives = 562/817 (68%), Gaps = 53/817 (6%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNS-SSIACLKRVLV 59
           M+Q   + Y  GT LTVGSH+ARIIKYLTSGGFAHIY+AEI P D +S + IACLKRVLV
Sbjct: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60

Query: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119
           PDKPSLN LRAEVDAMKLL+ ++ VVSYIDSHAAKS +++GSYEVFLLMEYC+ GGLIDF
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120

Query: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179
           MNTRLQNRL+E EVLKI S ++QG+AAMHALQPPLIHRDIKIENVLIS+D  FKVCDFGS
Sbjct: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180

Query: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239
           VCGVIRPPKNPQE NYVQHDILKNTTAQYR+PEMIDLYRG P++EKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240

Query: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299
           YYTTPFEK GE AILHS+FQFP+YPQYSD LK+LIS +L ENP QRPNICQ+L EVSRIQ
Sbjct: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300

Query: 300 GVPCPVKNFYLERKMLLQQQQQQQQQLQPLRHSVSQPQMEA----ITLPITL---QP-HP 351
           G PCP++NFY+ R M  QQQ QQ +      HS SQP++++    I +P  +   QP   
Sbjct: 301 GTPCPLRNFYVTRAMQQQQQHQQPK--IKFDHSASQPKLDSANNIINVPFKMSHNQPLRS 358

Query: 352 QKVLASAQVSYANTGLTASPTAQQKLLYSRSQPLPAR-------NDPFLNLDKSNLLPPK 404
            +  A A V+ A+ G   +            +PLP +       N PF  ++ +  L  K
Sbjct: 359 TQTFAGAPVNAASNGYLPA-----------LKPLPIQPVSSSFTNGPFKFIEGNKALQSK 407

Query: 405 TKLEF-PELKYNKEQLNGIPATTPYAT--QRRSVSPVRNGRGDISKILKSNPTSVDRLSS 461
               F P + ++  +L      TP +T   R SVSP   GRGDISKI+ +NPT+V+    
Sbjct: 408 QTPHFQPPISHDFNRLGRSQTFTPTSTLASRSSVSPPLAGRGDISKIISANPTNVEPSPI 467

Query: 462 YVDSETQT---FETIEPLSRSVSRSVSRGSASSASSQDSVEEQSTGGSFTRRIGDKLKRI 518
           Y+ S TQT   F +   L    ++     S +S SS +SVE Q TGGS TRR G KLK +
Sbjct: 468 YLSSGTQTDDGFASSHALKLERTK-----SIASLSSSESVESQHTGGSATRRFGQKLK-V 521

Query: 519 ISNEPRNTSPIRSRQNTGGSTRSAFSTLRRGTS-SNFSSDR-SKRNSVDFSVRRLGSGGN 576
            + E R+ SPI+SRQNTG S RSAF+TLRRG S  +F S+  +KRNS+D S     S G 
Sbjct: 522 FTGERRSISPIKSRQNTGDSVRSAFATLRRGFSGGSFKSELPNKRNSLDISSTSSHSNGF 581

Query: 577 KVRVSSSKSIEEKGNTNKFENKGHNRSVSTSSITSDLNKYEGKAGSVSRGYNQAHSPIKM 636
           K RVSSS+SIEE+    +F +    RS S++SI SDL++ + +  + ++ Y ++HSP+K+
Sbjct: 582 KFRVSSSESIEEENVYPRFSHS---RSSSSASIVSDLDQLQ-QDDTGAKNYYKSHSPVKV 637

Query: 637 SANRESRNSIQKRVHDLLKNSQDSPVRKTAPDFGEFSSFPQDHAAD--HTISDKVIDVHN 694
           SA + SR+SIQKRV DLLKNSQDSPV+KTA  +G  S  P D AA+    ++++ + + N
Sbjct: 638 SATQGSRSSIQKRVQDLLKNSQDSPVKKTAHGYGMLS--PGDEAAELASQLTNETM-LQN 694

Query: 695 VTSSPVVQKATLDTTHQSNTVVSPTRKHFTRTREKPVPPPKPVRLRPKPPPKPFHLKVKN 754
           V  S       L    ++++VV    +  ++  E+     KP   +PK P KP HLK   
Sbjct: 695 VHQSTASTPKVLSPAKRNSSVVIKAGQQVSKDAEEVPSSRKPAPPKPKRPKKPSHLKADK 754

Query: 755 LVIPKKGRYSNRANTLSDEVDIDDLEEDFKKRYPSAI 791
           ++   +      +  +SD ++ID+LE+DFK+R+PSA+
Sbjct: 755 IIKEAETSAYEHSVDISD-IEIDELEKDFKRRFPSAV 790

>KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 777

 Score =  675 bits (1742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/840 (48%), Positives = 527/840 (62%), Gaps = 112/840 (13%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNS-SSIACLKRVLV 59
           M+QP +E Y SGT+L VGSH+ +++KYL SGGFAH+YS EISPPDP    ++ACLKRV+V
Sbjct: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60

Query: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119
           PDK SLN+LRAEVD+MK L+ +KF+VSYIDSHA KS +N G YEV+LLMEYC+ GGLIDF
Sbjct: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120

Query: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179
           MNTRLQNRL+EFE+L IMSQVSQGVAAMHALQPPLIHRDIKIENVL+S++  FK+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180

Query: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239
           V GVIR P+N +E NYVQ+DI+KNTTAQYR PEMIDLYRGLP+DEKSDIWALGVFLYK C
Sbjct: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240

Query: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299
           YYTTPFEK GE AIL SKF+FPAYP+YSD++KNLIS +LR +P++RPNICQ++ EVSRIQ
Sbjct: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300

Query: 300 GVPCPVKNFYLERKMLLQQQQQQQQQLQPLRHSVSQPQMEA-ITLP--ITLQPHPQKVLA 356
           G+PCP+KNFYL R M     +Q+Q ++ P  H    PQM    T+P  ++ Q  P +V++
Sbjct: 301 GIPCPIKNFYLLRMM----DKQEQPRVSPPPHV---PQMTVPATVPTSVSTQHLPPQVVS 353

Query: 357 SAQVSYANTGL---------TASPTAQQKLLYSRSQP----LP------ARNDPFLNLDK 397
           + Q       +          + P   Q+ L S+ QP    +P        +DPF  +D+
Sbjct: 354 NVQTPSKTASIQHLPYLHVSKSQPMVTQQDLLSQKQPAGKTVPQTVSNYTSSDPFSKIDR 413

Query: 398 SNLLPPKTKLE-------FPELKYNKEQLNGIPATTPYATQRRSVSPVRNGRGDISKILK 450
           S LL     +E        P+L+Y +  L      +     R SVSPVRNGRG IS IL 
Sbjct: 414 SALLSTSATMESLPRAMRIPQLEYQQPHLL---TRSQSVVPRASVSPVRNGRGAISSILA 470

Query: 451 SNPTSVDRLSSYVDSETQTFETIEPLSRSVSRSVSRGSASSASSQDSVEEQ-STGGSFTR 509
           SN TS+DR   YVDSETQT +   P    +SRS+SR S +S+ S     E  STGGS TR
Sbjct: 471 SNRTSLDR-PKYVDSETQTSD--HPSELGLSRSLSRKSVASSLSSAESLEATSTGGSLTR 527

Query: 510 RIGDKLKRIISNEPRNTSPIRSRQNTGGSTRSAFSTLRRGTSS-NFSSDRSKRNSVDFSV 568
           +IG K+K++I+ E R  S IRS QNTG S +SAF+ LR+G SS  F+ D S R S     
Sbjct: 528 KIGSKMKKVITGEKRGFSTIRSAQNTGESVKSAFNALRKGISSMQFTGDSSSRKS----- 582

Query: 569 RRLGSGGNKVRVSSSKSIEEKGNTNKFENKGHNRSVSTSSITSDLNKYEGKAGSVSRGYN 628
                   K R +S KSI E  ++N    K H RS S+ S   + N YE           
Sbjct: 583 ---SLEARKYRSTSGKSIPENTSSN---TKSHRRSTSSFSFVPENNDYELIEDI------ 630

Query: 629 QAHSP---IKMSANRESRNSIQKRVHDLLKNSQDSPVRKTAPDFGEFSSFPQDHAADHTI 685
           Q   P   ++ S++ ++ +SIQKRV DL+ N+ D P R +A  +G+++    D      I
Sbjct: 631 QKEKPKSSLRRSSSLKTSSSIQKRVKDLI-NADDIPNRSSATGYGKYT----DIGRKTDI 685

Query: 686 SDKVIDVHNVTSSPVVQKATLDTTHQSNTVVSPTRKHFTRTREKPVPPPKPVRLRPKPPP 745
           SD     H+ +          +   +S+TV++P  +        P    KP  L+P  PP
Sbjct: 686 SD-----HHKS----------NANRKSSTVITPVHEAPKSKPAPPP---KPAHLKPNLPP 727

Query: 746 KPFHLKVKNLVIPKKGRYSNRANTLSDEVDIDDLEED--------------FKKRYPSAI 791
           KP HLK K+           R +    EV   D ++D              F++R+PSA+
Sbjct: 728 KPKHLKAKSF----------RTSPAKSEVKEQDSDQDSVGSPFQSRKEMKEFERRFPSAL 777

>Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W
           (REAL)
          Length = 805

 Score =  637 bits (1644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/833 (46%), Positives = 516/833 (61%), Gaps = 70/833 (8%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNSSS-IACLKRVLV 59
           M+ P +  Y  GT+LTVGSH A+IIKYLTSGGFA +YSAEISPPDP SS+ IACLKRV+V
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYSAEISPPDPYSSANIACLKRVIV 60

Query: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119
           PDK  LN+LRAEVDAMKLLK +K VVSYIDSHAAKS +N  +YEVF+LMEYC RGGLIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGVAYEVFVLMEYCERGGLIDF 119

Query: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179
           MNTRL+NRL+E E+L IM Q  QG+AAMHALQPPLIHRDIKIENVLIS +G +KVCDFGS
Sbjct: 120 MNTRLKNRLQESEILDIMGQTVQGIAAMHALQPPLIHRDIKIENVLISHEGLYKVCDFGS 179

Query: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239
           V GVIRPPKNPQE NYVQHDIL NTTAQYRSPEMIDLYRGLP+DEKSDIWALGVFLYK+C
Sbjct: 180 VSGVIRPPKNPQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKIC 239

Query: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299
           YYTTPFEK GE AILH+++Q+P++PQYSD+LKNLI  +L E P QRPNICQ+L EVSR+Q
Sbjct: 240 YYTTPFEKTGEAAILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQ 299

Query: 300 GVPCPVKNFYLERKMLLQQQQQQQQQLQPLRHSVSQPQMEAITLPIT---LQPHPQKVLA 356
             PCP++NFYL R M       Q  Q      S++    + +  P +   +Q  P  V  
Sbjct: 300 NRPCPIRNFYLLRAM------NQNAQFGSESTSMTYTPAQQLVSPQSFQNIQAMPNIVPL 353

Query: 357 SAQVSYAN----TGLTASPTAQQKLLYSRSQPLPARNDPFLNLDKSNLLPPK---TKLEF 409
           S   +  N    +    +    + +L  R+Q L    +  + L K+  +P     T L +
Sbjct: 354 SNIKTTPNLDSASNFVNNNNKMEAMLQLRTQKLETGPNFSIPLTKTKSVPLSDDFTSLYY 413

Query: 410 PELKYNKEQLNGIPATTPYATQRRSV--SPVRNGRGDISKILKSNPTSVDRLSSYVDSET 467
            EL   ++           + QR+S+  SP      +  ++     ++++R ++YVDSET
Sbjct: 414 KELHPFQKPHTFKSVEGSQSPQRKSIPFSPTPVNSNNYDRV-----STINRPNNYVDSET 468

Query: 468 QTFETIEPLSRSVSRSVSRGSASSASSQDSVEEQSTGGSFTRRIGDKLKRIISNEPRNTS 527
           QT ++I  L    S ++S    +  S + +V E  TGG   R +  KLKR+I+ E RN S
Sbjct: 469 QTLDSIATLKLKPSPTIS-NKTTGFSKESTVPENVTGGKIVRSLSSKLKRVITGESRNGS 527

Query: 528 PIRSRQNTGGSTRSAFSTLRRG-TSSNFSSDRS---KRNSVDFSVRRL----GSGGNKVR 579
           PI+SRQNTG S RSAF  LR G T S+ ++ RS     N+ +   RRL     +  +   
Sbjct: 528 PIKSRQNTGDSIRSAFGMLRHGFTGSSINNSRSTSFDNNNANSVNRRLTSSSSNPSSSNL 587

Query: 580 VSSSKSIEEKGNTNKFENKGHNRSVSTSSITSDLNKYE-GKAGSVSRGYNQAHSPIK--- 635
            S +K  EE     K E   H RS+   SI SD +++E   + + SR Y ++HSP+K   
Sbjct: 588 NSDTKRKEELDKKRKLE---HRRSMP-PSILSDFDQHERNNSRTGSRDYYRSHSPVKKTQ 643

Query: 636 -----------------MSANRESRNSIQKRVHDLLKNSQDSPVRKTAPDFGEFSSFPQD 678
                            ++ ++E + SIQ+RVH+LL NS+DS   K+A  +G+++    D
Sbjct: 644 TTPTTTTRPSLKSSNSDINIDQEKKESIQRRVHNLLNNSEDSLSYKSASGYGKYT----D 699

Query: 679 HAADHTISDKVIDVHNVTSSPVVQKATLDTTHQSNTVVSPTRKHFTRTREKPVPPPKPVR 738
             A+ T     + +     +P+ ++   +  H SNT+   T          P PPPKP+ 
Sbjct: 700 TEAESTNRQSSVRI-----TPITEER-FNNYHSSNTMNDHTSSKDKPKSRPPRPPPKPLH 753

Query: 739 LRPKPPPKPFHLKVKNLVIPKKGRYSNRANTLSDEVDIDDLEEDFKKRYPSAI 791
           LR K         +++   P + R S+ A     +V++D+LE DF+KR+PS +
Sbjct: 754 LRTKIHNTRCSSNLQSRKPPME-RISSEATETIVDVNVDELEADFRKRFPSKV 805

>KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {ON}
           Anc_2.284 YNL020C
          Length = 780

 Score =  631 bits (1627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/834 (45%), Positives = 526/834 (63%), Gaps = 98/834 (11%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPN-SSSIACLKRVLV 59
           M+ P +ET+PSG +LTVGSH A++IKYLTSGG+A +Y  EISP DP  +S+IACLKRV+V
Sbjct: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60

Query: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119
           PDKPSLN+LRAEVDAMKLLK ++ VVSYIDSHA+KS++ NG+YEVF+LME+C RGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120

Query: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179
           MN+RLQ+RL E E+L IMS  SQG+AAMH LQP L+HRDIKIENVLIS++  +KVCDFGS
Sbjct: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180

Query: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239
           VCG++RPPKN QE N+V HDI+KNTTAQYRSPEM+DL +GLP++EKSDIWALGVFLYKLC
Sbjct: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240

Query: 240 YYTTPFEK-AGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRI 298
           YYTTPFEK  GE AIL ++FQ+P+YP YSD+LKNLI  +L +NP  RPN+CQ+L EVSR+
Sbjct: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300

Query: 299 QGVPCPVKNFYLERKMLLQQQQQQQQQLQPLRHSVSQPQMEAITLPITL-QPHPQKVLAS 357
           QG+PCP++NFYL R M            +  + ++ QP ++ + +P TL QP  Q  LAS
Sbjct: 301 QGIPCPIRNFYLLRAM------------ENNKRTIEQP-VQNVYMPTTLSQPSTQMNLAS 347

Query: 358 AQVSYANTGL-----TASPTAQQK--LLYSRSQPLPARNDPFLN------------LDKS 398
              +     L     T  PT Q    LL++++ PLP  + P               L KS
Sbjct: 348 LNDTLPTAALKFNQTTIPPTNQHSPHLLHTQTLPLPTNDHPVAISHVQDKISPHELLKKS 407

Query: 399 ------------NLLPPKTKLEFPELKYNKEQ--LNGIPATTPYATQRRSVSPVRNGRGD 444
                       N++       F +L +  +   L+  P T P ++   ++ P  N    
Sbjct: 408 SKSLGSTGTSNKNVIDTSAPDHFTKLLHASKNTDLSYQPVTVPTSSSLYNL-PRANLSSS 466

Query: 445 ISKILKSNPTSVD---RLSSYVDSETQTFETIEPLSRSVSRSVSRGSASSASSQDS-VEE 500
             K  KS   + D   R ++YVD ETQT+       R   R+ S  S  S SSQ S V+E
Sbjct: 467 PQKSWKSINDNYDVSKRPTNYVDEETQTYTGQSTFLR---RTSSNRSNRSISSQYSGVQE 523

Query: 501 QSTGGSFTRRIGDKLKRIISNEPRNTSPIRSRQNTGGSTRSAFSTLRRGTSSNFSSDRSK 560
            +TG S  R++  KLK +++ E      I+SRQNTG S RSA +++R G + N ++ RS 
Sbjct: 524 NTTGSSLVRKLSVKLKNVLTGES-----IKSRQNTGDSIRSAMNSIRSGFTGNNNNTRSA 578

Query: 561 RNSVDFSVRRLGSGGNKVRVSSSKSIEEKGNTNKFENKGHNRSVSTSSITSDLNKYEGK- 619
             S D + +RL S    V +    +I E+ ++++FE   +N SVS++++  D+ ++E + 
Sbjct: 579 --SYD-NGKRLSS----VNLHMHSAILEQDDSDEFEMPRYN-SVSSNTL-KDVEEHERRT 629

Query: 620 AGSVSRGYNQAHSPIKMSANRESRNSIQKRVHDLLKNSQD--SPVRKTAPDFGEFSSFPQ 677
             + SR Y ++ SP++MS NRE +NSIQKRV DLLKN+++  +   +TA  +G+++ +  
Sbjct: 630 VNTSSREYYRSQSPVRMSVNREMKNSIQKRVQDLLKNAEENTTATVRTASGYGKYTDY-- 687

Query: 678 DHAADHTISDKVIDVHNVTSSPVVQKATLDTTHQSNTVVSPTRKHFTRTREKPVPPPKPV 737
                    +K  D  + T S V Q       +QS   ++      +  R+KP  P K  
Sbjct: 688 ---------NKNKDEISPTKSRVAQ------FNQSTAALAS----LSGKRKKPPVPYKRD 728

Query: 738 RLRPKPPPKPFHLKVKNLVIPKKGRYSNRANTLSDEVDIDDLEEDFKKRYPSAI 791
            L+P PP KP  L  + +      R S+ A  +  ++ +DD+E+D ++R+PS +
Sbjct: 729 SLKPTPPAKPAFLSSRPVA---SSRVSSNATDMLVDLSVDDIEKDIRRRFPSTV 779

>Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W
           (REAL)
          Length = 809

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/844 (45%), Positives = 516/844 (61%), Gaps = 88/844 (10%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNSSS-IACLKRVLV 59
           M+ P +  Y  GTVLTVGSH A+IIKYLTSGGFA +Y+AEISPPDP S++  ACLKRV+V
Sbjct: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60

Query: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119
           PDK  LN+LRAEVDAMKLLK +K VVSYIDSHAAKS +N  +YEVF+LME+C RGGLIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGIAYEVFVLMEFCERGGLIDF 119

Query: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179
           MNTRLQ+RL+E E+L+IMSQ  QG+AAMH LQPPLIHRDIKIENVLIS DG +KVCDFGS
Sbjct: 120 MNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGS 179

Query: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239
           V GVIRPP+N QE NYVQHDIL NTTAQYRSPEMIDLYR  P+DEKSDIWALGVFLYK+C
Sbjct: 180 VSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKIC 239

Query: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299
           YYTTPFEK+GE AILHS++Q+P++PQYSD+LK LI  +L E P QRPNICQ+L EVSR+Q
Sbjct: 240 YYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQ 299

Query: 300 GVPCPVKNFYLERKM--------------------LLQQQQQQQ----QQLQPLRHSVSQ 335
             PCP++NFYL R M                    LL  Q  Q     Q + P+ H  + 
Sbjct: 300 NEPCPIRNFYLLRAMGQNAQLASEPPSVTYVSAQQLLPAQTLQGIKHLQSMVPVTHVRTT 359

Query: 336 PQMEAITLPITLQPHPQKVLASAQVSYANTGLTASPTAQQKLLYSRSQPLPARNDPFLNL 395
           P +  +T  IT     + +L       ++  L  +P     L+ ++S PL   +D F +L
Sbjct: 360 PNLGTLTKAITNNNQTESILPVRTQPESDLNL-GNP-----LMKTKSVPL---SDDFASL 410

Query: 396 DKSNLLPPKTKLEFPELKYNKEQLNGIPATTPYATQRRSVSPVRNGRGDISKILKSNPTS 455
               L P +    F  ++  +     +  +TP      S SPV +   D     +++ ++
Sbjct: 411 YYRELHPFQKSQTFKSVESFQSPQRKL--STP-----SSSSPVNSKNND-----RASTST 458

Query: 456 VDRLSSYVDSETQTFETIEPLSRSVSRSVSRGSASSASSQDSVEEQSTGGSFTRRIGDKL 515
           VDR ++YVDS TQT + +  L+ + S SV+    S    +  V E  TGGS  R +  KL
Sbjct: 459 VDRPNNYVDSVTQTIDNMAALNLNQS-SVAINKPSGPPKESIVPENVTGGSIVRSLSSKL 517

Query: 516 KRIISNEPRNTSPIRSRQNTGGSTRSAFSTLRRG-TSSNFSSDRS------KRNSVDFSV 568
           K++I+ E R++SPI+SRQNTG S RSAF  LR G T S+ S++R+        N    SV
Sbjct: 518 KKVITGESRSSSPIKSRQNTGDSIRSAFGMLRHGLTGSSVSNNRTISFDSNNGNGNGNSV 577

Query: 569 RRLGSGGNKVRVSSSKSIEEKGNTNKFENKGHNRSVSTSSITSDLNKYE-GKAGSVSRGY 627
            R  +  +    + +   + + + +K + K  NR     SI SD +K+E   + + SR Y
Sbjct: 578 NRRLASSSSSSSNFNFDTKRQDDLDK-KQKLENRRSMPPSILSDFDKHERNNSRTGSRDY 636

Query: 628 NQAHSPIK--------------------MSANRESRNSIQKRVHDLLKNSQDSPVRKTAP 667
            ++HSP+K                    +   + ++ SIQ+RVH+LL NS+D    K+A 
Sbjct: 637 YRSHSPVKKNQTTPKTASRTTLKSDSSDIDVKQVNKESIQRRVHNLLNNSEDPLAHKSAS 696

Query: 668 DFGEFSSFPQDHAADHTISDKVIDVHNVTSSPVVQKATLDTTHQSNTVVSPTRKHFTRTR 727
            +G+++    + +  H+         +V  +P+ +    +  + S T+   T ++     
Sbjct: 697 GYGKYTDVNAEASNRHS---------SVRITPITE-GKFNKYYNSGTLKGETSRNDKHKS 746

Query: 728 EKPVPPPKPVRLRPKPPPKPFHLKVKNLVIPKKGRYSNRANTLSDEVDIDDLEEDFKKRY 787
             P PPPKP+ LR +        ++++   P+  R S+ A     +V++DDLE DF+KR+
Sbjct: 747 RPPRPPPKPLHLRTEIQNTRNFSRLQSRQ-PQMERISSEATETIVDVNVDDLEADFRKRF 805

Query: 788 PSAI 791
           PS +
Sbjct: 806 PSKV 809

>YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protein
           serine/threonine kinase; regulates the organization and
           function of the actin cytoskeleton and reduces endocytic
           ability of cell through the phosphorylation of the
           Pan1p-Sla1p-End3p protein complex
          Length = 810

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/867 (43%), Positives = 505/867 (58%), Gaps = 133/867 (15%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNSSS-IACLKRVLV 59
           M+ P +  Y  GT+LTVGSH A+IIKYLTSGGFA +Y+AEISPPDP S++ IACLKRV+V
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANIACLKRVIV 60

Query: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119
           P K  LN+LRAEVDAMKLL+ +K VVSYIDSHAA+S +N  +YEVF+LME+C RGGLIDF
Sbjct: 61  PHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARS-VNGIAYEVFVLMEFCERGGLIDF 119

Query: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179
           MNTRLQNRL+E E+L+IMSQ  QG+ AMHALQPPLIHRDIKIENVLIS DG +KVCDFGS
Sbjct: 120 MNTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYKVCDFGS 179

Query: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239
           V GVIRPP+N QE NYVQHDIL NTTAQYRSPEMIDLYRGLP+DEKSDIWALGVFLYK+C
Sbjct: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKIC 239

Query: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299
           YYTTPFEK+GE  ILH+++Q+P++PQYSD+LKNLI  +L E P QRPNICQ+L EVSR+Q
Sbjct: 240 YYTTPFEKSGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQ 299

Query: 300 GVPCPVKNFYLERKMLLQQQQQ--------------------------QQQQLQPLRHSV 333
             PCP++NFYL R M      Q                          Q   + P+ H  
Sbjct: 300 NKPCPIRNFYLLRAMNQNANTQLAGEPSSTTYVPTQKFIPVQSLQSINQPPNMMPVTHVS 359

Query: 334 SQPQMEAITLPITLQPHPQ-KVLASAQVSYANTGLTASPTAQQKLLYSRSQPLPARNDPF 392
           + P +   T PI++  + + +V A A +   +     SP     L+ ++S PL   +D F
Sbjct: 360 TTPNLG--TFPISINDNNKTEVTAHAGLQVGSHSNLTSP-----LMKTKSVPL---SDEF 409

Query: 393 LNLDKSNLLPPKTKLEFPELK-YNKEQLNGIPATTPYATQRRSVSPVRNGRGDISKILKS 451
            +L    L P +    F  ++ +   Q   +P          S++PV N   D       
Sbjct: 410 ASLYYKELHPFQKSQTFKSVESFQSPQRKSMPPL--------SLTPVNNDIFD------- 454

Query: 452 NPTSVDRLSSYVDSETQTFETIEPLSRSVSRSVSRGSASSASSQDSVEEQSTGGSFTRRI 511
             ++++R ++YVDSETQT + +   +  +S +++  S SS + + +  +   G    R +
Sbjct: 455 RVSAINRPNNYVDSETQTIDNMAVPNLKLSPTITSKSLSS-TKEIAAPDNINGSKIVRSL 513

Query: 512 GDKLKRIISNEPRNTSPIRSRQNTGGSTRSAFSTLRRGTSSNFSSDRSKRNSVDFSVRRL 571
             KLK++I+ E R  SPI+SRQNTG S RSAF  LR G + N S + S+  S D +    
Sbjct: 514 SSKLKKVITGESRGNSPIKSRQNTGDSIRSAFGKLRHGFTGN-SVNNSRSASFDNNNVNG 572

Query: 572 GSGGNKVR-VSSSKSIEEKGN--TNKFENKGHNRSVSTS-----SITSDLNKYE-GKAGS 622
                  R VSSS S   K N  T + E    N+ +        SI SD +++E   + +
Sbjct: 573 NGNNTNRRLVSSSTSSFPKFNSDTKRKEESDKNQRLEKRRSMPPSILSDFDQHERNNSRT 632

Query: 623 VSRGYNQAHSPIK--------------------MSANRESRNSIQKRVHDLLKNSQDSPV 662
            SR Y ++HSP+K                    ++ N+E + SIQ+RVH+LLK+S D   
Sbjct: 633 GSRDYYRSHSPVKKTQASAKTTSKPTLIPDNGNVNINQEKKESIQRRVHNLLKSSDDPVT 692

Query: 663 RKTAPDFGEFSSFPQDHAADHTISDKVIDVHNVTSSPVVQKATLDTTHQSN--------- 713
            K+A  +G+++    + +  H+ S ++  +        ++   LD   +SN         
Sbjct: 693 YKSASGYGKYTDIGTETSNRHS-SVRITPITEEKFKKTLKDGVLDIKTKSNGKDKSRPPR 751

Query: 714 ---------TVVSPTRKHFTRTREKPVPPPKPVRLRPKPPPKPFHLKVKNLVIPKKGRYS 764
                    T +   R +F+R + K +P                             R S
Sbjct: 752 PPPKPLHLRTEIQKIR-NFSRLQSKKLPIE---------------------------RIS 783

Query: 765 NRANTLSDEVDIDDLEEDFKKRYPSAI 791
           + A     +V++DDLE DF+KR+PS +
Sbjct: 784 SEATETIVDVNVDDLEADFRKRFPSKV 810

>NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {ON}
           Anc_2.284
          Length = 756

 Score =  614 bits (1583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/808 (46%), Positives = 499/808 (61%), Gaps = 72/808 (8%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNS-SSIACLKRVLV 59
           M+QP +  YP+GT+LTVG+H+A I KYLTSGGFA IY+ EI+P D  S S++ACLKRV+V
Sbjct: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60

Query: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119
           P K  LN+LRAEVDAMKLLK ++ VVSYIDS+A KS+ NNGSYEV LLMEYC  GGLIDF
Sbjct: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120

Query: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179
           MN+RLQNRL E E+L I+SQ +QGVA MHALQP L+HRDIKIENVL S +G FK+CDFGS
Sbjct: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180

Query: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239
           VCG IRPP+N QEL+YVQHDILKNTTAQYR PEM+DLYRGLP+DEKSDIWALGVFLYKLC
Sbjct: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299
           YYTTPFEK GE AILHSKFQ+PA+P YSD+LKNLI  +L ENP +RPNIC+LL E+S IQ
Sbjct: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300

Query: 300 GVPCPVKNFYLERKMLLQQQQQQQQQLQPLRHSVSQP--QMEA--ITLPITLQPHPQKVL 355
           GVPCP++NFYL R   L  Q Q Q+Q    + + +QP  Q+ A   T+PI          
Sbjct: 301 GVPCPIQNFYLIRAQQLANQIQLQRQTTVPKIATAQPIQQLNARTQTMPII--------- 351

Query: 356 ASAQVSYANTGLTASPTAQQKLLYSRSQPLPARNDPFLNLDKSNLLPPKTKLEFPELKYN 415
                + ANT L    T     + S +  LPA     L++      P   K  +  +K +
Sbjct: 352 ----NTKANTSLVTPITVP---VLSENTRLPALE---LDIKVPQFSPSLDKDMY--MKLH 399

Query: 416 KEQLNGIPATTPYATQRRSVSPVRNGRGDISKILKSNPTSVD----RLSSYVDSETQTFE 471
             Q +G    TP  T   SVSP+R     IS+    + T+ D    R S Y   + Q+  
Sbjct: 400 PFQKSGT-LLTPSKTA--SVSPIRRY---ISRSPSRDNTNYDIQRRRTSQYDHDQNQS-- 451

Query: 472 TIEPLSRSVSRSVSRGSASSASSQDSVEEQSTGGSFTRRIGDKLKRIISNEPRNTSPIRS 531
               + RS+SR+ S  S S+ S + +++  +TG SF ++  +K+KR+++ E RN SPIRS
Sbjct: 452 --NYMGRSLSRTSSIKSTSALSFEGNLQGNNTGDSFAQKFTNKIKRVVTGESRNASPIRS 509

Query: 532 RQNTGGSTRSAFSTLR-------RGTSSNFSSDRSKRNSVDFSVRRLGSGGNKVRVSSSK 584
           RQ+TGGS RSAF  +R       R  S + +++ S  N+ + +  R  S G    +++  
Sbjct: 510 RQDTGGSVRSAFGAIRGAFTGSMRAPSLDNNTNNSMHNNSNNNTSRNSSYGRHNIITN-- 567

Query: 585 SIEEKGNTNKFENKGHNRSVSTSSITSDLNKYE-GKAGSVSRGYNQAHSPIKMSANRESR 643
            I+E+ + N  + K   R      +  DL   E    G  +  Y ++HSP K    + +R
Sbjct: 568 PIKEEDSRNMTKAKLAKRHTMPPGMLYDLENLEIENEGYHASEYYRSHSPTKPFVTKTTR 627

Query: 644 NSIQKRVHDLLKNSQDSPVRKTAPDFGEFSSFPQDHAADHTISDKVIDVHNVTSSPVVQK 703
           ++IQ+RV +LL  S+  P+ +   D          +A  H++  + ++            
Sbjct: 628 DNIQQRVQNLLSESEQ-PMERNNIDTH------HTNAVSHSMIPRNLNSREK-------- 672

Query: 704 ATLDTTHQSNTVVSPTRKHFTRTREKPVPPPKPVRLRPKPPPKPFHLKVKNLVIPKKGRY 763
              D+   S+ V++P     +  ++ P  P KP  LRPKPPPKP +L      +  K R 
Sbjct: 673 ---DSLRYSSVVINPLEDIGSSPKKAPPLPFKPHHLRPKPPPKPTYLS----KMFSKERI 725

Query: 764 SNRANTLSDEVDIDDLEEDFKKRYPSAI 791
           S+ A      +D+D LE DF+KR+PS +
Sbjct: 726 SSTATEQLVTLDVDTLERDFRKRFPSTL 753

>NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa]
           {ON} Anc_2.284
          Length = 723

 Score =  611 bits (1575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/806 (46%), Positives = 476/806 (59%), Gaps = 98/806 (12%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDP-NSSSIACLKRVLV 59
           M+QP + TYP GT+LTVGSH  +IIKYLTSGGFA IY+ EISP +P N+S  ACLKRV+V
Sbjct: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60

Query: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119
           PDK  LN+LRAEVDAMKLLK ++ VVSYIDSHAA+S++  G+YEVFLLMEYC  GGLIDF
Sbjct: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120

Query: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179
           MNTRLQNRL E E+L I+SQ  QGV+AMHALQP LIHRDIKIENVLIS  G FK+CDFGS
Sbjct: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180

Query: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239
           VC  IRPP+NPQEL YVQHD+LKNTTAQYR+PEM+DLYRGLP++EKSDIWALGVFLYKLC
Sbjct: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240

Query: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299
           YYTTPFEK GE AILHS++Q+PA+P Y+D+LKNLI A L E+P +RPNICQLL E+SRIQ
Sbjct: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300

Query: 300 GVPCPVKNFYLERKMLLQQQQQQQQQLQPLRHSVSQPQMEAITLPITLQPHPQKVLASAQ 359
           G+PCP+ NFYL R + +Q           L + +  P  +      T   H Q     + 
Sbjct: 301 GIPCPINNFYLSRTINVQAS---------LMNPIITPTQQ------TALKHSQSSATISD 345

Query: 360 VSYANTGLTASPTAQQKLLYSRSQPLPARNDPFLNLDKSNLLPPKTKLEFPELKYNKE-- 417
            SYA             L  SRS      N P L            + E P++    +  
Sbjct: 346 QSYA-----------VPLASSRSSTTTG-NKPIL-----------IETEIPDMSQGSDDV 382

Query: 418 --QLNGIPATTPYATQRRSVSPVRNGRGDISKILKSNPTSVDRLSSYVDSETQTFETIEP 475
             +++    +    T  RS SP++     + K   SN  +    S YVDSETQTF T   
Sbjct: 383 YSRIHPFQKSQTLRTPSRSSSPIKYTGTLLQKSTSSNSNTSGNKSHYVDSETQTFST--- 439

Query: 476 LSRSVSRSVSRGSASSASSQDSVEEQSTGGSFTRRIGDKLKRIISNEPRNTSPIRSRQNT 535
            S       S   ++S+ S D ++E  TGGS T+     LKR+++ E RNTSPIRSRQNT
Sbjct: 440 -SSRRLSRSSSVRSASSRSSDQLKEHRTGGSITQFFTSTLKRVVTGESRNTSPIRSRQNT 498

Query: 536 GGSTRSAFSTLRRGTSSNFSSDRSKRNSVDFSVRRLGSGGNKVRVSSSKSIEEKGNTNKF 595
           GGS RSAF  LR G + N +S  S       +        +      S + +E       
Sbjct: 499 GGSIRSAFDALRSGITGNTNSRVS-----SLASSVRNVSSSSKHSKHSDADDEPNKIKIR 553

Query: 596 ENKGHNRSVSTSSITSDLNKYEGKAGSVSRGYNQAHSPIKMSANRESRNSIQKRVHDLLK 655
             K H RSV   ++ SD    E      S     ++SP+K+ +    R SIQ RV  LL+
Sbjct: 554 MKKAHRRSVP-PNLYSDFYANEDTPKLYS-----SNSPVKLKSLSTQRESIQNRVKALLE 607

Query: 656 NSQDSP-VRKTAPDFGEFSSFPQDHAADHTISDKVIDVHNVTSSPVVQKATLDTTHQSNT 714
             ++ P   KTA  +G+++                 D   +T SPV ++           
Sbjct: 608 TFEEEPSTIKTASGYGKYT-----------------DSEFIT-SPVPERG--------GR 641

Query: 715 VVSPTRKHFTRTREKPVPP---------PKPVRLRPKPPPKPFHLKVKNLVIPKKGRYSN 765
           + +PT K ++     PV           PKP  LRP PPPKP  L   + + P + R S+
Sbjct: 642 IPTPTNKRYSSVIINPVTEPISIRPSPPPKPKHLRPIPPPKPTRL---SKIYPDE-RISS 697

Query: 766 RANTLSDEVDIDDLEEDFKKRYPSAI 791
            A      +D++ LE+DFK+R+PS I
Sbjct: 698 TATERIVNLDVESLEKDFKRRFPSRI 723

>Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W
           (REAL)
          Length = 808

 Score =  609 bits (1570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/864 (44%), Positives = 520/864 (60%), Gaps = 129/864 (14%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDP-NSSSIACLKRVLV 59
           M+ P +  Y  GT+LTVGSH A+IIKYLTSGGFA +Y+AEISPPDP  +++IACLKRV+V
Sbjct: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60

Query: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119
           PDK  LN+LRAEVDAMKLLK +K VVSYIDSHAAKS +N  +YEVF+LME+C RGGLIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGVAYEVFVLMEFCERGGLIDF 119

Query: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179
           MNTRLQNRL+E E+L+IMSQ  QG+AAMHALQPPLIHRDIKIENVLIS +G +KVCDFGS
Sbjct: 120 MNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGS 179

Query: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239
           V GVIRPP+N QE NYVQHDIL NTTAQYRSPEMIDLYRGLP+DEKSDIWALG+FLYK+C
Sbjct: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKIC 239

Query: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299
           YYTTPFEK+GE  ILH+++Q+P +PQYSD+LKNLI  +L E P +RPNICQ+L EVSR+Q
Sbjct: 240 YYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQ 299

Query: 300 GVPCPVKNFYLERKMLLQQQQQQQ---------------QQLQ---------PLRHSVSQ 335
             PCP++NFYL R M    Q   +               Q LQ         P+ H  + 
Sbjct: 300 IKPCPIRNFYLLRAMSQTAQLASEPPSMKYVPTQKFLPAQGLQSMKPISNMIPVSHVRTT 359

Query: 336 PQMEAITLPITLQPHPQKVLASAQVSYANTGLTASPTAQQKLLYSRSQPLPARNDPFLNL 395
           P +   TLP ++  +      + Q+S    G +   T  +K   ++S PL   +D F +L
Sbjct: 360 PNLS--TLPRSIDDN-NMTDVTKQISLQFVGDSNVDTPLKK---TKSVPL---SDDFASL 410

Query: 396 DKSNLLPPKTKLEFPELKYNKEQLNGIPATTPYATQRRSVSPVRNGRGDISKILKSNPTS 455
               L P +    F  ++  +            + QRRS+ P      + S IL   PT 
Sbjct: 411 YYRELHPFQKSQTFKSVENFQ------------SPQRRSMPPSSLPPAN-SIILDKTPT- 456

Query: 456 VDRLSSYVDSETQTFETIEPLSRSVSRSVSRGSASSASSQDSVEEQSTGGSFTRRIGDKL 515
           ++R ++YVDSETQT + I      +S +++    +S   +    E  +GG+  R +  KL
Sbjct: 457 MNRPNNYVDSETQTTDIITMSGSKLSPALTNKPVNS-QKEFIAPENVSGGNIVRSLSSKL 515

Query: 516 KRIISNEPRNTSPIRSRQNTGGSTRSAFSTLRRG-TSSNFSSDRS-------KRNSVDFS 567
           K++I+ E R +SPI+SRQNTG STRSA   LR G T S+ +++RS         ++ +  
Sbjct: 516 KKVITGESRGSSPIKSRQNTGDSTRSALGMLRHGFTGSSMNNNRSASFDSNNGSSNNNSV 575

Query: 568 VRRLG---SGGNKVRVSSSKSIEEKGNTNKFENKGHNRSVSTSSITSDLNKYEG-KAGSV 623
            RRLG   +    V    +K  EE     K EN+   RS+  SSI SD +++E   + + 
Sbjct: 576 NRRLGSSSTSSLSVFNPDTKRQEEIDKKQKLENR---RSMP-SSILSDFDQHERINSRTG 631

Query: 624 SRGYNQAHSPIK--------------------MSANRESRNSIQKRVHDLLKNSQDSPVR 663
           SR Y ++HSP+K                    ++ N+E + SIQ+RVH+LLK+S+D    
Sbjct: 632 SRDYYRSHSPVKKIQTTSKSAPKPITKPVIGDININQEKKESIQRRVHNLLKSSEDPLTY 691

Query: 664 KTAPDFGEFSSFPQDHAADHTISDKVIDVHNVTSSPVVQK--ATLDTTHQSNTVVSPTRK 721
           K+A  +G+++    + +  H+         +V  +P+ ++   + +    SN       +
Sbjct: 692 KSASGYGKYTDTDTETSNRHS---------SVRITPITEEKFKSRNKNGLSNNKTKDNDR 742

Query: 722 HFTRTREKPVPPPKPVRLRPKPPPKPFHLKVKNLVIPKKGRYSNRANT--LSDE------ 773
           H +R    P               KP HL+ +     +K R S+R ++  LS E      
Sbjct: 743 HKSRPPRPPP--------------KPLHLRAE----IQKVRSSSRLHSGELSSERISSDA 784

Query: 774 ------VDIDDLEEDFKKRYPSAI 791
                 V++DDLE DF+KR+PS +
Sbjct: 785 TETIVEVNVDDLEADFRKRFPSKV 808

>Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar to
           Ashbya gossypii ADL217W
          Length = 748

 Score =  593 bits (1528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/771 (48%), Positives = 477/771 (61%), Gaps = 62/771 (8%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVP 60
           M+Q P +++  GTVLTVGSHK +++KYLTSGGFA IY  E+  PD     +ACLKRV VP
Sbjct: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVP 60

Query: 61  DKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFM 120
           DK SLN+LRAEVDAMKLL+ +K +VSYIDSHA+KS LNNGSYEV LLMEYC+RGGLI FM
Sbjct: 61  DKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFM 120

Query: 121 NTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSV 180
           NTRLQ+RLKEFEVL+IM+QV QG+ AMHALQPPLIHRDIKIENVLI+E+G+ KVCDFGSV
Sbjct: 121 NTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSV 180

Query: 181 CGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCY 240
           CGVIRPPKN  EL+YVQHDILKNTTAQYR+PEMIDLYRG  VDEKSDIWALGVFLYKLCY
Sbjct: 181 CGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCY 240

Query: 241 YTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQG 300
           YTTPFEK GEVAIL + FQFP+YPQYS++LKNLI+ +L ENP+ RPN CQ+L EV RIQG
Sbjct: 241 YTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQG 300

Query: 301 VPCPVKNFYLERKMLLQQQQQQQQQLQPLRHSVSQPQM----EAITLPITLQPHPQKVLA 356
            PCPVKNFYLER   L+QQ   Q     LRHSVSQP +    +   +PI +      VL 
Sbjct: 301 QPCPVKNFYLERS--LKQQIPSQ-----LRHSVSQPMIAMNPQQAKIPIVIPQVQNSVLP 353

Query: 357 SAQVSYANTGLTASPTAQQKLLYSRSQPLPARNDPFLNLDKSNLLPP-----KTKLEFPE 411
           S  ++         P          SQP   R D  L + K+ LL       KT+   P 
Sbjct: 354 SNTMNMGYVTGAFQPA---------SQPNEVRGDTALRVSKAKLLSTACDWDKTQNFVPG 404

Query: 412 LKYNKEQL--NGIPATTPYATQRRSVSPVRNGRGDISKILKSNPTSVDRLSSYVDSETQT 469
             YN +    +G   T+   T R SVSPVR+GRG+I+KI+ +NP ++ R   YVDSE QT
Sbjct: 405 SNYNSKASVESGHLPTSSLPTPRSSVSPVRSGRGNINKIIAANPINIKR-PVYVDSEMQT 463

Query: 470 FETIEPLSRSVSRSVSRGSASSASSQDSVEEQSTGGSFTRRIGDKLKRIISNEPRNTSPI 529
            + +  L ++ SR +S  S SS  SQ+S     TG S       + +  ++ + +N   +
Sbjct: 464 TD-LASLKKANSRPLSL-SLSSLPSQESFSLHYTGISAVES-SQQFQGPVTFD-KNNLLV 519

Query: 530 RSRQNTGGSTRSAFSTLRRGTSSNFSS-DRSKRNSVDFSVRRLGSGGNKVRVSSSKSIEE 588
            S+ NTG S  S+   + R    ++ + + +   S + S ++L      ++   S S  E
Sbjct: 520 NSKSNTGDSKSSSPELINRTLRYSYHAPEPASWESSEMSSKKLPYLNAILKTPKSLSAAE 579

Query: 589 KGNTNKFE---NKGHNRSVSTS-SITSDLNKYEGKAGSVSRGYNQAHSPIKMSANRESRN 644
              + + E   +   N  ++   ++  D   Y   +G +          + + + +  + 
Sbjct: 580 VSESRRSELERDSLANVPINNEYAVDPDSGGYHPSSGGL----------VSLLSTKNGQV 629

Query: 645 SIQKRVHDLLKNSQD----SPVRKTAPDFGEFSSFPQDHAADHTISDKVIDVHNVTSSPV 700
           SIQKRVH LL NS      S     A + G  S   ++  +D  I  +   V  V+ S  
Sbjct: 630 SIQKRVHLLLANSDAQELYSSTNSEAVNSGNISVGNEELNSDDNIKPEKPPVMPVSRS-- 687

Query: 701 VQKATLDTTHQSNTVVSPTRKHFTRTREKPVPPPKPVRLRPKPPPKPFHLK 751
             K+  +T     +VV  + K+  +  EKP    KPV LRP PPPKP HLK
Sbjct: 688 --KSQFNTP----SVVKFSTKNQKKPPEKPF---KPVHLRPTPPPKPAHLK 729

>ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL095W (PRK1) and
           YNL020C (ARK1)
          Length = 750

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/680 (50%), Positives = 432/680 (63%), Gaps = 40/680 (5%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVP 60
           M+Q P +    G +LTVGSH+ +II+YLTSGGFA IYS E+  P P   S+ACLKRV VP
Sbjct: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVP 60

Query: 61  DKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFM 120
           DKPSLN+LRAEVDAMK+LK H+ VVSYIDSHAAKS  ++G+YEV+LLMEYC RGGLIDFM
Sbjct: 61  DKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFM 120

Query: 121 NTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSV 180
           N+RLQ RL EFEVLKIMS V+QG+ AMHAL PPLIHRDIKIENVLIS DG+FKVCDFGSV
Sbjct: 121 NSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSV 180

Query: 181 CGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCY 240
            GVIRPPKN  E NYVQHDILKNTTAQYR+PEMIDLYR LPVDEKSDIWALGVFLYK+CY
Sbjct: 181 SGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCY 240

Query: 241 YTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQG 300
           +TTPFEK GE AIL +KFQFP+YPQY+D+LKNLIS +L E+P+QRPNICQ+L EVSRIQG
Sbjct: 241 FTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQG 300

Query: 301 VPCPVKNFYLERKMLLQQQQQQQQQLQPLRHSVSQPQMEAIT------LPITLQPHPQKV 354
           VPCP+ NFYLER         +     P+ HS SQP +   T       P+   P P   
Sbjct: 301 VPCPLPNFYLER--------MKHGACTPVHHSASQPALPLATHQFSTSTPMVTHPQP--- 349

Query: 355 LASAQVSYANTGLTASPTAQQKLLYSRS---QPLPARNDPFLNLDKSNLLPPKTKLEF-- 409
             + Q+S    G+    +    ++++ +   + +P R +P   + K+ L           
Sbjct: 350 -PANQMSPLPHGIQPITSNMVYMMHNTTPNIKDIP-RENPAATIQKNALYSMSGSEHLSA 407

Query: 410 --PELKYNKEQLNGIPATTPYATQRRSVSPVRNGRGDISKILKSNPTSVDRLSSYVDSET 467
              ++ +N+ QL     T      R S +P++  R +I K L   P +  +  +YVDSET
Sbjct: 408 LSSDMHFNRPQLEN-SHTFSGVGPRSSSNPIKIPRNEIQKFLSGTPPTSAKKPTYVDSET 466

Query: 468 QTFETIEPLSRSVSRSVSRGSASSASSQDSVEEQSTGGSFTRRIGDKLKRIISNEPRNTS 527
           QT + I   ++S SR  +  S S  SS +   EQSTG S   R+  K  R  +++ + ++
Sbjct: 467 QTGDIITS-NKSGSRPFAM-SLSPLSSPELFSEQSTGNSLLGRLSRKTIRSPTSD-KGSN 523

Query: 528 PIRSRQNTGGSTRSAFSTLRRGTS-SNFSSDRSKRNSVDFSVRRLGSGGNKVRVSSSKSI 586
           P++S+ + G    S  S+  R  S    SS  SKRNS D S R+     NK R++ S S 
Sbjct: 524 PLKSKSSVGDDLASLLSSPSRNLSFPAQSSKSSKRNSADLSSRK-SPVLNKSRIAMSYSG 582

Query: 587 EEKGNTNKFENKGHNRSVSTSSITSDLNKYEGKAGSVSRGYNQAHSPIKMSANRESRNSI 646
            EK +    E+       S+SS+    N       S  R  + + S  ++   ++ + SI
Sbjct: 583 PEKSSATGLES-------SSSSLFGSQNGEHRPPSSTDRHKSNSTS-FRLVPTKKGQTSI 634

Query: 647 QKRVHDLLKNSQDSPVRKTA 666
           Q+RVH LL  S    V K A
Sbjct: 635 QERVHKLLATSAQEDVSKKA 654

>TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.284
           YNL020C
          Length = 661

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/504 (60%), Positives = 363/504 (72%), Gaps = 32/504 (6%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPN-SSSIACLKRVLV 59
           M+QP +  Y  GTVLTVGSH A++I YLTSGGFA +YSAEI P D    S++ACLKRV+V
Sbjct: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60

Query: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119
           PDKPSLN+LRAEVDAMKLL+ +K VVSYIDSHAAKSS  NGSYEVFLLMEYCA GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120

Query: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179
           MNTRLQNRL+EFE+L IMSQV+QG+AAMHALQPPLIHRDIKIENVLIS  G +KVCDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180

Query: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239
           VCGVIRPP+NPQE  YVQHD+LKNTTAQYRSPEMIDLYRG P+DEKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240

Query: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299
           YYTTPFEK GE+AILHS+FQFPA P YSD+LK LI  +L ENP QRPN+CQ+L +VSR+Q
Sbjct: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300

Query: 300 GVPCPVKNFYLERKMLLQQQQQQQQQLQPLRHSVSQPQMEAITLPITLQPHPQKVLASAQ 359
           G+ CPV+NFYL R M    +QQQQ     LR+S +QP    + +PI  QP          
Sbjct: 301 GIQCPVRNFYLLRAM----EQQQQSTQNQLRYSRTQP---VLNVPIISQP---------- 343

Query: 360 VSYANTGLTASPTAQQKLLYSRSQPLPARNDPFLNLDKSNLLPPKTKLEF------PELK 413
           V +    ++ +P     L  S S  +P+ + P L     +     T   F          
Sbjct: 344 VGFPMHQISGAP-----LGSSTSHIVPSNSVPILAARPRSAGSNGTGRSFQTPSTSSLSA 398

Query: 414 YNKEQLNGIPATTPYATQRRSVSPVRNGRGDISKILKSNPTSVDRLSSYVDSETQTFET- 472
            + +  +   + +P +T   S SPVR+GRG+IS+I++SN TS DR   YVDS TQT +T 
Sbjct: 399 KSSQTFHRAASRSPVSTH-LSTSPVRHGRGNISQIVESNRTSFDR-PRYVDSVTQTSDTE 456

Query: 473 IEPLSRSVSRSVSRGSASSASSQD 496
            EPL  +   SVS  +  S +  D
Sbjct: 457 EEPLKVASKSSVSLPARESHAVAD 480

 Score = 58.5 bits (140), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 66/153 (43%), Gaps = 36/153 (23%)

Query: 633 PIKMSANRESRNSIQKRVHDLLKNSQDSPVRKTAPDFGEFSSFPQDHAADHTISDKVIDV 692
           P+    +RE++ SIQ+RV DLL +S+D P+ K+ P   E                     
Sbjct: 539 PLTSVRSREAKESIQRRVRDLLNSSEDLPLSKSEPKKDE--------------------- 577

Query: 693 HNVTSSPVVQKATLDTTHQSNTVVSPTRKHFTRTREKPVPPPKPVRLRPKPPPKPFHLKV 752
                    ++  L  TH       P+ K  ++ + +P  PPKP  LRPKPPPKP  L  
Sbjct: 578 --------PKRGQLSKTHHDE---KPSVKEKSKQKVRPRAPPKPAHLRPKPPPKPAFLSG 626

Query: 753 KNLVIPKKGRYSNRANTLSDEVDIDDLEEDFKK 785
           K +V        + A     +  ++ LE D +K
Sbjct: 627 KKMV----DTEPSEAGKAVIDAKVESLERDLRK 655

>KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {ON}
           Anc_2.284 YNL020C
          Length = 369

 Score =  514 bits (1325), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 240/331 (72%), Positives = 284/331 (85%), Gaps = 6/331 (1%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDP-NSSSIACLKRVLV 59
           M+QP ++TY  GT+L VGSH+ RIIKY+TSGGFA IY+ EISPPD    S+IACLKRV+V
Sbjct: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60

Query: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119
           PDKPSLN+LRAEVDAMKLL+ +K VVSYIDSHA+KS+ NNGSYEVFLLMEYC RGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120

Query: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179
           MNTRLQNRL E EVL I SQV+QG+AAMHALQPPL+HRDIKIENVLIS+   +K+CDFGS
Sbjct: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180

Query: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239
           V G+IRPP NPQEL YVQHD+LKNTTAQYRSPEMID YRGLP+DEKSDIWA+GVFLYKLC
Sbjct: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240

Query: 240 YYTTPFEK-AGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRI 298
           YYTTPFEK  GE AIL +++++P +P YS++LK+LI A+L ENP QRPNI Q++ E+S++
Sbjct: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300

Query: 299 QGVPCPVKNFYLERKMLLQQQQQQQQQLQPL 329
           Q VPCP+ NFYL    + QQQ+ +  QLQP+
Sbjct: 301 QNVPCPIVNFYL----VTQQQKHKMVQLQPI 327

>Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {ON}
           YNL020C (REAL)
          Length = 639

 Score =  514 bits (1325), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 231/309 (74%), Positives = 272/309 (88%), Gaps = 1/309 (0%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNS-SSIACLKRVLV 59
           M+QP + TY  GT LTVGSH+  I+KYLTSGGFA +YSA ISPPDP+S S+IACLKRV+V
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIVKYLTSGGFAQVYSALISPPDPHSHSNIACLKRVIV 60

Query: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119
           PDKPSLN+LRAEVDAM+LL+ +++VVSYIDSHAAK+ L+NGSYEVF+LMEYC RGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLRNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179
           MNTRLQNRL EFE+L+IMSQV+QGVAAMHALQPPLIHRDIKIENVLIS +  +K+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239
           VCGVIRPP+NPQEL+YVQ DI KNTTAQYRSPEM+D++RGLP+DEKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVQQDIFKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299
           YYTTPFEK GE AIL   F+FP YP YS+QL++LI  +L +NP QRPN+ QLL  +S +Q
Sbjct: 241 YYTTPFEKGGEPAILSGHFEFPPYPDYSEQLRDLIRDILVQNPCQRPNVYQLLKRISIMQ 300

Query: 300 GVPCPVKNF 308
            VPCP+ + 
Sbjct: 301 NVPCPISDI 309

>NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284
          Length = 621

 Score =  514 bits (1323), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 237/315 (75%), Positives = 272/315 (86%), Gaps = 1/315 (0%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPN-SSSIACLKRVLV 59
           M+QP +  Y  GT+L+VGSH+ARIIKYLTSGGFA +Y+AEISP DP  +SSI CLKRV+V
Sbjct: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60

Query: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119
           PDKPSLN+LRAEVDAMKLL+ +  VVSYIDSHAAK   N GSYEVFLLMEYC RGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120

Query: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179
           MNTRLQNRL E E+L IMSQVSQGVAAMHALQPPL+HRDIKIENVL++  G++K+CDFGS
Sbjct: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180

Query: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239
           VCG+IRPP NPQE  YVQHDI+KNTTAQYRSPEMI+L +GLP++EKSDIWALGVFLYKLC
Sbjct: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240

Query: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299
           YYTTPFEK GE AILH+ FQFP +P YSD++K+LI   L   P QRPNI QLL EVS+IQ
Sbjct: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300

Query: 300 GVPCPVKNFYLERKM 314
            VPCP+ +FYL+RK+
Sbjct: 301 NVPCPIPDFYLQRKL 315

>NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {ON} 
          Length = 661

 Score =  513 bits (1322), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 269/509 (52%), Positives = 335/509 (65%), Gaps = 55/509 (10%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDP-NSSSIACLKRVLV 59
           M+QP +  Y  GT+LTVGSHK +++KYLTSGGFA IY+ +ISPPD   ++++ACLKRV+V
Sbjct: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60

Query: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119
           PDKPSLN+LRAEVD MKLL+ +  VVSYIDSHAAK + N GSYEVFLLMEYC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120

Query: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179
           MNTRLQ RL+E E+L IMSQV+QG+AAMHAL PPL+HRDIKIENVL++  G +KVCDFGS
Sbjct: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180

Query: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239
           VCG+IRPP N QE++YVQHDI+KNTTAQYR+PEMIDLYRGLP+DEKSDIWALGVFLYKLC
Sbjct: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299
           YYTTPFEK GE AILH+ FQFP YPQYSD+LK LI+ +L E P QRPN  Q+L EVS +Q
Sbjct: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300

Query: 300 GVPCPVKNFYLERKMLLQQQQQQQQQLQPLRHSVSQPQMEAITLPITLQPHPQKVLASAQ 359
            V CP+ NFYL                  + ++V+Q QM        +Q  PQ       
Sbjct: 301 NVQCPIPNFYL------------------MNNNVTQGQM-------AMQTQPQN------ 329

Query: 360 VSYANTGLTASPTAQQKLLYSRSQPLPARNDPFLNLDKSNLLPPKTKLEFPELKYNKEQL 419
               N  + ASP           QP    N+   N   +  +     +    LK N    
Sbjct: 330 ----NGAMMASPNM---------QPYVPNNNFVYNTPNAVSMNDIQMMNAINLKVNSTHN 376

Query: 420 NG-IPATTPY---------ATQRRSVSPVRNGRGDISKILKSNPTSVDRLSSYVDSETQT 469
            G IP T              Q+    PV +   ++    KS+P ++   ++YVDSETQT
Sbjct: 377 TGMIPPTMATNMARTIPMQPVQKSQTLPVSSIPTNLQNTNKSSPFNLKSTTTYVDSETQT 436

Query: 470 FETIEPLSRSVSRSVSRGSASSASSQDSV 498
               + L++++S +    S  +  + +SV
Sbjct: 437 ETPKQTLNKAISSNTEGFSLINEKNPNSV 465

>YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON}
           ARK1Serine/threonine protein kinase involved in
           regulation of the cortical actin cytoskeleton; involved
           in control of endocytosis
          Length = 638

 Score =  513 bits (1320), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 231/309 (74%), Positives = 271/309 (87%), Gaps = 1/309 (0%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNS-SSIACLKRVLV 59
           M+QP + TY  GT LTVGSH+  IIKYLTSGGFA +YSA I+PPDP+S SS+ACLKRV+V
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60

Query: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119
           PDKPSLN+LRAEVDAM+LLK +++VVSYIDSHAAK+ L+NGSYEVF+LMEYC RGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179
           MNTRLQNRL EFE+L+IMSQV+QGVAAMHALQPPLIHRDIKIENVLIS +  +K+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239
           VCG+IRPP+N QEL+YVQ DILKNTTAQYRSPEMID +RGLP+DEKSDIWALG+FLYKLC
Sbjct: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240

Query: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299
           YYTTPFEK G++AIL  KF+FP YP YS+QLK LI  +L ++P  RPN+ QLL  +S +Q
Sbjct: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300

Query: 300 GVPCPVKNF 308
            VPCP+ + 
Sbjct: 301 NVPCPINDI 309

>TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.284
           YNL020C
          Length = 697

 Score =  514 bits (1323), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 284/508 (55%), Positives = 340/508 (66%), Gaps = 55/508 (10%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNS-SSIACLKRVLV 59
           M+QP +  Y  G +L VGSH+A+I+KYLTSGGFA +Y  EISP D +S S+IACLKRV+V
Sbjct: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60

Query: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKS----SLNNGSYEVFLLMEYCARGG 115
           PDK SLN  RAEV+AMKLL+ +K+VVSYIDSHAAKS     + NGSYEVFLLMEYC+  G
Sbjct: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120

Query: 116 LIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVC 175
           LIDFMNTRLQNRLKEFE+L IMS VSQGVAAMHALQPPL+HRDIKIENVLIS    FK+C
Sbjct: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180

Query: 176 DFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFL 235
           DFGSVCGVIRPP N  EL++VQHDILKNTTAQYRSPEM+ L + +P++EKSDIWALGVFL
Sbjct: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240

Query: 236 YKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEV 295
           YK+CYYTTPFEK GE AILHS++Q+PAYPQYSD LKNLI  +L  +P +RPNICQ++ EV
Sbjct: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300

Query: 296 SRIQGVPCPVKNFYLERKMLLQQQQ-----QQQQQLQPL--RHSVSQPQMEAITLPITLQ 348
           SR+QGVPCP+KNFYLER +     Q      Q +Q  PL  +HS+S P +  +   I L 
Sbjct: 301 SRLQGVPCPLKNFYLERAIRQTAVQDNHFNHQMEQFPPLHLQHSISSPALSTVNNNIGLS 360

Query: 349 P--HPQKVLASAQVSYANT---------GLTASPTAQ---QKLLYSRSQP---------- 384
                Q V  SA +  ANT          L  S T Q   Q +   R  P          
Sbjct: 361 NINFLQNVNNSA-IQTANTTSRINNNPYSLHNSSTLQNTPQTIAADRRYPVSTAPKQQHN 419

Query: 385 LPARNDPF--LNLDKSNLLPPKTKLEFPELKYNKEQLNGIPATTPYATQRRSVSPVRN-- 440
           +PA N+    + L KS      T  + P    N    N        +  ++SV+ + N  
Sbjct: 420 IPAYNNQINDITLQKS---LSATMADAPVSTINISD-NAFDRGLHLSELQKSVTALNNDM 475

Query: 441 ----------GRGDISKILKSNPTSVDR 458
                     GRG IS IL SNP S+D+
Sbjct: 476 NHIYSQKQEGGRGKISSILNSNPNSLDQ 503

>ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 704

 Score =  513 bits (1322), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 272/492 (55%), Positives = 338/492 (68%), Gaps = 47/492 (9%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPD-PNSSSIACLKRVLV 59
           M+ P + TY  GTVL+VG+H A+I+KY+ SGGFA +YSAE+ P D P  ++  CLKRV++
Sbjct: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60

Query: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119
           P+K  LN+LRAEV+AMKLLK  K VV YIDSHAA+S L NG+YEVFLLME+C  GGLIDF
Sbjct: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120

Query: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179
           MNTRLQNRLKE+E+L IMSQV+QG+AAMHALQPPLIHRDIKIENVLIS DG +KVCDFGS
Sbjct: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180

Query: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239
           V G IRPP+NPQE  +VQHDILKNTTAQYRSPEMIDLYR   +DEKSDIWALG+FLYKLC
Sbjct: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240

Query: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299
           YYTTPFEK G+ AILHS++QF A+P YSD+LKNLIS +L + PMQRPNICQ+L EVSR+Q
Sbjct: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300

Query: 300 GVPCPVKNFYLERKMLLQQQQQQ-----------------QQQLQPLRHSVSQPQMEAIT 342
           GV  P++NFYL R M                           Q+ PL  + S   + A  
Sbjct: 301 GVSSPMRNFYLLRAMQHTNTSTSFITPPVSMVNTNTFMAPPAQVAPLTPAQS---LGANG 357

Query: 343 LPITLQPHPQKVLASAQVSYANTGLTASPTAQQKLLYSRSQPLPARND---PFLNLD-KS 398
           +P+ + P P  ++A  + S  +TG    P A   ++   +Q  PA+     P  + D  S
Sbjct: 358 MPVGVTPQPMPIMAKTR-SGISTGGNIFPGAANPMVVP-TQLGPAQVAGPVPMGSQDMSS 415

Query: 399 NLLPPKTKLEFPELKYNKEQLNGIPATTPYATQRRSVSPVRNGRGDISKILKSNPTSV-D 457
            +LPP          +N+       +T P  T   S  P ++G G I+  + + P ++ D
Sbjct: 416 GILPP----------FNRA------STLP--TDGFSTGPGKDG-GVITSAVNTGPETIKD 456

Query: 458 RLSSYVDSETQT 469
           R  +YVDSETQT
Sbjct: 457 RPFNYVDSETQT 468

>Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {ON}
           YNL020C (REAL)
          Length = 632

 Score =  506 bits (1303), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 242/387 (62%), Positives = 304/387 (78%), Gaps = 15/387 (3%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNSSS-IACLKRVLV 59
           M+QP + TY  GT LTVGSH+  IIKYLTSGGFA +YSA ISPPDP+++S +ACLKRV+V
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60

Query: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119
           PDK SLN+LRAEVDAMKLL+ +++VVSYIDSHAAK++L+NGSYEVF+LMEYC RGGLIDF
Sbjct: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120

Query: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179
           MNTRLQNRL E E+L+IM QV+QGVAAMHALQPPLIHRDIKIENVLIS    +K+CDFGS
Sbjct: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180

Query: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239
           VCGVIRPP+NPQEL+YV+ D+LKNTTAQYRSPEM+D++RGLP+DEKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299
           YYTTPFEK GE AIL+ +F+F  YP YS+QL+NLI  LL +NP QRPN+ QLL +++ +Q
Sbjct: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300

Query: 300 GVPCPVKNFYLERK------MLLQQQQQQQQQLQPLR-HSVSQPQME----AITLP---I 345
             P P+++    ++      ++   Q    Q +Q L  HS+++  M        +P   I
Sbjct: 301 NAPYPIRDVQTVQRPSNHLNLMELHQNSATQNIQSLNSHSINENSMSNQNFQFRMPANVI 360

Query: 346 TLQPHPQKVLASAQVSYANTGLTASPT 372
           T Q  P +  + A ++  ++ LT SP+
Sbjct: 361 TAQSLPTRENSQAFINATSSSLTGSPS 387

>Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {ON}
           YNL020C (REAL)
          Length = 637

 Score =  504 bits (1298), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 227/309 (73%), Positives = 269/309 (87%), Gaps = 1/309 (0%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNSSS-IACLKRVLV 59
           M+QP + TY  GT LTVGSH+  IIKYLTSGGFA +YS  ISPPDP++++ +ACLKRV+V
Sbjct: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60

Query: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119
           PDKPSLN+LRAEVDAM+LLK +++VVSYIDSHAAK+ L NGSYEVF+LMEYC RGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120

Query: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179
           MNTRLQNRL EFE+L+I+SQV+QGVAAMHALQPPLIHRDIKIENVLIS +  +K+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180

Query: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239
           VCG+IR P+N QEL+YVQ DILKNTTAQYRSPEMID++RGLP+DEKSDIWALG+FLYKLC
Sbjct: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299
           YYTTPFEK GE AIL  KF+FP YP YS+QLK+LI  +L +NP  RP++ QLL  +S +Q
Sbjct: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300

Query: 300 GVPCPVKNF 308
            VPCP+ + 
Sbjct: 301 NVPCPINDI 309

>CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095w PRK1
          Length = 688

 Score =  499 bits (1285), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 241/358 (67%), Positives = 286/358 (79%), Gaps = 11/358 (3%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEI-SPPDPNSSSIACLKRVLV 59
           M+QP L+    GT LTVG+H  +I+KYLTSGGFA IY+ EI S    N S++ACLKRV V
Sbjct: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60

Query: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119
           PDK SLN LRAEVDAMKLL  +K VVSYIDSHA +S  N+G+YEVFLLMEYC  GGLIDF
Sbjct: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120

Query: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179
           MNTRLQNRL E E+L IMSQ +QG+A MHAL PPL+HRDIKIENVL+S+ G +KVCDFGS
Sbjct: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180

Query: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239
           V GVIRPP+N QEL YVQHDI+KNTTAQYR PEM+DLYRGLP+DEK+DIWALGVFLYKLC
Sbjct: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240

Query: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299
           YYTTPFEK GE AILH++FQFP++P YSD+LKNLI ++LRE+P  RPN+CQ+L EVSR+Q
Sbjct: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300

Query: 300 GVPCPVKNFYLERKM----LLQQQQQQQQQLQPLRHS----VSQPQMEAITLPITLQP 349
            VPCP++NFYL R M    L  +    Q QLQ LR++    +S P ++   +PI  +P
Sbjct: 301 NVPCPIRNFYLLRAMEKVKLSTEIDYPQLQLQKLRNAQADNLSNPMIKP--MPIAQRP 356

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 90/201 (44%), Gaps = 27/201 (13%)

Query: 599 GHNRSVSTSSITSDLNKYEGKAGSVSRGYNQAHSPIKMSANRESRNSIQKRVHDLLKNSQ 658
           G N S+ +S + SD      +    SR  + +   + ++ N E R SIQ RV  LL N  
Sbjct: 507 GDNNSLKSSKLDSDKLDIAVQRSPSSRS-DGSDFRLPLNPNSEKRKSIQLRVQHLLDNMS 565

Query: 659 DSPVRKTAPDFGEFS--------SFPQDHAADHTISDKVIDVHNVTSSPVVQKATLDTTH 710
            + V+K+A  +G+++        + P+       ++D +ID ++V +  +       +  
Sbjct: 566 SNEVKKSAQGYGKYTDELSSTGTNIPKVTPDSPVLAD-LIDFNDVPTIRIPSDKNQLSKS 624

Query: 711 QSNTVVSPTRKHFTRTREKPVPPPKPVRLRPKPPPKPFHLKVKNLVIPKKGRYSNRANTL 770
                  P +    R+ +K +     +RL PK                +  R ++ A  +
Sbjct: 625 GKIKPAPPPKPKKLRSNKK-ISTLSALRLEPK----------------QNDRITSDATDV 667

Query: 771 SDEVDIDDLEEDFKKRYPSAI 791
              +++DDLEEDFK+R+PSA+
Sbjct: 668 LMHLNVDDLEEDFKRRFPSAV 688

>TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON}
           Anc_2.284 YNL020C
          Length = 717

 Score =  484 bits (1247), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 215/318 (67%), Positives = 262/318 (82%), Gaps = 1/318 (0%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDP-NSSSIACLKRVLV 59
           M+QP ++ Y  GT L VG H+  IIKYLTSGGFA IY  +++PP+P N  ++ACLKRV+V
Sbjct: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60

Query: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119
           P+K  LN+LRAEV+AM+LLK    VV YIDS+AA+S  N+G+YEV  LME+C  GGLIDF
Sbjct: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120

Query: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179
           MNTRLQNRLKEFEVL IM+QV+QG+ AMH+L PPLIHRDIKIENVLIS +G +KVCDFGS
Sbjct: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180

Query: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239
           V G+IRPPKN +E N+VQ DI+KNTTAQYR PEM+DLYRG P++EKSDIWALGVFLYK+C
Sbjct: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240

Query: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299
           YYTTPFE  GE AILH+++Q+P YP YS +LKNLI  +L E P QRPN+CQ+L EVS +Q
Sbjct: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300

Query: 300 GVPCPVKNFYLERKMLLQ 317
           G+PCP+ NFYL+R+   Q
Sbjct: 301 GIPCPLPNFYLQRQQATQ 318

>KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {ON}
           Anc_2.284 YNL020C
          Length = 592

 Score =  480 bits (1235), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 221/315 (70%), Positives = 264/315 (83%), Gaps = 1/315 (0%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNS-SSIACLKRVLV 59
           M+QP + TYP GT LTVGSH+ +IIKYLT+GGFA IY   ISP DP S ++IACLKRV+V
Sbjct: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60

Query: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119
           PDKPSLN LRAEVDAMKLL+ ++ VVSYIDSHAAKSS  NG+YEVFLLMEYC  GGLI+F
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120

Query: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179
           +N+RLQNRLKE EV+ IM  VSQGVAAMHALQPPL+HRDIKIENVL+S++  FK+CDFGS
Sbjct: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180

Query: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239
           V G IRPP NPQEL  VQ+DI++NTTAQYRSPEMID+ RG P+DEKSDIWALGVFLYK+C
Sbjct: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240

Query: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299
           YYTTPFEK+GE  IL S+++FPA+P YSD+L++LIS LL   P  RPNI  ++ E+S ++
Sbjct: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300

Query: 300 GVPCPVKNFYLERKM 314
            + CP+ NFYL+  M
Sbjct: 301 NISCPIINFYLKPNM 315

>TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {ON}
           Anc_2.284 YNL020C
          Length = 707

 Score =  474 bits (1220), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 302/709 (42%), Positives = 401/709 (56%), Gaps = 86/709 (12%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNSS-SIACLKRVLV 59
           MSQ   + Y  GT L V SH+  I  YLTSGGFA +Y+A I+    N    + CLKRV+V
Sbjct: 1   MSQIFEDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIV 60

Query: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119
           P+K SLN LRAEVDAMK+LK +K++VSYIDSHA +   +  SY V LLMEYC+  GL+DF
Sbjct: 61  PNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDF 120

Query: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179
           MN RL+ RLKE E+LKIM+ VSQGV  MH LQPPL+HRDIKIENVL+S DGNFK+CDFGS
Sbjct: 121 MNLRLKERLKEEEILKIMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGS 180

Query: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239
           V GV+R P + +E  Y+Q+DILKNTTAQYRSPEM++L  G P++EKSDIWALG+ LYKLC
Sbjct: 181 VSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLC 240

Query: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299
           YYTTPFE+ G  AI+  KF +PAYPQY+D LKN+I  LL  NP+QRPNICQLL E+ RIQ
Sbjct: 241 YYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQ 300

Query: 300 GVPCPVKNFYLERKMLLQQQQQQQQQLQPLRHSVSQPQMEAITLPITLQPHPQKVLASAQ 359
               P+ NFY++R M                   S  QM+      T QPH   +L   Q
Sbjct: 301 HKSSPLPNFYVQRAM-------------------SSLQMD------TTQPHRIPILKYTQ 335

Query: 360 VSYANTGLTASPTAQQKLLYSRSQPLPARN--------DPFLNLDKS-NLLPPKTKLEFP 410
           +S       +SP+   +    +  P    N        D +L    S + L      +  
Sbjct: 336 MSKPVISSQSSPSKHCQTFSQKDYPYIQPNLSNSARAKDYYLGGSSSTDTLESSLSKQLS 395

Query: 411 ELKYNKEQLNGIPATTPYATQRRSVSP-----VRNGR----GDISKILKSNPTSVDRLSS 461
           E +     +N + +   + T RR ++P     ++ G      D S +  +N TS+    S
Sbjct: 396 EDRVYDVNVNTMDS---HCTYRRKLTPNYDHALKKGSSPSINDNSTL--NNMTSLKHEHS 450

Query: 462 YVDSET----------QTFETIEPLSRSVSRSVSRGSA-SSASSQDSVEEQSTGGSFTRR 510
           +   E               + + L+ +     SR S+ +S SS DS+   STGGS  + 
Sbjct: 451 FNSREAYIHPDFSGSKHFITSNDALNLNCRTPRSRDSSINSNSSVDSISRNSTGGSLIKS 510

Query: 511 IGDKLKRIISNEPRNTSPIRSRQNTGGSTRSAFSTLRRGT---SSNFSS-DRSKRNSVDF 566
           +G K+K   +   R+ SPI+SRQNTG S RSAF+ +R+G    SS  SS D   RNS  F
Sbjct: 511 LGTKIKLTTTGGKRSQSPIKSRQNTGDSIRSAFNKVRQGINLRSSRISSNDSVVRNSEQF 570

Query: 567 SVRRLGSGGNKVRVSSSKSIEEKGNTNK--FENKGHNRSVSTSSITSDLNKYEGKAGSVS 624
                  GG          I E  N NK  F+    NR    S         + K  S++
Sbjct: 571 -------GG----------IPELSNDNKYQFDTTSKNRHEYNSLSRKLSLSSQ-KQNSLN 612

Query: 625 RGYNQAHSPIKMSANRESRNSIQKRVHDLLKNSQDSPVRKTAPDFGEFS 673
                ++ PI +  N E++ SI+ RV  L+K+S D+ V  +A  +G+++
Sbjct: 613 DS--TSNDPIILITNLEAKKSIKDRVQALMKSSSDNHVIISAHGYGKYT 659

>Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa]
           {ON} complement(102096..104201) [2106 nt, 702 aa]
          Length = 701

 Score =  472 bits (1214), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 216/333 (64%), Positives = 274/333 (82%), Gaps = 7/333 (2%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPN-SSSIACLKRVLV 59
           M+Q  L  Y   TV+TVGSH A+I+KYL SGG+A +YSA ++P D + +++IACLKRV+V
Sbjct: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60

Query: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119
           PDK SLN+LRAEVDA+K+L+  K+VVSYIDSHA+K S + GSYEVF+LMEYC+ G LIDF
Sbjct: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120

Query: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179
           +NTRL+NRL+E E+L IM+QV+ GVA MH LQP LIHRDIKIEN+LISE+G +KVCDFGS
Sbjct: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180

Query: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239
           VCGVIRPP++ +E+ Y+QHDI+KNTTAQYRSPEM+DL +G  ++EKSDIWALGVFL+KLC
Sbjct: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240

Query: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299
           YYTTPFEK GE AIL S+FQ+PAYP YSD LKN+I  LL  +P +RPNICQL+ E+SR+Q
Sbjct: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300

Query: 300 GVPCPVKNFYLERKMLLQQQQQQQQQLQPLRHS 332
           G+  P+KNFYL R +      +    +QPL+++
Sbjct: 301 GIVPPMKNFYLSRAL------ETSSLMQPLQNN 327

>TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON}
           Anc_2.284 YNL020C
          Length = 1443

 Score =  484 bits (1246), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 213/318 (66%), Positives = 260/318 (81%), Gaps = 3/318 (0%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEI---SPPDPNSSSIACLKRV 57
           M+QP +  Y  G VL +G+H+  I KYL  GGFA +YS  +   S       ++ACLKRV
Sbjct: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60

Query: 58  LVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLI 117
           +VPDK  LN+LRAEVDAMKLLK +K++VSYIDSHA +S L  G YEVFLLMEYC+RGG+I
Sbjct: 61  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120

Query: 118 DFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDF 177
           DF+NTRL +RL+EFE+LKIMS V QGVAAMH LQPPLIHRDIKIENVLISE+G++K+CDF
Sbjct: 121 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180

Query: 178 GSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYK 237
           GS C V+RPPK PQE  ++ HDI+ NTTAQYRSPEMID Y G P+DEKSDIWALGVFLYK
Sbjct: 181 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 240

Query: 238 LCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSR 297
           LCYYTTPFEK GE AIL+ KFQFP+YPQYSD ++N+I+ +L ++P++RPNICQ+L +VS+
Sbjct: 241 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 300

Query: 298 IQGVPCPVKNFYLERKML 315
           +QGVPCP++NF L R  L
Sbjct: 301 LQGVPCPIENFMLTRIKL 318

>CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} similar
           to uniprot|P53974 Saccharomyces cerevisiae YNL020c ARK1
           or uniprot|P40494 Saccharomyces cerevisiae YIL095w PRK1
          Length = 622

 Score =  444 bits (1143), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 202/311 (64%), Positives = 247/311 (79%), Gaps = 1/311 (0%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPN-SSSIACLKRVLV 59
           M+ P +  Y  GT +TVGSH   I+KYLTSGG+A IYSA+I P D    +++A LKRV+V
Sbjct: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60

Query: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119
           PDK  LN+LRAEVDAMK LK HK++VSYIDSHAAKS   +G+YEVFL+MEYC+RGGLIDF
Sbjct: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120

Query: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179
           MNTRLQNRL E E+L I   +SQGVAAMH LQPPLIHRDIKIENVLIS D  +K+CDFGS
Sbjct: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180

Query: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239
           V G IRPPK P+EL YV+HDI+ +TTAQYR+PEM+DL +G  V++KSDIWALGVFLYKLC
Sbjct: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240

Query: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299
           YYTTPFE+ GE  IL+   +FP YP YSD +K LI ++L +NP+ RPNI Q++  VS++ 
Sbjct: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300

Query: 300 GVPCPVKNFYL 310
            V CP+ N ++
Sbjct: 301 NVNCPIPNIHV 311

>KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {ON}
           Anc_2.284 YNL020C
          Length = 788

 Score =  447 bits (1149), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 210/316 (66%), Positives = 255/316 (80%), Gaps = 7/316 (2%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDP-NSSSIACLKRVLV 59
           M+QP +  YP G V+ VGSH+A+I+KYLTSGGFA IYS EISP D   +S+IACLKRV+V
Sbjct: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60

Query: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119
           P+K  LN LR EVDAMKLLK ++ VVSYIDS+AAKS   NGSYEVFLLMEYC RG L+DF
Sbjct: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120

Query: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179
           MNT+L+ RL+E EVL IM+QV QG+AAMH L PPLIHRDIKIENVLIS DG FKVCDFGS
Sbjct: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180

Query: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKS---DIWALGVFLY 236
           VCG+IRPP+NPQEL YVQHD++KNTTAQYRSPEMIDL +G P++ K      W + + + 
Sbjct: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240

Query: 237 KLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVS 296
            L +YT  F +  EVAIL+ ++Q+PAYP YSD+LKN++  LL  +P++RPNICQLL E+S
Sbjct: 241 -LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEIS 297

Query: 297 RIQGVPCPVKNFYLER 312
           +IQ +PCP+ NFYLER
Sbjct: 298 KIQNIPCPIDNFYLER 313

 Score =  116 bits (291), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 113/350 (32%), Positives = 180/350 (51%), Gaps = 37/350 (10%)

Query: 461 SYVDSETQTFETIEPLSRSVSRSVSRGSASSASSQDSVEEQSTGGSFTRRIGDKLKRIIS 520
           +YVDSETQT E  EP       S+         S D  +  +TG S   R+G +L+ +I+
Sbjct: 456 TYVDSETQTLE--EP-------SLQHTRILPHISTDRTD--NTGNSIVSRLGVQLRNVIT 504

Query: 521 NEPRNTSPIRSRQNTGGSTRSAFSTLRR---GTSSNFS--SDRSKRNSVD--FSVRRLGS 573
           N+   +S I + Q TG S +SA  +L+    G ++N    S  + RN ++   S   +GS
Sbjct: 505 NDSSASSSIDTVQETGNSIKSAIESLKNSVSGMANNVKALSVENARNHLERLGSSYSIGS 564

Query: 574 GGNKVRVSSSKSIEEKGNTNKFENKGHNRSVSTSSITSDLNK-YEGKAGSVSRGYNQAHS 632
             N  + +S+  I     T+   +     S  T S  SD N+ Y+       +   Q+ S
Sbjct: 565 NNNIAKPNSAPIIPAVVTTHTSNSLKTAVSSPTHSELSDENELYDTLHLPDPKTSFQSPS 624

Query: 633 PIKMSANRESRNSIQKRVHDLLKNSQDSPVRKTAPDFGEFSSFPQDHAADHTISDKVIDV 692
           P+K + +R+ + SI+KRV +LLKN++DSPV+KTA  +G+++  P+   +       ++  
Sbjct: 625 PLKYAVDRKMKASIEKRVLNLLKNAEDSPVKKTAAGYGKYTKRPK-MVSPTNPHYHLVRQ 683

Query: 693 HNVTSSPVVQKATLDTTHQSNTVVSPTR--------KHFTRTREKPVPPPKPVRLRPKPP 744
           ++V+ +P++  A   + H    VV P          K+  +++  PV P KP  LRPKPP
Sbjct: 684 NSVSQTPLILSARGSSGH---PVVVPALINRDNDNGKYPAKSKAPPVVPKKPDHLRPKPP 740

Query: 745 PKPFHLKVKNLVIPKKGR---YSNRANTLSDEVDIDDLEEDFKKRYPSAI 791
            KP HL   +L I KK      +  A+ LSD   +D+LE+ FK+RYPS +
Sbjct: 741 KKPAHL--SSLKINKKHSTTVLNTPADLLSDTA-VDELEKSFKQRYPSTV 787

>Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)
           [2517 nt, 839 aa]
          Length = 838

 Score =  324 bits (830), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 168/353 (47%), Positives = 222/353 (62%), Gaps = 13/353 (3%)

Query: 1   MSQPP--LETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAE----ISPPDPNSSSIA-- 52
           ++ PP  L++Y  GT++ VG HK  ++KYL  GGFA IY  +    +S  DPN   +   
Sbjct: 19  IASPPKVLDSYVPGTIVIVGIHKVEVVKYLAEGGFAKIYVVKFLEYLSTVDPNGKEVLQN 78

Query: 53  ----CLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLM 108
               CLKRVLV D   LN +R EV+ M+ LK    VV Y DS+A++       YEV LLM
Sbjct: 79  GDQLCLKRVLVQDDNGLNEMRNEVEVMRKLKGAPCVVQYYDSNASRRIDGAPGYEVLLLM 138

Query: 109 EYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISE 168
           E C+   L+D+MN RL  +L E E+LKIM  V+  VA MH L  PLIHRDIKIENVL+  
Sbjct: 139 ELCSNNSLLDYMNQRLATKLSEDEILKIMFDVTLAVAQMHYLPSPLIHRDIKIENVLVDS 198

Query: 169 DGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDI 228
             NFK+CDFGS    +    + Q++  +  +I  +TT QYRSPEMIDLYR LPV+EKSDI
Sbjct: 199 KNNFKLCDFGSTSTCLPIVSSHQDIAILTQNIYVHTTPQYRSPEMIDLYRCLPVNEKSDI 258

Query: 229 WALGVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNI 288
           WALGVFLYKL +YTTPFE+ G+ AILHSK++FP    YS +L NLI  +L ENP  RPNI
Sbjct: 259 WALGVFLYKLMFYTTPFERTGQFAILHSKYEFPLN-NYSSKLINLIIVMLAENPNLRPNI 317

Query: 289 CQLLAEVSRIQGVPCPVKNFYLERKMLLQQQQQQQQQLQPLRHSVSQPQMEAI 341
            Q+L ++  I G+  P+ + Y       ++  + Q +LQ  ++ + Q Q+  I
Sbjct: 318 YQVLNQICYISGIKNPMDDAYGLGAYSFEKYTEYQSKLQNYQNQMYQIQVRKI 370

>SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 858

 Score =  323 bits (828), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 167/339 (49%), Positives = 214/339 (63%), Gaps = 10/339 (2%)

Query: 4   PPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIY-------SAEISPPDPN--SSSIACL 54
           P LE    GT++ VGSHK  I+KYL  GGFAHIY       S E+  P  +     +ACL
Sbjct: 27  PTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACL 86

Query: 55  KRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARG 114
           KRVLV D+  LN LR EV+ MK LK    +V Y DS+A++    +  YEV LLME C   
Sbjct: 87  KRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNK 146

Query: 115 GLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKV 174
            L+D+MN RL  +L E EVLKIM  V++ VA MH L  PLIHRDIKIENVL+  + NFK+
Sbjct: 147 SLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKL 206

Query: 175 CDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVF 234
           CDFGS           Q++  + ++I  +TT QYR+PEMIDLYR LP+DEKSDIWALG+F
Sbjct: 207 CDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIF 266

Query: 235 LYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAE 294
           LYKL +YTTPFE  G+ AILHSK+  PA   YS +L NLI  +L ENP  RPNI Q++ +
Sbjct: 267 LYKLLFYTTPFELTGQFAILHSKYDIPA-NNYSSKLINLIIIMLAENPNLRPNIYQVIYQ 325

Query: 295 VSRIQGVPCPVKNFYLERKMLLQQQQQQQQQLQPLRHSV 333
           V  I  V  P ++ Y        +  + Q++LQ  ++ +
Sbjct: 326 VCAIMKVDVPFEDKYQTGPYDFDKYSKYQEKLQAFQYQL 364

>KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {ON}
           Anc_3.273 YBR059C
          Length = 912

 Score =  319 bits (818), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 165/349 (47%), Positives = 211/349 (60%), Gaps = 23/349 (6%)

Query: 7   ETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEI--------SPPDPNSSS-------- 50
           E +  G V+ VG HK  IIKYL  GGFA IYS           + PD    S        
Sbjct: 17  EKFNPGAVVAVGRHKVEIIKYLAEGGFAQIYSVNFIEYLNEFSNEPDSTEDSNIDEFQQF 76

Query: 51  ------IACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEV 104
                 +ACLKRV+VPD+  LN LR EV+ M+ LK    +V Y DS+A++    N  +EV
Sbjct: 77  KLEPGNLACLKRVMVPDENGLNELRNEVNVMRKLKGTPNIVQYYDSNASRRHDGNPGFEV 136

Query: 105 FLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENV 164
            LLME C    L+D+MN RL  +L E E+LKIM  V+ G++ MH LQ PLIHRDIKIENV
Sbjct: 137 LLLMELCPNNSLLDYMNQRLTTKLSEKEILKIMYDVTLGISQMHYLQKPLIHRDIKIENV 196

Query: 165 LISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDE 224
           L+    NFK+CDFGS         + QE+  +  +I  +TT QYRSPEMIDLYR LP+DE
Sbjct: 197 LVDSSNNFKLCDFGSTSACFPIVTSHQEIAVLTQNIYVHTTPQYRSPEMIDLYRNLPIDE 256

Query: 225 KSDIWALGVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQ 284
           KSDIWALGVFLYKL +YTTPFE  G+ AILHSK++ P    YS +L NLI  +L ENP  
Sbjct: 257 KSDIWALGVFLYKLLFYTTPFEMTGQFAILHSKYEIPPN-NYSSRLINLIIIMLAENPNL 315

Query: 285 RPNICQLLAEVSRIQGVPCPVKNFYLERKMLLQQQQQQQQQLQPLRHSV 333
           RPNI Q++ +V    G+  P+K+ Y       +     Q +LQ +++ +
Sbjct: 316 RPNIYQVMHQVCITIGIEPPIKDKYEMGPYDFENYTHFQNKLQNIQYKI 364

>Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON}
           (72364..75669) [3306 nt, 1102 aa]
          Length = 1101

 Score =  319 bits (817), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 162/336 (48%), Positives = 208/336 (61%), Gaps = 12/336 (3%)

Query: 6   LETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEI----SPPDPNSSSI-------ACL 54
           +E + +G+ + VG+ K  I+KYLT GGFA IY  +     +  D N+S+I       ACL
Sbjct: 22  VEKFANGSTVVVGNKKVEIVKYLTEGGFAQIYIVKFLENSNEFDSNNSNIPLKIGDLACL 81

Query: 55  KRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARG 114
           KRVLV D+  LN +R EV+ MKLLK    +V Y DS+A++       +EV LLME C   
Sbjct: 82  KRVLVQDENGLNEMRNEVEVMKLLKGAPNIVQYFDSNASRRKDGTNGFEVLLLMELCPNK 141

Query: 115 GLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKV 174
            L+DFMN RL  +L E E+L IM  V+  VA MH L PPLIHRDIKIENVL+     FK+
Sbjct: 142 SLLDFMNQRLTTKLSEKEILTIMHDVTLAVAQMHTLSPPLIHRDIKIENVLVDSQNGFKL 201

Query: 175 CDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVF 234
            DFGS           Q++  +  DI  +TT QYRSPEMIDLY+ LP+DEKSDIWALG+F
Sbjct: 202 ADFGSTSKCFPAVSAHQDIAILSQDIFMHTTPQYRSPEMIDLYKCLPIDEKSDIWALGIF 261

Query: 235 LYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAE 294
           LYKL +Y TPFE  G+ AILHSK+ FP    YS +L NLI  +L ENP  RPNI Q+L E
Sbjct: 262 LYKLLFYITPFEMTGQFAILHSKYDFPQ-TNYSSRLINLIIIMLSENPNLRPNIYQVLHE 320

Query: 295 VSRIQGVPCPVKNFYLERKMLLQQQQQQQQQLQPLR 330
           +  I G    + + Y +      Q ++ Q +LQ L+
Sbjct: 321 ICSISGTRLEITDKYGQGPYNFDQFRKFQNELQSLQ 356

>Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {ON}
           similar to Ashbya gossypii AGR027C
          Length = 894

 Score =  314 bits (805), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 162/344 (47%), Positives = 216/344 (62%), Gaps = 10/344 (2%)

Query: 6   LETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEI----SPPDPNSS-----SIACLKR 56
           LE   +G++L VG H+  II+YL  GGFAHIY        +  D + S      IACLKR
Sbjct: 25  LEKLTAGSILLVGVHRVEIIEYLAEGGFAHIYKVSFIEYTNELDRHHSVLQRGDIACLKR 84

Query: 57  VLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGL 116
           V V D+  LN LR EV+ MK LK    VV Y DS+A++ +     +EV LLME C+ G L
Sbjct: 85  VQVNDENGLNELRNEVEVMKKLKGCGNVVQYYDSNASRHTDGTPGFEVLLLMELCSNGSL 144

Query: 117 IDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCD 176
           +D+MN RL  +L E EVLKIM  +++G++ MH L+ PLIHRDIKIENVL+    NFK+CD
Sbjct: 145 LDYMNQRLATKLSEREVLKIMYDITKGISHMHFLRTPLIHRDIKIENVLVDSANNFKLCD 204

Query: 177 FGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLY 236
           FGS    +      QE+  + ++I  +TT QYRSPEMIDLYR L ++EKSDIWALG+FLY
Sbjct: 205 FGSTSTCLPAVSTHQEIAMLTNNIYVHTTPQYRSPEMIDLYRCLAINEKSDIWALGIFLY 264

Query: 237 KLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVS 296
           KL +YTTPFE  G+ AILHSK+  P    +S +L NLI  +L ENP  RPNI Q+L  + 
Sbjct: 265 KLLFYTTPFELTGQFAILHSKYDIPQN-NFSSKLINLIIVMLAENPYIRPNIYQILYHIC 323

Query: 297 RIQGVPCPVKNFYLERKMLLQQQQQQQQQLQPLRHSVSQPQMEA 340
            I     P+++ Y +      +  + Q++LQ L++ +   Q  A
Sbjct: 324 SIMECDVPIEDHYGQGPYDFNKYARYQERLQRLQYEILVNQQNA 367

>TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1061

 Score =  317 bits (811), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 159/316 (50%), Positives = 203/316 (64%), Gaps = 16/316 (5%)

Query: 9   YPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEI--------SPPDPNSS-------SIAC 53
           YP+GT + VGSHK  +IKY+  GGFA IY+ +         S P  N +        IAC
Sbjct: 99  YPAGTPVAVGSHKVEVIKYIAEGGFAQIYTVKFIERLNEFASLPGGNQNQKPLQPGDIAC 158

Query: 54  LKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCAR 113
           LKRVLV D   LN +R EV+ M+ L+    VV Y DS+A+  S +   YEV LLME+C  
Sbjct: 159 LKRVLVNDDNGLNEMRNEVNVMQKLQGAPCVVQYYDSNASHRSDSAPGYEVLLLMEFCPN 218

Query: 114 GGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFK 173
             L+D+MN RL  RL E E++KIM   + G+A +H L+ PLIHRDIKIENVL+ ++ NFK
Sbjct: 219 NSLLDYMNDRLATRLSEKEIMKIMYDTTLGIAQLHYLKTPLIHRDIKIENVLVDQENNFK 278

Query: 174 VCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGV 233
           +CDFGS         N +++     +I  NTT QYRSPEMIDLYR  P+DEKSDIWALGV
Sbjct: 279 LCDFGSTSICFPIVTNHRDIAIFTQNIYVNTTPQYRSPEMIDLYRYQPIDEKSDIWALGV 338

Query: 234 FLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLA 293
           FLYKL ++TTPFE+ G+ AILHSK++FP    YS +L NLI  +L ENP  RPNI Q+L 
Sbjct: 339 FLYKLLFFTTPFERTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPSVRPNIYQVLQ 397

Query: 294 EVSRIQGVPCPVKNFY 309
            +  I G   P+ + Y
Sbjct: 398 YLCSINGWKVPLNDKY 413

>KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} similar
           to uniprot|P38080 Saccharomyces cerevisiae YBR059C AKL1
           Ser-Thr protein kinase
          Length = 901

 Score =  313 bits (803), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 162/340 (47%), Positives = 213/340 (62%), Gaps = 11/340 (3%)

Query: 4   PPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSA---EISPPDPNSSSI-------AC 53
           P LE   +G+ + VG+H+  I+KYL  GGFAHIY     E +     + SI       AC
Sbjct: 24  PVLERLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVKFVEYANELEQAPSITLKVGETAC 83

Query: 54  LKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCAR 113
           LKRVLV D+  LN +R EV  MK L     +V Y DSHA++S      +EV LLME C  
Sbjct: 84  LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRSRDGVPGFEVMLLMELCPN 143

Query: 114 GGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFK 173
             L+D+MN RL  +L E E+LKIM  V++ +A MH L  PLIHRD+KIENVL+  D NFK
Sbjct: 144 NSLLDYMNQRLTTKLSEQEILKIMFDVTRALAQMHYLPIPLIHRDVKIENVLVDGDNNFK 203

Query: 174 VCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGV 233
           +CDFGS    +      QE+  + ++I  +TT QYRSPEMIDLYR LP+DEKSDIWALG+
Sbjct: 204 LCDFGSTSTCLPVANTHQEIAVLTNNIYIHTTPQYRSPEMIDLYRCLPIDEKSDIWALGI 263

Query: 234 FLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLA 293
           FLYKL +YTTPFE  G+ AILHSK++FP    YS +L NLI  +L ENP  RPNI Q++ 
Sbjct: 264 FLYKLLFYTTPFELTGQFAILHSKYEFPI-NNYSSKLINLIIIMLAENPNLRPNIYQIMD 322

Query: 294 EVSRIQGVPCPVKNFYLERKMLLQQQQQQQQQLQPLRHSV 333
            +  I  V  P+++ Y       ++    Q +LQ +++ +
Sbjct: 323 NLCSIMKVENPIEDKYGMGPYSFEKYSAYQAKLQKVQYQM 362

>KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa]
           {ON} Anc_3.273 YBR059C
          Length = 1091

 Score =  317 bits (812), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 167/365 (45%), Positives = 223/365 (61%), Gaps = 32/365 (8%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISP----------------P 44
           +S   +E + +G  + VGSH   I+KYLT GGFA IY  +++                  
Sbjct: 21  ISNLAIEKFSAGESVAVGSHGVEIVKYLTEGGFAQIYLVKLTEYLNEFDAIDIQNQRQQQ 80

Query: 45  DPNSSSIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEV 104
           +     + CLKRV+V D+  L+ ++ EV+ MK L+    VV Y DS+A ++   NG +EV
Sbjct: 81  ELKIGDLVCLKRVMVYDEAGLSEMKNEVNVMKQLRGKPNVVQYYDSNATRNRGANGGFEV 140

Query: 105 FLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENV 164
           FLLMEYC    L+D+MN RL  +L E E+L IM  ++ GV+ +H L  PLIHRDIKIENV
Sbjct: 141 FLLMEYCPNKSLLDYMNQRLTTKLTESEILNIMYDITLGVSQLHFLDNPLIHRDIKIENV 200

Query: 165 LISEDGNFKVCDFGSVCGVIRPP--KNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPV 222
           L+  +  FK+CDFGS    I PP     Q+++ + HDI  +TT QYRSPEMIDL+R LPV
Sbjct: 201 LVDHNNRFKLCDFGSTN--ICPPIATTNQDISVLTHDIYVHTTPQYRSPEMIDLFRCLPV 258

Query: 223 DEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENP 282
           +EK+DIWALGVFLYKL +YTTPFE  G+ AILHSK++ P    YS++L NLI  +L ENP
Sbjct: 259 NEKADIWALGVFLYKLLFYTTPFELTGQFAILHSKYEIPQ-SHYSERLLNLIVVMLAENP 317

Query: 283 MQRPNICQLLAEVSRIQGVPCPV-----------KNFYLERKMLLQQQQQQQQQLQPLRH 331
             RPNI Q+L+E+  I  V  P+            NF L +K + + Q Q  Q +Q    
Sbjct: 318 NLRPNIYQVLSEICSILNVEVPIPDIYGAGVFNFNNFALFQKKVQKIQSQLFQMVQDRTK 377

Query: 332 SVSQP 336
           S SQP
Sbjct: 378 SRSQP 382

>CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P38080 Saccharomyces cerevisiae
           YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 1027

 Score =  315 bits (807), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 152/320 (47%), Positives = 208/320 (65%), Gaps = 12/320 (3%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEI-----------SPPDPNSS 49
           ++ P  E YP+G +++VG+H+  I+ YL  GGFA IY  +            S       
Sbjct: 12  LNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVG 71

Query: 50  SIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLME 109
            IACLKRV+V D+  LN +R EV+ MK LK+   +V Y DS+A++ +     +EV LLME
Sbjct: 72  DIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131

Query: 110 YCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISED 169
            C    L+D+MN RL+ +L E E+LKIM  VS G++ MH L  PLIHRDIKIENVL+  +
Sbjct: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDAN 191

Query: 170 GNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIW 229
            NFK+CD GS      P  + Q++  +  +I  +TT QYR+PEMIDLYR LP++EKSDIW
Sbjct: 192 NNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIW 251

Query: 230 ALGVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNIC 289
           ALG+FLYKL +YTTPFE  G++AILHSK+ FP   +YS ++ NLI  +L ENP  RPNI 
Sbjct: 252 ALGIFLYKLLFYTTPFEITGQMAILHSKYDFPPN-KYSSKIINLIIIMLAENPNLRPNIF 310

Query: 290 QLLAEVSRIQGVPCPVKNFY 309
           Q++  +  I  +P P+++ Y
Sbjct: 311 QVVYHICSIMNLPVPIEDRY 330

>Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059C
           (AKL1) - Serine-threonine protein kinase [contig 32]
           FULL
          Length = 935

 Score =  310 bits (795), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 157/340 (46%), Positives = 212/340 (62%), Gaps = 11/340 (3%)

Query: 4   PPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSA----------EISPPDPNSSSIAC 53
           P LE   +G+ + VG+H+  I+KYL  GGFAHIY            ++         +AC
Sbjct: 66  PVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLAC 125

Query: 54  LKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCAR 113
           LKRVLV D+  LN +R EV  MK L     +V Y DSHA+++   +  +EV LLME C  
Sbjct: 126 LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPN 185

Query: 114 GGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFK 173
             L+D+MN RL  +L E E+LKIM  V++ +A MH L  PLIHRD+KIENVL+  + NFK
Sbjct: 186 NSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFK 245

Query: 174 VCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGV 233
           +CDFGS           QE+  + ++I  +TT QYRSPEMIDLYR LP++EKSDIWALG+
Sbjct: 246 LCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGI 305

Query: 234 FLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLA 293
           FLYKL +YTTPFE  G+ AILHSK++FP    YS +L NLI  +L ENP  RPNI Q++ 
Sbjct: 306 FLYKLLFYTTPFELTGQFAILHSKYEFPVN-NYSSKLINLIIIMLAENPNLRPNIYQVMD 364

Query: 294 EVSRIQGVPCPVKNFYLERKMLLQQQQQQQQQLQPLRHSV 333
            +  I  V  P+++ Y       ++  Q Q +LQ +++ +
Sbjct: 365 NLCSILKVKNPLEDKYQLGSYSFEKYSQYQAKLQKVQYQM 404

>NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON}
           Anc_3.273
          Length = 1157

 Score =  313 bits (803), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 160/352 (45%), Positives = 213/352 (60%), Gaps = 26/352 (7%)

Query: 7   ETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSA---------EISPPDPNS--------- 48
           E +P+GT + VGSHK  IIKY+  GGFA IY+          E S  D N+         
Sbjct: 22  EKFPAGTQVAVGSHKVEIIKYIAEGGFAQIYAVKYVESLNEFEDSNTDENAHLSGDRQAP 81

Query: 49  -------SSIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGS 101
                    IACLKRVLV D+  LN +R EV+ MK LK    VV Y DS+A++       
Sbjct: 82  NPMILKLGDIACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRHNGASG 141

Query: 102 YEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKI 161
           +EV LLME C    L+D+MN RL  +L E E+LKIM  ++  V+ MH L+ PL+HRDIKI
Sbjct: 142 FEVLLLMELCPNKSLLDYMNQRLTTKLTEHEILKIMYDITFAVSHMHYLKIPLLHRDIKI 201

Query: 162 ENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLP 221
           ENVL+    NFK+CDFGS    +      Q++  +  +I  +TT QYRSPEMIDLYR LP
Sbjct: 202 ENVLVDAQNNFKLCDFGSTSTRLPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLP 261

Query: 222 VDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLREN 281
           +DEKSDIWALG+FLYKL ++ TPFE  G+ AILHSK++FP    YS +L NLI  +L EN
Sbjct: 262 IDEKSDIWALGIFLYKLLFFITPFEMTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAEN 320

Query: 282 PMQRPNICQLLAEVSRIQGVPCPVKNFYLERKMLLQQQQQQQQQLQPLRHSV 333
           P  RPNI Q+L  +  +  V  P+++ Y +     ++    Q ++Q +++ V
Sbjct: 321 PNLRPNIYQVLDNICSMMNVEVPIEDIYEQGPYNFEKYTHFQNKIQNIQYHV 372

>NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]
           {ON} Anc_3.273
          Length = 1095

 Score =  312 bits (799), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 157/342 (45%), Positives = 210/342 (61%), Gaps = 12/342 (3%)

Query: 3   QPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEI-----------SPPDPNSSSI 51
           +P  E Y  GT + VG+HK  IIKY+  GGFA IY+ +              P      +
Sbjct: 16  KPNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDV 75

Query: 52  ACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYC 111
           ACLKRVLV D+  LN +R EV+ MK L+    +V Y DS+A++       +EV LLME C
Sbjct: 76  ACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELC 135

Query: 112 ARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGN 171
               L+D+MN RL  +L E E+LKIM  V+  V+ MH L  PL+HRDIKIENVL+    N
Sbjct: 136 PNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNN 195

Query: 172 FKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWAL 231
           FK+CDFGS           Q++  +  +I  +TT QYRSPEMIDLYR LP+DEKSDIWAL
Sbjct: 196 FKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWAL 255

Query: 232 GVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQL 291
           G+FLYKL ++TTPFE  G+ AILHSK++FP    YS +L NLI  +L ENP  RPNI Q+
Sbjct: 256 GIFLYKLLFFTTPFELTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPNLRPNIYQV 314

Query: 292 LAEVSRIQGVPCPVKNFYLERKMLLQQQQQQQQQLQPLRHSV 333
           L  +  I G+  P+++ Y E     ++    Q ++Q +++ +
Sbjct: 315 LHNICSISGMKVPIEDQYAEGPYDFEKYTHFQNKVQSVQYQL 356

>KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.273
           YBR059C
          Length = 913

 Score =  308 bits (790), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 162/347 (46%), Positives = 215/347 (61%), Gaps = 31/347 (8%)

Query: 6   LETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSA-----------EISPPDPNS---SSI 51
           +E Y  G V+ VGSH+  I++Y+  GGFA IYS            E SP   +      +
Sbjct: 15  VEKYQPGKVIVVGSHRVEILQYIAEGGFAQIYSVKFLEYANEFDREESPGSKDQLQVGDL 74

Query: 52  ACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGS--------YE 103
           ACLKRV+V D+  LN LR EV+ MK L     +V Y DS+A++  L NG+        +E
Sbjct: 75  ACLKRVIVQDQNGLNELRNEVNVMKKLVGAPNIVQYYDSNASR--LRNGTDSQPQENKFE 132

Query: 104 VFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIEN 163
           V LLME C    L+D+MN RL  +L E E+L++M  VS  +A MH L+ PLIHRDIKIEN
Sbjct: 133 VLLLMELCPNKSLLDYMNLRLATKLSEQEILEVMYDVSLAIAQMHYLRKPLIHRDIKIEN 192

Query: 164 VLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVD 223
           VL+ +   FK+CDFGS           +++ Y+  +I  +TT QYRSPEMIDLYR LP+D
Sbjct: 193 VLVDQKNRFKLCDFGSTSTCFPMVVTHRDIAYLTQNIYVHTTPQYRSPEMIDLYRCLPID 252

Query: 224 EKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPM 283
           EKSDIWALG+FLYKL ++TTPFE+ G+ AILHSKF+FP    YS +L NLI  +L ENP 
Sbjct: 253 EKSDIWALGIFLYKLLFFTTPFERTGQFAILHSKFEFPQN-NYSFKLINLIIVMLSENPN 311

Query: 284 QRPNICQLLAEVSRIQGVPCPVKNFY------LERKMLLQQQQQQQQ 324
            RPNI Q+L ++ +++ VP P+ + Y       +  ML Q   Q+ Q
Sbjct: 312 LRPNIYQVLHQICQLKQVPIPIADKYGLGAYNFDYYMLFQNNLQKVQ 358

>Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {ON}
           YBR059C (REAL)
          Length = 1107

 Score =  310 bits (794), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 159/351 (45%), Positives = 216/351 (61%), Gaps = 11/351 (3%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAE----ISPPDPNSS------S 50
           M  P +E Y  G ++ VG+HK  I+ YL  GGFA IY+ +    ++  D  +S       
Sbjct: 14  MGHPAVERYTPGKIVCVGTHKVEIVNYLAEGGFAQIYAVKFLEYLNEFDNTASLPLKIGD 73

Query: 51  IACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEY 110
           +ACLKRVLV D+  LN +R EV+ MK LK    VV Y DS+A++       +EV LLME 
Sbjct: 74  VACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 111 CARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDG 170
           C    L+D+MN RL  +L E E++KIM  V+  ++ MH L  PLIHRDIKIENVL+  + 
Sbjct: 134 CPNKSLLDYMNQRLSTKLSESEIVKIMYDVALSISEMHYLPVPLIHRDIKIENVLVDAEN 193

Query: 171 NFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWA 230
           NFK+ DFGS           Q++  +  +I  +TT QYRSPEMIDLYR LP++EKSDIWA
Sbjct: 194 NFKLADFGSTSTSFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 231 LGVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQ 290
           LG+FLYKL ++TTPFE  G+ AILHSK++FP   +YS +L NLI  +L ENP  RPNI Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFPV-NKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 291 LLAEVSRIQGVPCPVKNFYLERKMLLQQQQQQQQQLQPLRHSVSQPQMEAI 341
           +L  +  I     P+++ Y E      +  + Q +LQ ++  + Q Q + I
Sbjct: 313 VLYHICDILNAEVPIEDKYSEGAYDFAKYTKFQNKLQNVQIQMYQLQQKKI 363

>KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}
           Anc_3.273 YBR059C
          Length = 949

 Score =  307 bits (787), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 201/322 (62%), Gaps = 19/322 (5%)

Query: 6   LETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSA-------EISPPDPNSS--------- 49
           +E +  G  L VG+HK  I+ YLT GGFA IY         E    D  S+         
Sbjct: 28  IEKFEKGQNLAVGTHKVEIVDYLTEGGFAQIYVVKFIEVLNEFDNEDNGSNVRISNYSLK 87

Query: 50  --SIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLL 107
              +ACLKRVLV D+  LN +R EV+ MK L+    +V Y DS+A +S   N  YEV LL
Sbjct: 88  LGDVACLKRVLVYDEVGLNEMRNEVNVMKKLRGCPNIVQYYDSNATRSHNGNPGYEVLLL 147

Query: 108 MEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLIS 167
           ME C+   L+++MN RL  +L E EVLKIM  V+ GVA MH L+ PLIHRDIKIENVL+ 
Sbjct: 148 MELCSNNSLLNYMNQRLATQLSEKEVLKIMYDVTSGVAQMHYLKTPLIHRDIKIENVLVD 207

Query: 168 EDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSD 227
            + NFK+CDFGS           Q++  +  ++  +TT QYRSPEMIDLYR LP++EKSD
Sbjct: 208 SNNNFKLCDFGSATTCPPVATTHQDIALLGQNVYVHTTPQYRSPEMIDLYRYLPINEKSD 267

Query: 228 IWALGVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPN 287
           IWALGVFLYKL +YTTPFE  G+ A+LHSKF  PA  +YS ++ NL+  +L EN   RPN
Sbjct: 268 IWALGVFLYKLLFYTTPFETTGQFAMLHSKFDIPA-NKYSSKIINLVIIMLSENLNLRPN 326

Query: 288 ICQLLAEVSRIQGVPCPVKNFY 309
           I Q++  + ++  V  P+ + Y
Sbjct: 327 IYQVMHYICQLIQVDTPILDIY 348

>Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {ON}
           YBR059C (REAL)
          Length = 1108

 Score =  310 bits (793), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 159/351 (45%), Positives = 215/351 (61%), Gaps = 11/351 (3%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAE----ISPPDPNSS------S 50
           M  P +E +  G ++ VG+HK  +I YL  GGFA IY  +    ++  D  +S       
Sbjct: 14  MGHPAVERFTPGHIVCVGTHKVEVINYLAEGGFAQIYMVKFVEYLNEFDNAASVPLKIGD 73

Query: 51  IACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEY 110
           +ACLKRVLV D+  LN +R EV+ MK LK    VV Y DS+A++       +EV LLME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 111 CARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDG 170
           C    L+D+MN RL  +L E E++KIM  V   ++ MH L  PLIHRDIKIENVL+  + 
Sbjct: 134 CPNKSLLDYMNQRLSTKLTESEIVKIMYDVVLSISQMHYLPVPLIHRDIKIENVLVDANN 193

Query: 171 NFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWA 230
           NFK+ DFGS           Q++  +  +I  +TT QYRSPEMIDLYR LP++EKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 231 LGVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQ 290
           LG+FLYKL ++TTPFE  G+ AILHSK++FP   +YS +L NLI  +L ENP  RPNI Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFPV-NKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 291 LLAEVSRIQGVPCPVKNFYLERKMLLQQQQQQQQQLQPLRHSVSQPQMEAI 341
           +L  +  I  +  P+++ Y E      +  Q Q +LQ ++  + Q Q + I
Sbjct: 313 VLYHLCEILNIEVPIEDKYTEGAYNFSKYTQFQNKLQNVQLQMYQLQQKKI 363

>YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON}
           AKL1Ser-Thr protein kinase, member (with Ark1p and
           Prk1p) of the Ark kinase family; involved in endocytosis
           and actin cytoskeleton organization
          Length = 1108

 Score =  310 bits (793), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 159/351 (45%), Positives = 214/351 (60%), Gaps = 11/351 (3%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAE----ISPPDPNSS------S 50
           M  P +E Y  G ++ VG+HK  ++ YL  GGFA IY  +    ++  D  +S       
Sbjct: 14  MGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGD 73

Query: 51  IACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEY 110
           +ACLKRVLV D+  LN +R EV+ MK LK    +V Y DS+A++       +EV LLME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 111 CARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDG 170
           C    L+D+MN RL  +L E E++KIM  V+  ++ MH L   LIHRDIKIENVL+    
Sbjct: 134 CPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN 193

Query: 171 NFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWA 230
           NFK+ DFGS           Q++  +  +I  +TT QYRSPEMIDLYR LP++EKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 231 LGVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQ 290
           LGVFLYKL ++TTPFE  G+ AILHSK++FP   +YS +L NLI  +L ENP  RPNI Q
Sbjct: 254 LGVFLYKLLFFTTPFEMTGQFAILHSKYEFPV-NKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 291 LLAEVSRIQGVPCPVKNFYLERKMLLQQQQQQQQQLQPLRHSVSQPQMEAI 341
           +L  +  I  V  P+++ Y E      +  Q Q +LQ ++  + Q Q + I
Sbjct: 313 VLYHLCEILNVEVPIEDKYAEGAYNFSKYTQFQNKLQNVQLQMYQLQQKKI 363

>Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {ON}
           YBR059C (REAL)
          Length = 1090

 Score =  309 bits (791), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 161/351 (45%), Positives = 214/351 (60%), Gaps = 11/351 (3%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSA---EISPPDPNSSSI------ 51
           M  P +E Y  G ++ VG+HK  I+ YL  GGFA IY     E      N++S+      
Sbjct: 14  MGHPAVERYTPGDIVCVGTHKVEIVNYLAEGGFAQIYVVKFLEYLNEFDNAASVPLKIGD 73

Query: 52  -ACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEY 110
            ACLKRVLV D+  LN +R EV+ MK LK    VV Y DS+A++       +EV LLME 
Sbjct: 74  LACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 111 CARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDG 170
           C    L+D+MN RL  +L E E++KIM  V+  ++ MH L  PLIHRDIKIENVL+    
Sbjct: 134 CPNKSLLDYMNQRLSTKLTETEIVKIMYDVALSISQMHYLPVPLIHRDIKIENVLVDAKD 193

Query: 171 NFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWA 230
           +FK+ DFGS           Q++  +  +I  +TT QYRSPEMIDLYR LP++EKSDIWA
Sbjct: 194 SFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 231 LGVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQ 290
           LG+FLYKL ++TTPFE  G+ AILHSK++FP   +YS +L NLI  +L ENP  RPNI Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFPV-NKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 291 LLAEVSRIQGVPCPVKNFYLERKMLLQQQQQQQQQLQPLRHSVSQPQMEAI 341
           +L  +  I  V  P+++ Y E      +  Q Q +LQ ++  + Q Q + I
Sbjct: 313 VLCHLCDILNVEVPIEDKYAEGPYNFARYTQFQNKLQNVQLQMYQLQQKKI 363

>TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {ON}
           Anc_3.273 YBR059C
          Length = 788

 Score =  303 bits (775), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 158/347 (45%), Positives = 212/347 (61%), Gaps = 11/347 (3%)

Query: 5   PLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAE----ISPPDPNS------SSIACL 54
           P++TY  G ++ VG HK  IIKYL  GGFA IY A+    I   D N         + CL
Sbjct: 95  PIDTYVPGHIVEVGIHKVEIIKYLAEGGFAKIYVAKFLQYIKQIDINKIQVLQPGDLICL 154

Query: 55  KRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARG 114
           KRVLV D   LN +R EV  MK L     +V   DS+A++ +     YEV LLME C+  
Sbjct: 155 KRVLVTDDNGLNEMRNEVSVMKKLIGAPNIVQLYDSNASRRTDGIAGYEVLLLMELCSNK 214

Query: 115 GLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKV 174
            L+D+MN RL  +L E E+LKIM  V+  VA MH L  PLIHRDIKIENVL+    NFK+
Sbjct: 215 SLLDYMNQRLAVKLTEPEILKIMFDVTLAVAQMHYLPIPLIHRDIKIENVLVDSQNNFKL 274

Query: 175 CDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVF 234
           CDFGS    +      +++  +  ++  +TT QYRSPEMID+YR + ++EKSDIWALG+F
Sbjct: 275 CDFGSTSTCMPIATTHRDMAALTQNLYVHTTPQYRSPEMIDVYRCIHINEKSDIWALGIF 334

Query: 235 LYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAE 294
           LYKL +Y TPFE+ G+ AILHSK++FP +  YS +L NLI  +L ENP  RPNI Q+LA 
Sbjct: 335 LYKLLFYITPFERTGQFAILHSKYEFPQH-SYSMKLINLIIIMLAENPNLRPNIYQVLAY 393

Query: 295 VSRIQGVPCPVKNFYLERKMLLQQQQQQQQQLQPLRHSVSQPQMEAI 341
           + +I  +  P+ + Y       Q+    Q  LQ  ++ + Q Q+ ++
Sbjct: 394 ICKIINIKTPIDDIYGLGPYDFQKYTNYQTALQNSQNQMYQVQIRSM 440

>ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 1115

 Score =  309 bits (791), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 159/349 (45%), Positives = 214/349 (61%), Gaps = 25/349 (7%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEI------------SPPDPNS 48
           +++P ++ Y  GTV+ VG+ +  II ++  GGFA IYS +             +P  P  
Sbjct: 14  VTKPVVDGYAPGTVVAVGNQQVEIISFIAEGGFAQIYSVKYIKFLGEFNNGSKAPLQP-- 71

Query: 49  SSIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLM 108
             IACLKRVLVPD+  L+ +R EV+ MK L+  K ++ Y DS+A++ +     YEV LLM
Sbjct: 72  GDIACLKRVLVPDENGLSEMRNEVEVMKQLRGAKAIIQYYDSNASRRTSGQVGYEVLLLM 131

Query: 109 EYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISE 168
           E C    L+D+MN RL  RL E E+LK+M   +  ++ MH L  PLIHRDIKIENVL+  
Sbjct: 132 ELCPNNSLLDYMNQRLATRLTEKEILKVMYDTTLAISQMHYLPIPLIHRDIKIENVLVDA 191

Query: 169 DGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDI 228
             NFK+CDFGS           Q++  +  +I  NTT QYRSPEMIDLYR LP++EKSDI
Sbjct: 192 QNNFKLCDFGSTSTCFPLVTTHQDIAILTQNIYVNTTPQYRSPEMIDLYRCLPINEKSDI 251

Query: 229 WALGVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNI 288
           WALG+FLYKL ++ TPFE  G+ +ILHSK++FPA  +YS +L NLI  +L ENP  RPNI
Sbjct: 252 WALGIFLYKLLFFITPFEMTGQFSILHSKYEFPAN-KYSSKLINLIIIMLAENPYVRPNI 310

Query: 289 CQLLAEVSRIQGVPCPVK--------NF--YLERKMLLQQQQQQQQQLQ 327
            Q++  +  + G   P++        NF  Y E +  LQ  Q Q   LQ
Sbjct: 311 YQVMHHICSVIGCEVPIEDKYGLGPYNFEKYTEFQTKLQNVQYQMYLLQ 359

>TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3.273
           YBR059C
          Length = 1049

 Score =  305 bits (782), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 159/347 (45%), Positives = 206/347 (59%), Gaps = 21/347 (6%)

Query: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEI----------SPPDPNSSS 50
           +  P +E +  G V+ VG+H+  ++ YL  GGFA IY  +           S        
Sbjct: 14  VGNPTMERFLPGAVVAVGTHRVEVVNYLAEGGFAQIYVVKFLEYLNEFENKSKVPMKVGD 73

Query: 51  IACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEY 110
           +ACLKRVLV D+  L+ +R EV+ MK L   + +V Y DS+A +    N  +EV LLME 
Sbjct: 74  VACLKRVLVQDENGLSEMRNEVEVMKQLMGAQNIVQYYDSNACRRHNGNAGFEVLLLMEL 133

Query: 111 CARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDG 170
           C    L+D+MN RL  +L E E+LKIM  VS  V+ MH L+ PLIHRDIKIENVL+    
Sbjct: 134 CPNKSLLDYMNQRLATKLTEKEILKIMYDVSLAVSQMHYLKNPLIHRDIKIENVLVDAQN 193

Query: 171 NFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWA 230
           +FK+CDFGS           QE+  +  +I  +TT QYR PEMIDLYR LP++EKSDIWA
Sbjct: 194 SFKLCDFGSTSQCFPVVTTHQEIAILTQNIYVHTTPQYRCPEMIDLYRCLPINEKSDIWA 253

Query: 231 LGVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQ 290
           LG+FLYKL ++ TPFE  G+ AILHSK++FP    YS QL NLI  +L ENP  RPNI Q
Sbjct: 254 LGIFLYKLLFFITPFEMTGQFAILHSKYEFPPN-HYSSQLINLIIIMLAENPFVRPNIYQ 312

Query: 291 LLAEVSRIQGVPCPVK--------NF--YLERKMLLQQQQQQQQQLQ 327
           +L  +  + GV  P++        NF  Y E +  LQ  Q Q   LQ
Sbjct: 313 VLNHICTMIGVEVPIEDKYGCGAYNFDKYAEFQTKLQNAQYQMYMLQ 359

>KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 814

 Score =  298 bits (764), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 149/309 (48%), Positives = 196/309 (63%), Gaps = 12/309 (3%)

Query: 12  GTVLTVGSHKARIIKYLTSGGFAHIY-----------SAEISPPDPNSSSIACLKRVLVP 60
            T + VG+H+  I+++L  GGFA+IY            A I      +  IACLKRV+VP
Sbjct: 32  NTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVP 91

Query: 61  DKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFM 120
           D+  LN LR EV+ MK L+    +V Y DS+A++    +  +E+ LLME C +  L+D+M
Sbjct: 92  DENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYM 151

Query: 121 NTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSV 180
           N +L  +L E E+LKIM  VS  +A MH L  PLIHRDIKIENVL+ +D NFK+CDFGS 
Sbjct: 152 NNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGST 211

Query: 181 CGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCY 240
                     Q++  + ++I  +TT QYRSPEMIDLYR LP++EKSDIWALG+FLYKL +
Sbjct: 212 SMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLF 271

Query: 241 YTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQG 300
           YTTPFE  G+ AILHSK++ P    YS +L NLI  +L ENP  RPNI Q++  V  I  
Sbjct: 272 YTTPFELTGQFAILHSKYEIPQN-GYSSKLINLIIIMLAENPSLRPNIYQVMHHVCSILK 330

Query: 301 VPCPVKNFY 309
              P  + Y
Sbjct: 331 CDVPFTDKY 339

>TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3.273
           YBR059C
          Length = 1054

 Score =  302 bits (774), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 155/324 (47%), Positives = 195/324 (60%), Gaps = 32/324 (9%)

Query: 6   LETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEI----------------SPPDPNSS 49
           +E Y  GT+LTVG  +  I+KYLT GGFA IY+                   +  +    
Sbjct: 37  IEKYKQGTILTVGIRRIEILKYLTEGGFAQIYTVRFIEYLNEFDNDDAENDNNSRNLKIG 96

Query: 50  SIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNG--------- 100
            +ACLKRVLVPD+  L+ +R EVD MK L     +V Y DS+A+K   N+          
Sbjct: 97  DVACLKRVLVPDENGLSEMRNEVDVMKKLVNCPNIVQYYDSNASKIKDNSNIDTTNNNDN 156

Query: 101 ------SYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPL 154
                  +E+ LLMEYC    L+DFMN RL  +L E E+LK M+ ++  V  MH L  PL
Sbjct: 157 NKNTDLGFEILLLMEYCPNKSLLDFMNQRLTTKLTENEILKAMTDITTAVLQMHYLAQPL 216

Query: 155 IHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMI 214
           IHRDIKIENVL+  + NFK+ DFGS   +  P    Q++  +  DI  NTT QYRSPEMI
Sbjct: 217 IHRDIKIENVLVDSNNNFKLADFGSTTKIQPPITTHQDIAILNKDIYMNTTPQYRSPEMI 276

Query: 215 DLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLI 274
           DLY+ LP+DEKSDIWALGV LYKL +YTTPFE  G+ AILHSK++FPA   YS +  NLI
Sbjct: 277 DLYKCLPIDEKSDIWALGVLLYKLLFYTTPFELTGQFAILHSKYEFPA-NNYSSKFINLI 335

Query: 275 SALLRENPMQRPNICQLLAEVSRI 298
             +L ENP  RPNI Q+L  +  I
Sbjct: 336 IIMLAENPNLRPNIFQVLYYLKSI 359

>AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR059C
           (AKL1)
          Length = 961

 Score =  300 bits (768), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 152/338 (44%), Positives = 209/338 (61%), Gaps = 10/338 (2%)

Query: 5   PLETYPSGTVLTVGSHKARIIKYLTSGGFAHIY-------SAEISPPDP--NSSSIACLK 55
           PLE   +G+ + VG H+  +I+YL  GGFAHIY       + E+   D         CLK
Sbjct: 25  PLEMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLK 84

Query: 56  RVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGG 115
           RV V D+  LN LR EV+ MK L+    +V Y DS+A++       YEV LLME C  G 
Sbjct: 85  RVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGS 144

Query: 116 LIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVC 175
           L+D+MN RL  +L E EVLKIM  ++ G++ MH  + PLIHRDIKIENVL+  D NFK+C
Sbjct: 145 LLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLC 204

Query: 176 DFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFL 235
           DFGS    +    + QE+  + ++I  +TT QYRSPEMIDLYR LP++EKSDIWALG+FL
Sbjct: 205 DFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFL 264

Query: 236 YKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEV 295
           YKL +YTTPFE  G+ AILHSK++ P    +S +L NL+  +L ENP  RPN+ Q++  +
Sbjct: 265 YKLLFYTTPFELTGQFAILHSKYEIPRN-SFSSKLINLVIIMLAENPYLRPNVYQVMYHI 323

Query: 296 SRIQGVPCPVKNFYLERKMLLQQQQQQQQQLQPLRHSV 333
             +      + + Y +         + Q++LQ L++ +
Sbjct: 324 CSMMECEVKIDDLYGQGPYNFDMYGRYQEKLQRLQYDM 361

>CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 991

 Score =  300 bits (769), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 163/367 (44%), Positives = 225/367 (61%), Gaps = 34/367 (9%)

Query: 1   MSQPPLET-YPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEI----------------SP 43
           ++QP +E  +P+G V+TVGSH+  ++ YL  GGFA IY  +                  P
Sbjct: 87  VAQPQIEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQP 146

Query: 44  PDPNSSSIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGS-- 101
             P S   ACLKRVLV D+  LN +R+EV+ MK L+    +V Y DS+A++    +G+  
Sbjct: 147 LKPGSP--ACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNIT 204

Query: 102 --YEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDI 159
             +EV LLME C    L+D+MN RL  +L E E+ KIM  ++  VA MH L  PLIHRDI
Sbjct: 205 QGFEVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDI 264

Query: 160 KIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRG 219
           KIENVL+  + NFK+CDFGS         + Q++  +  D+  +TT QYRSPEMIDL++ 
Sbjct: 265 KIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKY 324

Query: 220 LPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLR 279
           +P++EKSDIWALGVFLYKL ++TTPFE+ G+ A+LHSKF+FP    YS +L NLI  +L 
Sbjct: 325 IPINEKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPN-SYSSKLINLIIVMLA 383

Query: 280 ENPMQRPNICQL---LAEVSRIQGVPCPVKNFY------LERKMLLQQQQQQ-QQQLQPL 329
           ENP  RPNI Q+   L+EV+  +  P  + + Y       E+    Q++ QQ Q QL  L
Sbjct: 384 ENPSLRPNIYQVLYYLSEVTNREVPPTVLSDKYGQGPYNFEKYTRFQKESQQVQLQLSTL 443

Query: 330 RHSVSQP 336
           +  ++ P
Sbjct: 444 QAKINDP 450

>TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1361

 Score =  292 bits (748), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 142/316 (44%), Positives = 196/316 (62%), Gaps = 13/316 (4%)

Query: 6   LETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEI--------SPPDP----NSSSIAC 53
           +E Y  G +++VG+H+ +I  YL  GGFA IY  +         +  D      S  IAC
Sbjct: 32  IEKYKPGKLISVGAHQVKIEDYLAEGGFAQIYKVKFIDYLNEFENKKDQLNSLKSGDIAC 91

Query: 54  LKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCAR 113
           LKRVLV D+  LN +R EV+ MKLL+    +V Y DS+A + +     YE+ LLME C  
Sbjct: 92  LKRVLVNDENGLNEMRNEVEVMKLLQGCPNIVQYYDSNALRRNDGLNGYEILLLMELCPN 151

Query: 114 GGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFK 173
             L+D+MN RL+ +L E E++KIM   +  V+ MH L  PLIH+DIK+EN+L+  + NFK
Sbjct: 152 NSLLDYMNQRLKTKLNETEIVKIMYDTTLAVSQMHYLDKPLIHKDIKVENILVDSNNNFK 211

Query: 174 VCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGV 233
           +CDFGS         +  ++  +  +I  +TT QYRSPEMIDLYR LP++E SDIWALGV
Sbjct: 212 LCDFGSTSPCYEIVTSHHDIAVLTQNIYMHTTPQYRSPEMIDLYRCLPINETSDIWALGV 271

Query: 234 FLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLA 293
           FLYKL ++ TPFE+ G+ +ILH+KF  P    Y  +L NLI  +L EN   RPNI Q++ 
Sbjct: 272 FLYKLLFFITPFERTGQFSILHAKFDIPVN-NYHPKLINLIIIMLSENLNLRPNIYQVMY 330

Query: 294 EVSRIQGVPCPVKNFY 309
           E+  I   P P+++ Y
Sbjct: 331 EICSITNTPLPIEDKY 346

>Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236C -
           Hypothetical ORF [contig 165] FULL
          Length = 346

 Score =  106 bits (265), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 86/338 (25%), Positives = 146/338 (43%), Gaps = 62/338 (18%)

Query: 13  TVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLNSLRAEV 72
           + +++   K RI K L  GG + +Y  E          +  LK+   P      S+ +  
Sbjct: 17  SFVSINGRKYRIQKLLGEGGLSFVYLVE-----SKEGELFALKKTRCP----FGSIGSIS 67

Query: 73  DAMKLLKAHK-----FVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQN- 126
            AMK +  ++     ++   +DS   +    +GS  V++L+ Y A+G L D +N  L + 
Sbjct: 68  PAMKEVANYQRFSSPYIAQIVDSQVVQE--KDGSKTVYVLLPYFAKGSLQDLINRHLLDC 125

Query: 127 -RLKEFEVLKIMSQVSQGVAAMHALQP--------------------------------- 152
            ++ E ++L++   +++G+  +H   P                                 
Sbjct: 126 TQMSELDILRMALGIARGLLCIHEANPNHETDVAYSIVSAPYAEDSSLLNDLELDTFGES 185

Query: 153 --PLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNP-QELNYVQHDILKNTTAQYR 209
                HRD+K  N++IS +    + D GS C   R   N  Q L   Q     N T  Y 
Sbjct: 186 QQSYAHRDVKPSNIMISPEDLPVISDLGS-CSRARIDINSRQALLRFQEWSSDNCTLSYA 244

Query: 210 SPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEV-------AILHSKFQFPA 262
           +PE++D+     + EK DIW+ G  +Y +C+  +PFE+  ++       AI   K+  P 
Sbjct: 245 APEILDVKLNSVITEKCDIWSFGCTMYSMCFGISPFEREEQISGASVTYAITTGKYTVPR 304

Query: 263 YPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQG 300
              YS  L  LI   L  NP QRP++ +L+A +  +QG
Sbjct: 305 GTSYSSSLIELIGKCLSVNPEQRPSVNELIALLMELQG 342

>KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON} 
          Length = 668

 Score =  108 bits (270), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 72/267 (26%), Positives = 136/267 (50%), Gaps = 42/267 (15%)

Query: 46  PNSSSIACLKRVLVPD-KPSLN---SLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGS 101
           P S +   LK++ + D K   N   ++  E++  KL+  HK ++S ID     +++    
Sbjct: 70  PTSDATLALKKLPINDYKLKTNRRSTILKEIEIHKLVNGHKNIISMIDHFEIDATM---- 125

Query: 102 YEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKI 161
              ++++E C  G L D +  R +  L+E+E  ++M Q+   V  +H  +  ++H D+K+
Sbjct: 126 ---YMVLELCGAGSLYDII-CRSKRSLREWEAKRLMIQLCGAVDWIH--EKNIVHADLKL 179

Query: 162 ENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNT-----TAQYRSPEMIDL 216
            N+LI    N ++CDFG               ++V  DI  N+     T  Y SPE+I  
Sbjct: 180 SNILIDSSNNLQLCDFGH--------------SFVSTDIDNNSINKFGTPNYLSPEIISN 225

Query: 217 Y-----RGLPVDEKSDIWALGVFLYKLCYYTTPFE----KAGEVAILHSKFQFPAYPQYS 267
           +     + L   ++SDIW++G+ LY + +  TPFE    ++    I+  K+ F    + S
Sbjct: 226 FILSDKKDLYFPKESDIWSIGIVLYAMIFDKTPFEATTLRSTYENIVECKYGFVENKRVS 285

Query: 268 DQLKNLISALLRENPMQRPNICQLLAE 294
           +++K LI  +L+  P++R  I +++++
Sbjct: 286 NKVKKLIQNILKIQPLERKTIVEIVSD 312

>SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 364

 Score =  104 bits (260), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 92/354 (25%), Positives = 158/354 (44%), Gaps = 76/354 (21%)

Query: 13  TVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLNSLRAEV 72
           +VL  G H A I + L  GGF+ +Y  +       ++ +  LK++  P      ++ +  
Sbjct: 20  SVLINGQHYA-IQRLLGEGGFSFVYLVQ----SRENNDLFALKKIHCP----FGNIESVS 70

Query: 73  DAMKLLKAHK-FVVSYIDSHAAKSSL---NNGSYEVFLLMEYCARGGLIDFMNTRLQN-- 126
           +AM+ + ++K F   YI +H   S +    +GS  VF+L+ Y   G L+D +NT L +  
Sbjct: 71  EAMREVNSYKKFRSPYI-THCVSSQVLQEQDGSKTVFILLPYFPTGSLLDKINTHLLDGT 129

Query: 127 RLKEFEVLKIMSQVSQGVAAMH-------------ALQPPLIHRD--------------- 158
            + E E+++I+  V++G+  MH             ++   L +RD               
Sbjct: 130 TISEEEIVRILVSVARGLRTMHNPAGQEDSIEDQTSVNTDLQYRDTVSMTYNEDLRLLND 189

Query: 159 -------------------------IKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQEL 193
                                    IK  N++ S DG   +CD GS         +  +L
Sbjct: 190 SLELDVLSGNTSSFMASTTAYSHKDIKPANIMFSSDGLPVICDLGSCSRAHVDISSRSQL 249

Query: 194 NYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEV-- 251
              Q    ++ T  +RSPE++++     +DEK DIW+LG  LY +C+  +PFE+  ++  
Sbjct: 250 VEFQEWCNEHCTLPFRSPELLNVTLNSKIDEKVDIWSLGCTLYCMCFGISPFEREEQLSG 309

Query: 252 -----AILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQG 300
                AI   KF  P    YS +L  +I   +  +  +RP+I +LLA +  +QG
Sbjct: 310 ASMTYAIATGKFSIPPNTNYSPELIKIIKDCIEVDSKKRPSIDELLARLQDLQG 363

>TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON}
           Anc_6.262 YPL236C
          Length = 372

 Score =  100 bits (249), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 84/352 (23%), Positives = 155/352 (44%), Gaps = 66/352 (18%)

Query: 11  SGTVLTVGSHKARIIKYLTSGGFAHIY--------SAEISPPDPNSSSIACLKRVLVP-- 60
           S + +++   +  I + L  G  + +Y        +A  S    N+  +  LKR+  P  
Sbjct: 22  SDSYVSINGRRYTIRRLLGEGTLSFVYLVQRLGSKTATGSISLGNAPELYALKRIRCPFG 81

Query: 61  DKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFM 120
           +  S+++   EVD  K  ++  ++++ +DS   +    +GS  + +L+ Y   G L D +
Sbjct: 82  NIESISAAMKEVDNYKRFQS-PYIITLVDSQVVQE--KDGSKTLCILLPYFPLGSLQDMV 138

Query: 121 NTRL--QNRLKEFEVLKIMSQVSQGVAAMH----------------------------AL 150
           N  L     + E E ++IM  +++G+  +H                              
Sbjct: 139 NRNLLKGTFVSEAECIRIMIGIARGLRCLHDPSARETSDAETMRDTVSLSYSDEAAFLLD 198

Query: 151 QPPL----------------IHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELN 194
             PL                +HRDI++ N+L S +G   V D GS C          +LN
Sbjct: 199 DTPLELDVLSSHNTVNTRSYVHRDIRLANILFSSEGLPVVSDLGSCCKADITVSTKHQLN 258

Query: 195 YVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEV--- 251
            +Q  +  N +  Y +PE++++     +D K+DIW++G   Y + +  +PFE+  +V   
Sbjct: 259 ELQDWVTANCSFPYTAPELLNVKLNSTIDCKADIWSVGCTCYAMLFGMSPFERELQVSGA 318

Query: 252 ----AILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299
               AI   K+ FP   +YS+ L  +I + L+ +P  RP+I +LL  +  +Q
Sbjct: 319 SLTYAIGCGKYTFPKQTRYSESLLAVIKSCLQVDPTARPDINELLDTLQDLQ 370

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score =  100 bits (250), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 78/271 (28%), Positives = 132/271 (48%), Gaps = 29/271 (10%)

Query: 27  YLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVS 86
           +L  GGFA  +  ++   D    +   + ++ +  + + N L +E+   K ++ H+ +V 
Sbjct: 103 FLGEGGFARCF--QMKDDDGKVFAAKTVAKISIKSEKARNKLLSEIQIHKNMR-HQNIVH 159

Query: 87  YIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAA 146
           +ID    +  +N     V++L+E C  G L+D +  R    L E EV    +Q+   +  
Sbjct: 160 FID--CFEDDIN-----VYILLEICPNGSLMDLLKRR--KILTEPEVRFFTTQICGALDH 210

Query: 147 MHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTA 206
           MH+    +IHRD+K+ N+   +D N K+ DFG +  +I    N  E  Y         T 
Sbjct: 211 MHSRN--IIHRDLKLGNIFFDKDFNLKIGDFG-LAAIIN---NENERKYTIC-----GTP 259

Query: 207 QYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVA-----ILHSKFQFP 261
            Y +PE+I   + +    + DIW+LGV ++ +     PF+ A EV+     I H  + FP
Sbjct: 260 NYIAPEVIMGGKQIGHSFEVDIWSLGVMIFAMITGKPPFQ-AKEVSTIYDRIKHCNYSFP 318

Query: 262 AYPQYSDQLKNLISALLRENPMQRPNICQLL 292
                S  +K LI  +L  NPM+RP I ++L
Sbjct: 319 TDKYVSKDVKKLIQDILSMNPMERPTIQEIL 349

>Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 97.4 bits (241), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 81/335 (24%), Positives = 152/335 (45%), Gaps = 62/335 (18%)

Query: 11  SGTVLTVGSHKARIIKYLTSGGFAHIYSAEI---SPPDPNSSSIA---CLKRVLVPDKPS 64
           S T + V   + +I + L  GG + +Y  ++   S    NS++ A    LK+++ P   +
Sbjct: 19  SDTTIRVNDRRYKIQRLLGEGGMSFVYLVQLLKGSLSMENSAATAELYALKKIICPSVEN 78

Query: 65  LNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRL 124
           +++   E++  K  ++  +V+  IDS   +    +GS  +++++ Y + G L D +N RL
Sbjct: 79  ISNGMREIENYKRFQS-PYVIQSIDSQVMQE--KDGSKTIYIILPYYSLGSLQDSINRRL 135

Query: 125 --QNRLKEFEVLKIMSQVSQGVAAMHA--------------------------------- 149
                + E E ++IM  V++G+  +H                                  
Sbjct: 136 LEGTFISEAECVRIMLGVTRGLLCLHDPASRQDNVTTRTTVDTISMTYSDETAMLLEDTP 195

Query: 150 LQPPLI-----------HRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQH 198
           L+  ++           HRDI   N+L S DG   + D GS         N  +L+ +Q 
Sbjct: 196 LEMDMLSSSSAGLIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLSELQE 255

Query: 199 DILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEV------- 251
            +  N T  Y +PE+++L     +  K DIW++G   Y L +  +PFE+  ++       
Sbjct: 256 WVNDNCTLPYTAPELLNLKLNQALSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASLTY 315

Query: 252 AILHSKFQFPAYPQYSDQLKNLISALLRENPMQRP 286
           AI   K+ FP   ++S++L ++I   ++ +P+QRP
Sbjct: 316 AINTGKYSFPRNSRFSERLLDVIKRCIQVDPIQRP 350

>Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 97.1 bits (240), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 83/341 (24%), Positives = 148/341 (43%), Gaps = 62/341 (18%)

Query: 11  SGTVLTVGSHKARIIKYLTSGGFAHIYSAE------ISPPDPNSSSIACLKRVLVPDKPS 64
           S T + V   + +I + L  GG + +Y  +      I      +  +  LK+++ P+  S
Sbjct: 19  SDTTIRVNDKRYKIQRLLGEGGLSFVYLVQLLKGSLIMENGVAAPELYALKKIICPNVES 78

Query: 65  LNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRL 124
           +++   E++  K  ++  +V+  IDS   +    +GS  +++++ +   G L D +N RL
Sbjct: 79  ISNGMREIENYKRFQS-PYVIQSIDSQVMQE--KDGSKSIYIILPFYTLGSLQDSINRRL 135

Query: 125 --QNRLKEFEVLKIMSQVSQGVAAMHA--------------------------------- 149
                + E E ++IM  V +G+  +H                                  
Sbjct: 136 LEGTFISEAECVRIMLGVIRGLLCLHDPASRQDNTNSRTTVDTVSMTYSDETAFLLEDTP 195

Query: 150 LQPPLI-----------HRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQH 198
           L+  ++           HRDI   N+L S DG   + D GS         N  +L  +Q 
Sbjct: 196 LEMDMLSSNLGASIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLRELQE 255

Query: 199 DILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEV------- 251
            +  N T  Y +PE++ L     +D K DIW+LG   Y L +  +PFE+  ++       
Sbjct: 256 WVNDNCTLPYTAPELLGLKLNQTLDCKVDIWSLGCTFYTLMFGISPFEREEQIHGASITY 315

Query: 252 AILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLL 292
           AI   K+ FP   ++S+ L ++I   ++ +P+QRP   QLL
Sbjct: 316 AINTGKYSFPRNSRFSEGLLSVIKKCIQVDPVQRPTTSQLL 356

>KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 346

 Score = 96.7 bits (239), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 76/331 (22%), Positives = 147/331 (44%), Gaps = 54/331 (16%)

Query: 15  LTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVP--DKPSLNSLRAEV 72
           ++V  H+  I + L  GGF+ +Y  E        + +  LK++  P     S++    EV
Sbjct: 19  VSVNGHRYHIKRLLGEGGFSFVYLVE-----SRENGLMALKKIRCPFGSIGSISPAMKEV 73

Query: 73  DAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQN--RLKE 130
           D  +  K+  ++   IDS   +    +GS  V++L+ Y ++G L D +N  L +  ++ E
Sbjct: 74  DNYQKFKS-PYIAQIIDSQVVQE--RDGSKTVYILLPYFSKGSLQDEINRHLLDCTQVPE 130

Query: 131 FEVLKIMSQVSQGVAAMHALQPP-----------------------------------LI 155
            EV+++   V++G+  +H   P                                      
Sbjct: 131 LEVVRLALGVARGLLCIHDAAPADESDVTYSIVSAPYAEDSSLLNDLELDTFGESHQAYA 190

Query: 156 HRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMID 215
           H DIK  N++IS +G   + D GS         + Q L   Q    ++ T  + +PE++D
Sbjct: 191 HHDIKPSNIMISSEGMPVISDLGSCSRACVEINSRQALLQFQEWRSEHCTLTFMAPEILD 250

Query: 216 LYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEV-------AILHSKFQFPAYPQYSD 268
           +     + EK D+W+ G  +Y +C+  +PFE+  ++       ++   K+  P+   YS 
Sbjct: 251 VKLNSVITEKCDVWSFGCTIYTMCFGISPFEREEQISGASVTYSLTTGKYSIPSGTNYSS 310

Query: 269 QLKNLISALLRENPMQRPNICQLLAEVSRIQ 299
            L +++   L  +P  RP++ +L++ +  +Q
Sbjct: 311 GLIDVVKKCLNVDPDGRPSVDELISLLMDLQ 341

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score =  100 bits (248), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 83/311 (26%), Positives = 143/311 (45%), Gaps = 83/311 (26%)

Query: 9   YPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNSSSIACLKRVL-VPDKPSLNS 67
           + S  ++ +G++K  I+K +  G F  +Y A        +  +   K VL   +K   N 
Sbjct: 26  FSSNELVDIGNYK--IVKLIGEGSFGKVYLA--------NHRLTHQKVVLKTGNKNDPNV 75

Query: 68  LRA-----EVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNT 122
           +R      + D   + K ++ +V+                +V++ +EYC    L +++  
Sbjct: 76  VREVFYHRQFDFPHITKLYEVIVT--------------ESKVWMALEYCPGKELYEYL-- 119

Query: 123 RLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFG---- 178
            +Q+R+   E  K+ +Q+   V   H+LQ   +HRD+K+EN+L+ + G  K+ DFG    
Sbjct: 120 LMQHRISLEESGKLFAQIVSAVYYAHSLQ--CVHRDLKLENILLDKKGRAKITDFGFTRE 177

Query: 179 --------SVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDL--YRGLPVDEKSDI 228
                   +VCG                      T  Y +PE+I+   Y G  +    DI
Sbjct: 178 CATKTMLETVCG----------------------TTVYMAPELIERKSYDGFKI----DI 211

Query: 229 WALGVFLYKLCYYTTPFEKAGEVAILHSKFQ-FPAYPQYSDQL-----KNLISALLRENP 282
           W+LGV LY + + T PF++  E     +K++     P Y+D +     K+LIS LL ++P
Sbjct: 212 WSLGVILYTMIHGTMPFDEEDETK---TKWKIINEEPFYNDDVVSKDAKDLISQLLCKDP 268

Query: 283 MQRPNICQLLA 293
            QRP + Q+LA
Sbjct: 269 SQRPQLSQVLA 279

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score =  100 bits (248), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 85/309 (27%), Positives = 139/309 (44%), Gaps = 81/309 (26%)

Query: 9   YPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLNSL 68
           + S  +  VG++K  I+K +  G F  +Y A   P    +    CLK     DK   N +
Sbjct: 30  FTSDELTEVGNYK--ILKQVGEGSFGKVYLALHRP----THRKVCLK---TSDKNDPNIV 80

Query: 69  RA-----EVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTR 123
           R      + D   + K ++ +V+                +V++ +EYC    L D + + 
Sbjct: 81  REVFYHRQFDFPYITKLYEVIVT--------------ETKVWMALEYCPGKELYDHLLS- 125

Query: 124 LQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFG----- 178
             +R+   E  ++ +Q+S  V   H++    +HRD+K+EN+L+ ++GN K+ DFG     
Sbjct: 126 -LHRISLLECAELFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFGFTREC 182

Query: 179 -------SVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMID--LYRGLPVDEKSDIW 229
                  +VCG                      T  Y +PE+I+   Y G  +    DIW
Sbjct: 183 MTKTTLETVCG----------------------TTVYMAPELIERRTYDGFKI----DIW 216

Query: 230 ALGVFLYKLCYYTTPFEKAGEVAILHSKFQF-PAYPQYS-----DQLKNLISALLRENPM 283
           +LGV LY L   + PF+   EV    +K++     P Y      D  K+LIS LL +NP 
Sbjct: 217 SLGVILYTLITGSLPFDDDDEV---KTKWKIVNEEPNYDSTLIPDDAKDLISRLLAKNPK 273

Query: 284 QRPNICQLL 292
           +RP++ Q+L
Sbjct: 274 ERPSLPQVL 282

>YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON}
           ENV7Protein proposed to be involved in vacuolar
           functions; mutant shows defect in CPY processing; has
           sequence similarity with the human serine/threonine
           protein kinase STK16
          Length = 364

 Score = 95.1 bits (235), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 80/335 (23%), Positives = 147/335 (43%), Gaps = 62/335 (18%)

Query: 11  SGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPD------PNSSSIACLKRVLVPDKPS 64
           S   + V   + RI + L  GG + +Y  ++S           +  +  LK+++ P   S
Sbjct: 19  SDATIRVNDKRYRIQRLLGEGGMSFVYLVQLSKNSLIIDNGIATPELYALKKIICPSVES 78

Query: 65  LNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRL 124
           +++   E++  K  ++  +V+  IDS   +    +GS  +++++ Y + G L D +N RL
Sbjct: 79  ISNGMREIENYKRFQS-PYVIKSIDSQVMQE--KDGSKTIYIVLPYYSLGSLQDSINRRL 135

Query: 125 --QNRLKEFEVLKIMSQVSQGVAAMHA--------------------------------- 149
                + E E ++IM  V++G+  +H                                  
Sbjct: 136 LEGTFVSEAECVRIMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDETAMLLEDTP 195

Query: 150 LQPPLI-----------HRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQH 198
           L+  ++           HRDI   N+L S DG   + D GS        +N  +L+ +Q 
Sbjct: 196 LEMDMLSSNSAGSIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIENRHQLSELQE 255

Query: 199 DILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEV------- 251
            +  N T  Y  PE+++L     +  K DIW+LG   Y L +  +PFE+  ++       
Sbjct: 256 WVNDNCTLPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQIHGASLTY 315

Query: 252 AILHSKFQFPAYPQYSDQLKNLISALLRENPMQRP 286
           AI   K+ FP   ++S+ L ++I   ++ +P+QRP
Sbjct: 316 AINTGKYSFPRNSRFSEGLLSVIKKCIQVDPIQRP 350

>ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q7LGU7 Saccharomyces cerevisiae YPL236C
           Hypothetical ORF
          Length = 369

 Score = 92.8 bits (229), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 82/338 (24%), Positives = 145/338 (42%), Gaps = 63/338 (18%)

Query: 11  SGTVLTVGSHKARIIKYLTSGGFAHIYSAE----ISPPDPNSSSIACLKRVLVP--DKPS 64
           S + L++   +  I K L    F+ IY  +    ++      +++  LKR+  P  +  S
Sbjct: 22  SESYLSINGRRYSIKKLLGESNFSFIYLVQQIGSVTASSTPRTNLYALKRIRCPFGNIES 81

Query: 65  LNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRL 124
           ++    EVD  K  ++  +++  +DS  A+    +GS  V++L+ Y   G L D  +  L
Sbjct: 82  ISGAMKEVDNYKRFQS-PYIIHLVDSQVAQQ--RDGSKTVYILLPYFPLGSLQDSTSRNL 138

Query: 125 QNR--LKEFEVLKIMSQVSQGVAAMHA--------------------------------- 149
            N   + E E ++I+  +++G+  +H                                  
Sbjct: 139 LNGTFISEAECIRIVIGIARGLRCLHDPSARSQDAEQQQEHDAVSMSYSDEAAFLLEDTP 198

Query: 150 LQPPLI------------HRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQ 197
           L+  ++            HRDIK  N+L S DG   + + GS            +L  +Q
Sbjct: 199 LELDILSSANTINSNFYAHRDIKPSNILFSSDGLPVISNLGSCSKADLSINTGMQLTELQ 258

Query: 198 HDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEV------ 251
             +  + T  Y +PE++ +     VD K DIW+LG   Y + +  +PFE+  ++      
Sbjct: 259 AWVSDHCTVAYTAPELLHITLNRSVDTKVDIWSLGCTCYFMLFGISPFEREEQISGASLK 318

Query: 252 -AILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNI 288
            AI    F FP+  +YS+ L  LI+  L+ NP  RP+I
Sbjct: 319 YAIGTGNFSFPSQDRYSEGLLKLITKCLQVNPAARPDI 356

>KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24
           YDR523C
          Length = 543

 Score = 94.0 bits (232), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 85/332 (25%), Positives = 157/332 (47%), Gaps = 37/332 (11%)

Query: 8   TYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVPD-KPSLN 66
           T P  T+ T+        K +  G F  ++ A     +  +  +  +K + + D +    
Sbjct: 9   TLPPSTLFTID-------KCVGKGNFGDVFKA----MNNVTKEVVAIKIINLDDSEEETF 57

Query: 67  SLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQN 126
            +  E+  M LLK+  ++  YI +        N  Y ++++MEYC  G   D + T  + 
Sbjct: 58  EIIKEMRLMSLLKS-PYIARYITTI-------NEDYLMWIVMEYCGGGSARDLIKTCYRE 109

Query: 127 RLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRP 186
            L E +V  ++  V  G+  +HA     IHRDIK  N+L+++ G  KV DFG V   +R 
Sbjct: 110 GLAENKVAFVVKSVLLGLQYLHAQHK--IHRDIKAANILLTDSGLVKVADFG-VSAEMRS 166

Query: 187 PKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFE 246
               +   +V        T  + +PE++ +  G+  +EKSDIW+LG+  Y+L     P  
Sbjct: 167 TMKAK--TFV-------GTPYWMAPEVV-MNEGMGYNEKSDIWSLGITTYELLKGVPPLA 216

Query: 247 KAGEVAILHS--KFQFPA-YPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQGVPC 303
           K   + ++ +  K + P  +  Y++ +K+ I+  L ++P +RP+  +LL     ++G P 
Sbjct: 217 KYDAIRVMRNIPKRKPPKLHGAYTNLVKHFIATCLIKDPEKRPSASELLEHDFMVKG-PG 275

Query: 304 PVKNFYLERKMLLQQQQQQQQQLQPLRHSVSQ 335
            V+N   E   L   ++ Q    +  R+ +++
Sbjct: 276 NVENLKNEVSYLKFTKETQAVARKKSRYDINE 307

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 94.7 bits (234), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 69/210 (32%), Positives = 106/210 (50%), Gaps = 28/210 (13%)

Query: 90  SHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHA 149
           +H   S LNN   E++++MEYCA G L   +      ++ E  +  IM ++   +A MH 
Sbjct: 79  THYYGSYLNN--TELWVIMEYCAGGSLRTLLR---PGKIGEQYIGVIMRELL--IALMHI 131

Query: 150 LQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQ-- 207
            +  +IHRDIK  NVLI+ DG+ K+CDFG    +             Q  I + T A   
Sbjct: 132 HKDGVIHRDIKAANVLITNDGHIKLCDFGVAAQL------------SQTKIRRQTMAGTP 179

Query: 208 -YRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPF--EKAGEVAILHSKFQFPAYP 264
            + +PE+I    G+  D K DIW+LG+  Y++     P+   +A     L +K + P   
Sbjct: 180 YWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPPRLE 237

Query: 265 --QYSDQLKNLISALLRENPMQRPNICQLL 292
             Q+S  LK  I+  L E+P +RP+  +LL
Sbjct: 238 GRQHSSALKEFIALCLDEDPKERPSAEELL 267

>Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C
           (REAL)
          Length = 364

 Score = 91.7 bits (226), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 79/335 (23%), Positives = 144/335 (42%), Gaps = 62/335 (18%)

Query: 11  SGTVLTVGSHKARIIKYLTSGGFAHIYSAE------ISPPDPNSSSIACLKRVLVPDKPS 64
           S T + V   + +I + L  GG + +Y  +      I      +  +  LK+++ P   S
Sbjct: 19  SDTTIRVNDKRYKIQRLLGEGGMSFVYLVQLLKNSLIMENGIITPEMYALKKIICPSVES 78

Query: 65  LNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRL 124
           +++   E++  K  ++  +V+  IDS   +    NGS  +++++ Y + G L D +N RL
Sbjct: 79  ISNGMREIENYKRFQS-PYVIQSIDSQVTQE--KNGSKIIYIILPYYSLGSLQDSINRRL 135

Query: 125 --QNRLKEFEVLKIMSQVSQGVAAMH---------------------------------- 148
                + E E ++IM  V++G+  +H                                  
Sbjct: 136 LEGTFISEAECVRIMLGVTRGLLCLHDPASRQDNITPRVNVDAVSMTYSDETAMLLEDTP 195

Query: 149 ----------ALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQH 198
                     A      HRDI   N+L S +G   + D GS         +  +L+ +Q 
Sbjct: 196 LEMDVLSSGSAGSIAYAHRDITPSNILYSSEGLPVIADLGSCSQADIRIGSRNQLSELQE 255

Query: 199 DILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEV------- 251
            +  N T  Y +PE+++L     +  K DIW++G   Y L +  +PFE+  ++       
Sbjct: 256 WVNDNCTLPYTAPELLNLKLNQILSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASITY 315

Query: 252 AILHSKFQFPAYPQYSDQLKNLISALLRENPMQRP 286
           AI   K+ FP   ++S+ L N+I   ++ +P+QRP
Sbjct: 316 AINTGKYSFPRNSRFSEALLNVIKKCIQVDPIQRP 350

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score = 94.0 bits (232), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 89/347 (25%), Positives = 145/347 (41%), Gaps = 96/347 (27%)

Query: 9   YPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLNSL 68
           + S  +  VG++K  I K +  G F  +Y A   P    +     LK     DK   N +
Sbjct: 31  FSSSELTEVGNYK--IQKQIGEGSFGKVYLATHRP----TKQKVVLK---TGDKSDPNVV 81

Query: 69  RA-----EVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTR 123
           R      + D   + K ++ +V+                +V++ +EYC    L D + ++
Sbjct: 82  REVFYHRQFDYPYITKLYEVIVT--------------ETKVWMALEYCPGKELYDHLLSK 127

Query: 124 LQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFG----- 178
             +RL   E  ++ +Q++  V   H L    +HRD+K+ENVL+ ++GN K+ DFG     
Sbjct: 128 --SRLPTLECAELFAQITGAVHYAHTLN--CVHRDLKLENVLLDKNGNAKLTDFGFTRES 183

Query: 179 -------SVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDL--YRGLPVDEKSDIW 229
                  +VCG                      T  Y +PEMI    Y G  V    DIW
Sbjct: 184 MTKAVLETVCG----------------------TTVYMAPEMIQHKPYDGFKV----DIW 217

Query: 230 ALGVFLYKLCYYTTPFEKAGEVA----------ILHSKFQFPAYPQYSDQLKNLISALLR 279
           +LGV LY L     PF++  ++           ++  +   P       + +NLI  LL 
Sbjct: 218 SLGVILYTLLCGCLPFDEDDDLLTKQKIINDTPVIDERITIP-------EAQNLIEQLLS 270

Query: 280 ENPMQRPNICQLLAEVSRIQGVPCPVKNFYLER--KMLLQQQQQQQQ 324
           ++P +RPN   +L     +     P     LE+  K++L+Q+Q   Q
Sbjct: 271 KDPTERPNTSAIL-----LHPFLQPYGTLILEQTNKIILKQKQGGSQ 312

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score = 93.2 bits (230), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 74/275 (26%), Positives = 132/275 (48%), Gaps = 32/275 (11%)

Query: 27  YLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVS 86
           +L  GGFA  +  +I        +   + ++ +  + +   L +E+   K +K H  +V 
Sbjct: 100 FLGEGGFARCF--QIKDESGKIFAAKTVAKISIKSEKTKRKLLSEIQIHKSMK-HSNIVQ 156

Query: 87  YIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAA 146
           +ID     ++       V++L+E C  G L+D +  R    L E EV    +Q+   +  
Sbjct: 157 FIDCFEDDAN-------VYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIKY 207

Query: 147 MHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTA 206
           +H+ +  +IHRD+K+ N+   +D N KV DFG +  V+    N +E  Y         T 
Sbjct: 208 LHSRR--IIHRDLKLGNIFFDKDYNLKVGDFG-LAAVL---ANDRERKYTVCG-----TP 256

Query: 207 QYRSPE-MIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILH-----SKFQF 260
            Y +PE ++  + G   +   DIW++GV +Y L     PF+ A +V +++      K+ +
Sbjct: 257 NYIAPEVLMGKHSGHSFE--VDIWSIGVMIYALLVGKPPFQ-AKDVNVIYERIKLCKYGY 313

Query: 261 PAYPQYSDQLKNLISALLRENPMQRPNICQLLAEV 295
           P     S + + LI  +L  NP+QRP I  ++ +V
Sbjct: 314 PKDKYVSKEAEILIHDILSLNPLQRPTIIDIIDDV 348

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score = 93.6 bits (231), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 83/297 (27%), Positives = 136/297 (45%), Gaps = 57/297 (19%)

Query: 9   YPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLNSL 68
           + S  +  VG++K  I+K +  G F  +Y A   P    +    CLK     DK   N +
Sbjct: 30  FTSDELTEVGNYK--ILKQIGEGSFGKVYLALHRP----THRKVCLK---TSDKNDPNIV 80

Query: 69  RA-----EVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTR 123
           R      + D   + K ++ +V+                +V++ +EYC    L D + + 
Sbjct: 81  REVFYHRQFDFPYITKLYEVIVT--------------ESKVWMALEYCPGKELYDHLLS- 125

Query: 124 LQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGV 183
             +R+   E  ++ +Q+S  V   H++    +HRD+K+EN+L+ ++GN K+ DF    G 
Sbjct: 126 -LHRISLLECGELFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDF----GF 178

Query: 184 IRPPKNPQELNYVQHDILKNTTAQYRSPEMID--LYRGLPVDEKSDIWALGVFLYKLCYY 241
            R       L  V        T  Y +PE+I    Y G  +    D W+LGV LY L   
Sbjct: 179 TRECMTKTTLETV------CGTTVYMAPELIGRKTYDGFKI----DTWSLGVILYTLITG 228

Query: 242 TTPFEKAGEVAILHSKFQF-PAYPQYS-----DQLKNLISALLRENPMQRPNICQLL 292
           + PF+   E     +K++     P+Y      D  K+LIS LL +NP +RP++ Q+L
Sbjct: 229 SLPFDDDDEA---KTKWKIVNEEPKYDPKLIPDDAKDLISRLLAKNPGERPSLPQVL 282

>KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7.86
            YAL017W
          Length = 1440

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 83/177 (46%), Gaps = 22/177 (12%)

Query: 115  GLIDFMN-TRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFK 173
            G ID  +   L+N + E EV  I  Q+  G+  +H     +IHRDIK ENV++   G  K
Sbjct: 1272 GCIDLFDLIELKNNMTEMEVKLIFKQIVSGIKHLH--DQAIIHRDIKDENVIVDATGFVK 1329

Query: 174  VCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMI--DLYRGLPVDEKSDIWAL 231
            + DFGS   V   P           D+   T   Y +PE++  D Y G P     DIWA+
Sbjct: 1330 LIDFGSAAHVKSGP----------FDVFVGTI-DYAAPEVLSGDPYEGKP----QDIWAI 1374

Query: 232  GVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNI 288
            G+ LY + +   PF    E  IL  +  F      S + K LIS +L  N  +RP I
Sbjct: 1375 GILLYTIVFKENPFYNIDE--ILEGELTFSESSDVSAECKALISMILNRNVQKRPTI 1429

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 80/298 (26%), Positives = 136/298 (45%), Gaps = 75/298 (25%)

Query: 17  VGSHKARIIKYLTSGGFAHIYSAEISPPDPNSSSIACLKRVLV--PDKPSLNSLRA---- 70
           VG++K  I+K +  G F  +Y A   P           K+V++   DK   N +R     
Sbjct: 36  VGNYK--ILKQIGEGSFGKVYLALHKP---------THKKVVLKSSDKTDPNVVREIFYH 84

Query: 71  -EVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLK 129
            + D   + K ++ +++                +V++++EYC    L D++ ++   R+ 
Sbjct: 85  RQFDFPYITKLYEVIIT--------------ETKVWMVIEYCPNKELYDYLLSK--KRIS 128

Query: 130 EFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKN 189
             E  +I +Q+   V   H+L    +HRD+K+EN+L+ +D N K+ DFG           
Sbjct: 129 LDESARIFAQIVGAVYYAHSLS--CVHRDLKLENILLDKDNNAKLTDFG----------- 175

Query: 190 PQELNYVQHDILKNT-------TAQYRSPEMI--DLYRGLPVDEKSDIWALGVFLYKLCY 240
                    D  KNT       T  Y +PE++  + Y G  +    DIWALG+ LY +  
Sbjct: 176 ------FTRDFSKNTQLETICGTTVYMAPELLRREKYDGYKI----DIWALGILLYTIIN 225

Query: 241 YTTPFE----KAGEVAILHSKFQFPAYPQ--YSDQLKNLISALLRENPMQRPNICQLL 292
            T PF+    K  E+ I+ +    P Y    ++D   +L++ LL ++P  RP I Q+L
Sbjct: 226 GTMPFDEDDPKKTELKIISAS---PDYDNKYFNDDSIDLVNRLLSKDPSMRPTIEQIL 280

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 74/275 (26%), Positives = 136/275 (49%), Gaps = 30/275 (10%)

Query: 26  KYLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVV 85
           ++L  GGFA  +  +I        +   + ++ +  + +   L +E+   K + +H  +V
Sbjct: 85  QFLGEGGFARCF--QIKDDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSM-SHTNIV 141

Query: 86  SYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVA 145
            +ID    + ++N     V++L+E C  G L++ +  R    + E EV   M+Q+  G+ 
Sbjct: 142 QFID--CFEDNVN-----VYILLEICPNGSLMELIKKR--KTITEPEVRFFMTQICGGIQ 192

Query: 146 AMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTT 205
            MH+ +  +IHRD+K+ N+   E  N K+ DFG +  V+    N +E  +         T
Sbjct: 193 YMHSNR--VIHRDLKLGNIFFDEHYNLKIGDFG-LAAVL---ANDRERKFTI-----CGT 241

Query: 206 AQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSK-----FQF 260
             Y +PE++ + +      + DIW++GV LY L     PF+ A +V  ++ +     F +
Sbjct: 242 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQ-AKDVNTIYERIKQRNFAY 299

Query: 261 PAYPQYSDQLKNLISALLRENPMQRPNICQLLAEV 295
           P   + S   K LI  +L  NPM+RP+I +++  V
Sbjct: 300 PKDKKISQDAKYLIDDILSLNPMERPSIQEIMDYV 334

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 76/253 (30%), Positives = 121/253 (47%), Gaps = 39/253 (15%)

Query: 100 GSY----EVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLI 155
           GSY    +++++MEYCA G L   +      ++ E  +  IM ++    A MH  +  +I
Sbjct: 83  GSYLNDTKLWVIMEYCAGGSLRTLLR---PGKIGEQYIGVIMRELL--TALMHIHKDGVI 137

Query: 156 HRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQ---YRSPE 212
           HRDIK  NVLI+ DG+ K+CDFG    +             Q  I + T A    + +PE
Sbjct: 138 HRDIKAANVLITNDGHIKLCDFGVAAQL------------SQTKIRRQTMAGTPYWMAPE 185

Query: 213 MIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPF--EKAGEVAILHSKFQFPAYP--QYSD 268
           +I    G+  D K DIW+LG+  Y++     P+   +A     L +K + P     Q+S 
Sbjct: 186 VI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLEGRQHSS 243

Query: 269 QLKNLISALLRENPMQRPNICQLLAE--VSRIQGVPCPVKNFYLERKMLLQQQQQQQQQL 326
            LK +I+  L E+P +RP+   LL    +   + VP  +    + R +L + ++ Q    
Sbjct: 244 ALKEIIALCLDEDPKERPSAEDLLKTKFIKLHKNVPVSILKELISRYLLHRDKRSQ---- 299

Query: 327 QPLRHSVSQPQME 339
              R SVS   +E
Sbjct: 300 ---RESVSSSALE 309

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 86/297 (28%), Positives = 135/297 (45%), Gaps = 57/297 (19%)

Query: 9   YPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLNSL 68
           + S  +  VG++K  I+K +  G F  +Y A   P    +    CLK     DK   N +
Sbjct: 30  FTSDELTEVGNYK--ILKQIGEGSFGKVYLALHRP----THRKVCLK---TSDKNDPNIV 80

Query: 69  RA-----EVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTR 123
           R      + D   + K ++ +V+                +V++ +EYC    L D  +  
Sbjct: 81  REVFYHRQFDFPYITKLYEVIVT--------------ESKVWMALEYCPGKELYD--HLL 124

Query: 124 LQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGV 183
              RL   E  ++ +Q+S  V   H++    +HRD+K+EN+L+  +GN K+ DF    G 
Sbjct: 125 SLRRLSLLECGELFAQISGAVYYAHSMH--CVHRDLKLENILLDRNGNAKLTDF----GF 178

Query: 184 IRPPKNPQELNYVQHDILKNTTAQYRSPEMID--LYRGLPVDEKSDIWALGVFLYKLCYY 241
            R       L  V        T  Y +PE+I+   Y G  +    DIW+LGV LY L   
Sbjct: 179 TRECMTKTTLETV------CGTTVYMAPELIERKTYDGFKI----DIWSLGVILYTLITG 228

Query: 242 TTPFEKAGEVAILHSKFQF-PAYPQYS-----DQLKNLISALLRENPMQRPNICQLL 292
             PF+   EV    +K++     P+Y      D  K+LIS LL +NP +RP++ Q+L
Sbjct: 229 YLPFDDDDEV---KTKWKIVNEEPKYDSKFIPDDAKDLISRLLAKNPGERPSLPQVL 282

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 83/297 (27%), Positives = 135/297 (45%), Gaps = 57/297 (19%)

Query: 9   YPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLNSL 68
           + S  +  VG++K  I+K +  G F  +Y A   P    +    CLK     DK   N +
Sbjct: 30  FTSDELTEVGNYK--ILKQIGEGSFGKVYLALHRP----THRKVCLK---TSDKNDPNIV 80

Query: 69  RA-----EVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTR 123
           R      + D   + K ++ +V+                +V++ +EYC    L D  +  
Sbjct: 81  REVFYHRQFDFPYITKLYEVIVT--------------ESKVWMALEYCPGKELYD--HLL 124

Query: 124 LQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGV 183
              R+   E  ++ +Q+S  V   H++    +HRD+K+EN+L+ ++GN K+ DF    G 
Sbjct: 125 SLRRISLLECGELFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDF----GF 178

Query: 184 IRPPKNPQELNYVQHDILKNTTAQYRSPEMID--LYRGLPVDEKSDIWALGVFLYKLCYY 241
            R       L  V        T  Y +PE+I+   Y G  +    DIW+LGV LY L   
Sbjct: 179 TRECMTKTTLETV------CGTTVYMAPELIERRTYDGFKI----DIWSLGVILYTLITG 228

Query: 242 TTPFEKAGEVAILHSKFQF-PAYPQYS-----DQLKNLISALLRENPMQRPNICQLL 292
             PF+   E     +K++     P+Y      D  ++LIS LL +NP +RP++ Q+L
Sbjct: 229 YLPFDDDDEA---KTKWKIVNEEPKYDAKVIPDDARDLISRLLAKNPGERPSLSQVL 282

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 74/274 (27%), Positives = 133/274 (48%), Gaps = 30/274 (10%)

Query: 27  YLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVS 86
           +L  GGFA  +  +I        +   + ++ +  + +   L +E+   K +K H+ VV 
Sbjct: 87  FLGEGGFARCF--QIKDDSGKIFAAKTVAKLSIKSEKTRKKLLSEIQIHKSMK-HQNVVQ 143

Query: 87  YIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAA 146
           +ID     ++       V++L+E C  G L+D +  R    L E EV    +Q+   +  
Sbjct: 144 FIDCFEDDTN-------VYILLEICPNGSLMDLLKKR--KLLTEPEVRFFTTQICGAIKY 194

Query: 147 MHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTA 206
           MH+ +  +IHRD+K+ N+    + N K+ DFG +  V+    N +E  Y         T 
Sbjct: 195 MHSRR--VIHRDLKLGNIFFDRNYNLKIGDFG-LAAVL---ANDRERKYTV-----CGTP 243

Query: 207 QYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSK-----FQFP 261
            Y +PE++ + +      + DIW++GV LY L     PF+ + +V  ++ +     F FP
Sbjct: 244 NYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQ-SKDVNTIYERIKCCDFSFP 301

Query: 262 AYPQYSDQLKNLISALLRENPMQRPNICQLLAEV 295
                S++ K LI  LL  +P++RP+I +++  V
Sbjct: 302 KEKHISNEAKVLIQDLLSLDPLERPSISEIMDYV 335

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score = 91.3 bits (225), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 73/274 (26%), Positives = 136/274 (49%), Gaps = 30/274 (10%)

Query: 27  YLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVS 86
           +L  GGFA  +  +I        +   + ++ +  + +   L +E+   K +K H  +V 
Sbjct: 97  FLGEGGFARCF--QIKDESGKIFAAKTVAKISIKTEKTKKKLLSEIQIHKSMK-HPNIVH 153

Query: 87  YIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAA 146
           ++D     ++       V++L+E C+ G L+D M  R    L E EV    +Q+   V  
Sbjct: 154 FVDCFEDDTN-------VYILLEICSNGSLMDLMKKR--KTLTEPEVRFFTTQICGAVKY 204

Query: 147 MHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTA 206
           MH+ +  +IHRD+K+ N+   +D N KV DFG +  V+    N +E  Y         T 
Sbjct: 205 MHSRR--VIHRDLKLGNIFFDKDYNLKVGDFG-LAAVL---ANNRERKYTV-----CGTP 253

Query: 207 QYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSK-----FQFP 261
            Y +PE++ + +      + DIW++GV +Y L     PF+ A +V +++ +     + +P
Sbjct: 254 NYIAPEVL-MGKHAGHSFEVDIWSIGVMIYALLVGKPPFQ-AKDVNVIYDRIKACQYGYP 311

Query: 262 AYPQYSDQLKNLISALLRENPMQRPNICQLLAEV 295
                S + K LI+ +L  +P++RP+I +++ +V
Sbjct: 312 KDKYVSSEAKTLIADILCVDPVERPSIREIIDDV 345

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 78/275 (28%), Positives = 129/275 (46%), Gaps = 40/275 (14%)

Query: 28  LTSGGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHK----- 82
           L  GGFA  +  +    D    S AC     +  K S+ + R +   +  ++ H+     
Sbjct: 99  LGEGGFARCFHIK----DDVGISFACK----IVSKKSIKTERTKFKLLSEIQIHQNLRYS 150

Query: 83  FVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQ 142
            +V ++D    +  LN     V++L+E C  G L+D +  R    L E EV  + +QV  
Sbjct: 151 HIVKFMD--CFEDELN-----VYILLELCPNGSLMDLLKKR--KILTEAEVKFMTTQVCG 201

Query: 143 GVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILK 202
            +  MH+    +IHRD+K+ NV   ++ N K+ DFG    +     N  E  Y       
Sbjct: 202 AINYMHS--NNIIHRDLKLGNVFFDKNFNIKIGDFGLAATL----SNVSEKKYTMCG--- 252

Query: 203 NTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSK----- 257
             T  Y +PE+I L + +    ++DIW+LG+ +Y +     PF+ A +V  ++ K     
Sbjct: 253 --TPNYIAPEVI-LSKQIGHSFEADIWSLGIMIYAMVLGKPPFQ-AKDVTTIYEKIKLCQ 308

Query: 258 FQFPAYPQYSDQLKNLISALLRENPMQRPNICQLL 292
           ++FP     ++ +K LI  LL  +P QRP I  +L
Sbjct: 309 YEFPPDKYITNDVKVLIQDLLVLDPSQRPRIMDIL 343

>ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakly
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1262

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 60/179 (33%), Positives = 86/179 (48%), Gaps = 20/179 (11%)

Query: 115  GLIDFMN-TRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFK 173
            G ID  +   L+  + E+E   I  QV   +  +H+    ++HRDIK ENV++   G  K
Sbjct: 1094 GCIDLFDLIELKTNMTEYEAKLIFRQVVSAIRHLHS--QGIVHRDIKDENVVVDSKGFVK 1151

Query: 174  VCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEK-SDIWALG 232
            + DFGS   V   P           D+   T   Y +PE++    G P D K  DIWA+G
Sbjct: 1152 LIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVL---SGEPFDGKPQDIWAIG 1197

Query: 233  VFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQL 291
            V LY + +   PF    E  IL    +F      S++  NLI  +L +NP QRP I ++
Sbjct: 1198 VLLYTIVFKENPFYNIDE--ILEVNLKFHGTKGVSEECINLIKMILNKNPSQRPTIDEV 1254

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score = 90.5 bits (223), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 101/196 (51%), Gaps = 25/196 (12%)

Query: 104 VFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIEN 163
           V++++EYC+   L + +    + RL   E  K+ SQ++  V   H L+   +HRD+K+EN
Sbjct: 103 VWMVLEYCSGHELYEHLLK--EQRLSLEESKKLFSQIASAVYYAHELK--CVHRDLKLEN 158

Query: 164 VLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMID--LYRGLP 221
           VL+  +G+ K+ DF    G  R      +L  +        T  Y +PE+I+   Y G  
Sbjct: 159 VLLDGNGHAKLTDF----GFTREMATRSQLETIC------GTTVYMAPELIERKCYDGFK 208

Query: 222 VDEKSDIWALGVFLYKLCYYTTPFEKAGEV----AILHSKFQFPAYPQYSDQLKNLISAL 277
           V    DIW+LG+ LY +     PF++  ++     I++ +  F      SD   +LI  +
Sbjct: 209 V----DIWSLGIILYTMINGYMPFDEDDDIKTKLKIVNDELDFNQ-EWISDDAIDLIQGM 263

Query: 278 LRENPMQRPNICQLLA 293
           LR+NP +R ++ Q+L+
Sbjct: 264 LRKNPNERISLAQVLS 279

>TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_7.86
            YAL017W
          Length = 1262

 Score = 90.9 bits (224), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 86/183 (46%), Gaps = 22/183 (12%)

Query: 112  ARGGLIDFMN-TRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDG 170
             + G ID  +    +  + EFE   I  Q+  G++ +H  +  ++HRDIK ENV++   G
Sbjct: 1091 GKTGCIDLFDLIEFKTNMTEFEAKLIFKQIISGISHLH--ESGIVHRDIKDENVIVDAKG 1148

Query: 171  NFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMI--DLYRGLPVDEKSDI 228
              K+ DFGS   V   P           D+   T   Y SPE++  + Y G P     DI
Sbjct: 1149 FVKLIDFGSAAYVKNGP----------FDVFVGTI-DYASPEVLRGEKYEGKP----QDI 1193

Query: 229  WALGVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNI 288
            WALG+ LY + +   PF    E  IL    +FP     S    +LI  +L  + ++RP+I
Sbjct: 1194 WALGILLYTIVFKENPFYNIDE--ILEGDMKFPETENISANCIDLIKLILNRSALERPSI 1251

Query: 289  CQL 291
              +
Sbjct: 1252 TDI 1254

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 69/238 (28%), Positives = 118/238 (49%), Gaps = 39/238 (16%)

Query: 104 VFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIEN 163
           V++ +EYC    L D++   L+ R+   E  ++ +Q+   V   H+LQ   +HRD+K+EN
Sbjct: 103 VWMALEYCPGNELYDYL--LLKQRIPLDETRRLFAQIVSAVFYAHSLQ--CVHRDLKLEN 158

Query: 164 VLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMI--DLYRGLP 221
           +L+ ++G   + DF    G  R      +L  V        T  Y +PE+I  + Y G  
Sbjct: 159 ILLDKNGYAMLTDF----GFTRECATKTQLETV------CGTTVYMAPELIKREAYDGYK 208

Query: 222 VDEKSDIWALGVFLYKLCYYTTPFEKAGEV----AILHSKFQFPA-YPQYSD-QLKNLIS 275
           V    D W+LG+ LY + +   PF++   V     I+H +   PA   +Y+  Q K+LI 
Sbjct: 209 V----DTWSLGIILYTMLHGYMPFDEDDTVRTGLKIMHEE---PAVLDEYTSPQAKDLIV 261

Query: 276 ALLRENPMQRPNICQLLAE-------VSRIQGVPCPVKNFYLERKMLLQQQQQQQQQL 326
            LL +N  QRPN+ ++L            ++ V C +K    +R+  L+ Q + +++L
Sbjct: 262 RLLDKNAAQRPNLNEVLQHPFLQPYGALLLETVECLIKR---QRRASLKFQSKTEKRL 316

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 102/209 (48%), Gaps = 53/209 (25%)

Query: 104 VFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIEN 163
           V++ +EYC    L +++  +    L+E    ++ SQ+   V   H+++   +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYLLAKKHIPLEE--CSELFSQIVGAVYYAHSMK--CVHRDLKLEN 158

Query: 164 VLISEDGNFKVCDFG------------SVCGVIRPPKNPQELNYVQHDILKNTTAQYRSP 211
           +L+ + G+ K+ DFG            ++CG                      T  Y +P
Sbjct: 159 ILLDKKGHAKLTDFGFTRECATKGILETICG----------------------TTVYMAP 196

Query: 212 EMIDL--YRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSKFQFPAY-PQYSD 268
           E+I+   Y G  +    D W+LG+ LY + + T PF++  EV    +K++   Y P Y +
Sbjct: 197 ELIERKPYEGYKI----DTWSLGIILYTMIHGTMPFDEVDEVK---TKYKIVHYNPTYDN 249

Query: 269 QL-----KNLISALLRENPMQRPNICQLL 292
                  K LIS LL ++P QRP++ Q+L
Sbjct: 250 DYIDSNGKELISQLLEKDPNQRPSLTQVL 278

>Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095W
            (BCK1) - MEKK serine/threonine kinase [contig 48] FULL
          Length = 1446

 Score = 90.5 bits (223), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 66/237 (27%), Positives = 113/237 (47%), Gaps = 30/237 (12%)

Query: 65   LNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRL 124
            L +LR+EV  +K L  H  +V Y+          N +Y   L +EY A G +   +  RL
Sbjct: 1193 LEALRSEVATLKDLD-HTNIVQYL-------GFENKNYVYSLFLEYVAGGSVGSLI--RL 1242

Query: 125  QNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVI 184
              +  E  +  +  QV +G++ +H+ +  ++HRD+K +N+L+  DG  K+ DF    G+ 
Sbjct: 1243 YGKFDENLIRFLAVQVLRGLSYLHSKK--ILHRDMKADNLLLDVDGICKISDF----GIS 1296

Query: 185  RPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTP 244
            +   N     Y   D+    T  + +PEM+D  +G     K DIW+LG  + ++     P
Sbjct: 1297 KKSNNI----YSNSDMTMRGTVFWMAPEMVDTKQGYSA--KVDIWSLGCVVLEMFAGKRP 1350

Query: 245  FEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRE--------NPMQRPNICQLLA 293
            +     VA +    +F + P   +  + +ISA  +E        NP +RP   +LL+
Sbjct: 1351 WSNLEVVAAMFKIGKFKSAPPIPEDTQKIISAEGKEFLDACFEINPEKRPTADELLS 1407

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 77/276 (27%), Positives = 131/276 (47%), Gaps = 34/276 (12%)

Query: 27  YLTSGGFAHIYSAEISPPDPNSSSIAC--LKRVLVPDKPSLNSLRAEVDAMKLLKAHKFV 84
           +L  GGFA  +  +    D      A   + ++ +  + +   L +E+   K +K H  +
Sbjct: 95  FLGEGGFARCFQMK----DDKGKVFAAKTVAKLSIKSEKTRRKLLSEIQIHKSMK-HPNI 149

Query: 85  VSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGV 144
           V + D     ++       V++L+E C  G +++ +  R    L E EV   M Q+   +
Sbjct: 150 VQFTDCFEDDTN-------VYILLEICPNGSVMELLRQR--KHLTEPEVRFCMIQIIGAI 200

Query: 145 AAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNT 204
             MH+ +  +IHRD+K+ N+   ++ N K+ DFG +  V+    N +E  Y         
Sbjct: 201 RYMHSRR--VIHRDLKLGNIFFDKEYNLKIGDFG-LAAVL---ANDKERKYTI-----CG 249

Query: 205 TAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSK-----FQ 259
           T  Y +PE++   +      + DIW++GV LY L +   PF+ A EV  ++ +     F 
Sbjct: 250 TPNYIAPEVLT-GKHTGHSYEVDIWSIGVMLYALLFGKPPFQ-AKEVETIYERIKCRDFI 307

Query: 260 FPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEV 295
           FPA    S   KNLIS LL+ NP  RP++ ++   V
Sbjct: 308 FPADKPVSSDAKNLISHLLQLNPAARPSLYEITDNV 343

>ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]
           {ON} similar to uniprot|P08458 Saccharomyces cerevisiae
           YDR523C SPS1 dispensable for mitosis involved in
           middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 471

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 77/270 (28%), Positives = 132/270 (48%), Gaps = 37/270 (13%)

Query: 31  GGFAHIYSAEISPPDPNSSSIACLKRV-LVPDKPSLNSLRAEVDAMKLLKAHKFVVSYID 89
           G F  +Y A     D     +  +K V L   +  ++ L  E+  +  L++  F+ +YI 
Sbjct: 24  GNFGDVYKA----CDKVEGKVVAVKVVNLEHSEEDIDLLAQEIFFLAELRS-PFITNYIT 78

Query: 90  SHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHA 149
           +     S+       +++MEYC  G   D +     N + E +V  I SQV +G+  +H 
Sbjct: 79  TLTEDVSM-------WIVMEYCGGGSCADLIKHIYINGMPEKKVAFITSQVLRGLVYLH- 130

Query: 150 LQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYR 209
            +   IHRDIK  N+L++++G  K+ DFG V G IR     +   +V        T  + 
Sbjct: 131 -EQKKIHRDIKAANILLTDEGTVKLGDFG-VSGQIRA--TLKRGTFV-------GTPYWM 179

Query: 210 SPEMI----DLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHS--KFQFPA- 262
           +PE++    D Y     DEK+DIW+LG+ +Y+L     P  K   + ++ +  K + PA 
Sbjct: 180 APEVVSKENDGY-----DEKADIWSLGITVYELLKGAPPLSKCDPMKVMINLPKRKPPAL 234

Query: 263 YPQYSDQLKNLISALLRENPMQRPNICQLL 292
           +  YS   KN +S+ L +NP+ R +  +++
Sbjct: 235 HGHYSHSAKNFVSSCLVKNPVGRASAYEMV 264

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 70/274 (25%), Positives = 135/274 (49%), Gaps = 30/274 (10%)

Query: 27  YLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVS 86
           +L  GGFA  +  +I        +   + ++ +  + +   L +E+   K ++ H  VV 
Sbjct: 96  FLGEGGFARCF--QIKDESGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMR-HFNVVQ 152

Query: 87  YIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAA 146
           +ID     ++       V++L+E C  G L++ +  R    + E EV   M+Q+   +  
Sbjct: 153 FIDCFEDDTN-------VYILLEICPNGSLMELLKKR--RTVTEPEVRYFMTQICGAIKY 203

Query: 147 MHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTA 206
           MH+ +  +IHRD+K+ N+   ++ N K+ DFG +  V+    N +E  Y         T 
Sbjct: 204 MHSRR--VIHRDLKLGNIFFDKNYNLKIGDFG-LAAVL---ANDRERKYTV-----CGTP 252

Query: 207 QYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSK-----FQFP 261
            Y +PE++ + +      + DIW++GV +Y L     PF+ + +V +++ +     F FP
Sbjct: 253 NYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQ-SKDVNMIYERIKNRDFAFP 310

Query: 262 AYPQYSDQLKNLISALLRENPMQRPNICQLLAEV 295
                S++ K LI  +L  +P++RP+I +++  V
Sbjct: 311 KDKYISNEAKTLIHDILSTDPLERPSIEEIIDYV 344

>Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W
           (REAL)
          Length = 1017

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 71/234 (30%), Positives = 112/234 (47%), Gaps = 40/234 (17%)

Query: 71  EVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKE 130
           E+  MKLL +H  V+   D     ++L       +L++EY  +G L + +  R    L E
Sbjct: 77  EIVIMKLL-SHPNVLGLYDVWETNNNL-------YLILEYAEKGELFNLLVDR--GALPE 126

Query: 131 FEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNP 190
            E +K   Q+   V+  HAL   ++HRD+K EN+L+  D N KV DFG            
Sbjct: 127 REAMKCFRQIIIAVSYCHAL--GIVHRDLKPENLLLDSDYNIKVADFGMAA--------- 175

Query: 191 QELNYVQHD--ILKNTTA--QYRSPEMIDLYRGLPVDE-KSDIWALGVFLYKLCYYTTPF 245
                +Q D  +L+ +     Y +PE++    GLP +   SD+W+ GV L+ L     PF
Sbjct: 176 -----LQTDAALLETSCGSPHYAAPEIVS---GLPYEGFSSDVWSCGVILFALLTGRLPF 227

Query: 246 -EKAGEVAIL-----HSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLA 293
            E+ G +  L       +F+ P   + S   ++LIS +L  +P QR  I  +L+
Sbjct: 228 DEENGNIRTLLLKVQRGQFEMPDDTEISKDAQDLISKILVVDPAQRIKIRDILS 281

>Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON}
           (48405..49868) [1464 nt, 488 aa]
          Length = 487

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 76/270 (28%), Positives = 130/270 (48%), Gaps = 35/270 (12%)

Query: 31  GGFAHIYSAEISPPDPNSSSIACLKRV-LVPDKPSLNSLRAEVDAMKLLKAHKFVVSYID 89
           G F  +Y A     D  + +I  +K V L   +  ++ L  E+  +  L++  ++ +YI 
Sbjct: 24  GNFGDVYKAF----DKTNGAIVAVKVVNLEHTEEDIDLLAQEIFFLAELRS-PYITNYIT 78

Query: 90  SHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHA 149
           +     S+       +++MEYC  G   D + T   N L E +V  I  +V +G+  +H 
Sbjct: 79  TMIEDVSM-------WIVMEYCGGGACSDLIKTVYINGLPENKVGFITREVLKGLKYLHD 131

Query: 150 LQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYR 209
            +   IHRDIK  N+L++++G  K+ DFG V G IR     +   +V        T  + 
Sbjct: 132 QKK--IHRDIKAANILLTDEGKVKLGDFG-VSGQIRATM--KRGTFV-------GTPYWM 179

Query: 210 SPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSKFQFP------AY 263
           +PE+++       +EK+DIW+LG+ +Y+L     P  K   + ++ S    P       +
Sbjct: 180 APEVVN-KESNGYNEKADIWSLGITVYELLKGLPPLSKCDPMKVMVS---LPRRKPPKLH 235

Query: 264 PQYSDQLKNLISALLRENPMQRPNICQLLA 293
            QYSD  K  ++A L ++P  RP+   LL 
Sbjct: 236 GQYSDVAKGFVAACLVKDPNLRPSAEMLLT 265

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 78/300 (26%), Positives = 138/300 (46%), Gaps = 61/300 (20%)

Query: 9   YPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNSSSIACLKRVLV--PDKPSLN 66
           + S  +  VG++K  I+K +  G F  +Y A   P           ++V++   DK   N
Sbjct: 26  FTSDELSEVGNYK--ILKQIGEGSFGKVYLASHKPTH---------RKVVLKTSDKSDPN 74

Query: 67  SLRA-----EVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMN 121
            +R      + D   + K ++ +V+                +V++ +EYC    L + + 
Sbjct: 75  LVREVFYHRQFDFPYITKLYEVIVT--------------ETKVWMALEYCPGRELYEHL- 119

Query: 122 TRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVC 181
             + +R+   E  K+ +Q+   V   H+L    +HRD+K+EN+L+ ++GN K+ DF    
Sbjct: 120 -LMLHRIPLDECAKLFAQIVSAVHYAHSLN--CVHRDLKLENILLDKNGNAKLTDF---- 172

Query: 182 GVIRPPKNPQELNYVQHDILKNTTAQYRSPEMI--DLYRGLPVDEKSDIWALGVFLYKLC 239
           G  R   +   L  +        T  Y +PE+I    Y G  +    DIW+LGV LY + 
Sbjct: 173 GFTRECVSKSSLETI------CGTTVYMAPELIQRQAYDGFKI----DIWSLGVILYTMI 222

Query: 240 YYTTPFEKAGEVAILHSKFQF-PAYPQYSDQL-----KNLISALLRENPMQRPNICQLLA 293
             T PF++  E     +K++    +P ++D       K+LI  LL + P +RP + Q+L+
Sbjct: 223 NGTMPFDEDDETK---TKWKIVNDFPNFNDNFVSHEAKDLIKRLLAKCPSERPTMEQILS 279

>Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL095W
            (REAL)
          Length = 1481

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 77/279 (27%), Positives = 126/279 (45%), Gaps = 42/279 (15%)

Query: 31   GGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLN--------SLRAEVDAMKLLKAHK 82
            G F  +Y       +  +  +  +K+V VP   S N        +LR+EV  +K L  H 
Sbjct: 1187 GSFGAVYLCL----NVTTGEMMAVKQVEVPKYSSQNEAILGTVEALRSEVSTLKDLD-HL 1241

Query: 83   FVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQ 142
             +V Y+          N  Y +FL  EY A G +   +  R+  R  E  +  + +QV +
Sbjct: 1242 NIVQYLGFEN-----KNNIYSLFL--EYVAGGSVGSLI--RMYGRFDESLIRHLTTQVLK 1292

Query: 143  GVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILK 202
            G+A +H+    ++HRD+K +N+L+ +DG  K+ DF    G+ R  K+     Y   D+  
Sbjct: 1293 GLAYLHS--KGILHRDMKADNLLLDQDGICKISDF----GISRKSKDI----YSNSDMTM 1342

Query: 203  NTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILH----SKF 258
              T  + +PEM+D  +G     K DIW+LG  + ++     P+     VA +     SK 
Sbjct: 1343 RGTVFWMAPEMVDTKQGYSA--KVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKS 1400

Query: 259  QFP----AYPQYSDQLKNLISALLRENPMQRPNICQLLA 293
              P      P  S   ++ + A    NP +RP   +LL+
Sbjct: 1401 APPIPEDTLPLISQVGRSFLDACFEINPEERPTATELLS 1439

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 134/274 (48%), Gaps = 30/274 (10%)

Query: 27  YLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVS 86
           +L  GGFA  +  +I        +   + ++ +  + +   L +E+   K ++ H  +V 
Sbjct: 106 FLGEGGFARCF--QIKDDSGKIFAAKTVAKLSIKTEKTRKKLLSEIQIHKSMR-HANIVQ 162

Query: 87  YIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAA 146
           +ID    +++       V++L+E C  G L++ +  R    L E EV    +Q+  G+  
Sbjct: 163 FIDCFEDETN-------VYILLEICPNGSLMELLKKR--KTLTEPEVRFFTTQICGGIKY 213

Query: 147 MHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTA 206
           MH+ +  +IHRD+K+ N+   ++ N K+ DFG +  V+    N +E  Y         T 
Sbjct: 214 MHSRR--VIHRDLKLGNIFFDKNYNLKIGDFG-LAAVL---ANDRERKYTV-----CGTP 262

Query: 207 QYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSK-----FQFP 261
            Y +PE++ + +      + DIW++GV +Y L     PF+ A +V  ++ +     F FP
Sbjct: 263 NYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQ-AKDVNTIYERIKCCDFVFP 320

Query: 262 AYPQYSDQLKNLISALLRENPMQRPNICQLLAEV 295
                S + + L+  LL  +P++RP+I ++L  V
Sbjct: 321 KEKYISSEARILVQDLLSLDPLERPSIMEVLDYV 354

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 75/275 (27%), Positives = 131/275 (47%), Gaps = 32/275 (11%)

Query: 27  YLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVS 86
           +L  GGFA  +  +I     +  +   + +  +  + +   L +E+   K + AH  +V 
Sbjct: 87  FLGEGGFARCF--QIKDDSGDIFAAKTVAKASIKSEKTRKKLLSEIQIHKSM-AHPNIVQ 143

Query: 87  YIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAA 146
           +ID     S+       V++L+E C  G L++ +  R    L E EV    +Q+   +  
Sbjct: 144 FIDCFEDDSN-------VYILLEICPNGSLMELLKRR--KVLSEPEVRFFTTQICGAIKY 194

Query: 147 MHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTA 206
           MH+ +  +IHRD+K+ N+    + N K+ DFG +  V+    N  E  Y         T 
Sbjct: 195 MHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVL---ANESERKYTI-----CGTP 243

Query: 207 QYRSPE-MIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSK-----FQF 260
            Y +PE ++  + G   +   DIW+LGV LY L     PF+ A +V  ++ +     F F
Sbjct: 244 NYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQ-ARDVNTIYERIKCRDFSF 300

Query: 261 PAYPQYSDQLKNLISALLRENPMQRPNICQLLAEV 295
           P     SD+ K LI  +L  +P++RP++ +++  V
Sbjct: 301 PKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074
           aa] {ON} YHR102W (REAL)
          Length = 1074

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 70/273 (25%), Positives = 122/273 (44%), Gaps = 29/273 (10%)

Query: 61  DKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFM 120
           D   +  ++ E+  +  LK    +  Y  S+   +SL       +++MEYCA G L   +
Sbjct: 59  DSDEVEDVQREIQFLASLKQIHNITRYYGSYLKDTSL-------WIIMEYCAGGSLRSLL 111

Query: 121 NTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSV 180
                 ++ E  +  IM +V   +  +H  +  +IHRDIK  NVLI+ +GN K+CDFG  
Sbjct: 112 R---PGKIDEKYIGVIMREVLVALKCIH--KDNVIHRDIKAANVLITNEGNVKLCDFGVA 166

Query: 181 CGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCY 240
             V +     Q +           T  + +PE+I    G+  D K DIW+LG+  Y++  
Sbjct: 167 AQVNQTSLRRQTM---------AGTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEIAT 215

Query: 241 YTTPFEKAGEV----AILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAE-- 294
              P+ +   +     I+ SK        YS  LK  I+  L E+P +R +   LL    
Sbjct: 216 GNPPYCEVEALRAMQLIIKSKPPRLEGRSYSPSLKEFIALCLDEDPKERLSADDLLKSKF 275

Query: 295 VSRIQGVPCPVKNFYLERKMLLQQQQQQQQQLQ 327
           +   +  P  +    + R +L + + +   +++
Sbjct: 276 IKNHKTTPTSILKELISRYLLFRDKNKSMYRIE 308

>NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24
          Length = 535

 Score = 87.4 bits (215), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 75/283 (26%), Positives = 133/283 (46%), Gaps = 39/283 (13%)

Query: 19  SHKARIIKYLTSGGFAHIYSAEISPPDPNSSSIACLKRV-LVPDKPSLNSLRAEVDAMKL 77
           +H   + + +  G F  +Y A     D  ++ +  +K V L      L  L  E+  +  
Sbjct: 19  AHNYIVKECVGRGNFGDVYRA----IDRTTNKVVAIKVVDLENTNERLEVLAQEIFFLAE 74

Query: 78  LKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIM 137
           LK+  ++++YI +    +S+       +++MEYC  G   D +     N L E +V  I 
Sbjct: 75  LKS-PYIINYITTLLEDASM-------WIVMEYCGGGSCSDLLKYYFNNGLPEKKVAYIT 126

Query: 138 SQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQ 197
            ++ +G+  +H  +   IHRDIK  N+L++E+G+ K+ DFG V G ++       +    
Sbjct: 127 REILKGLQYLH--EQKKIHRDIKAANILLTEEGHVKLGDFG-VSGQLKSTLRRGTI---- 179

Query: 198 HDILKNTTAQYRSPEM----IDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAI 253
                  T  + +PE+    I+ Y     DEK DIW+LG+ +++L     P  K   + +
Sbjct: 180 -----VGTPYWMAPEVASQNIEGY-----DEKIDIWSLGITVFELLKGVPPLVKLDPIRV 229

Query: 254 LHSKFQFPAYPQ----YSDQLKNLISALLRENPMQRPNICQLL 292
           L +     + P+    YSD  K+ ++  L +NP +RP    LL
Sbjct: 230 L-ANLSRKSAPRLQGAYSDAAKSFVALCLIKNPNERPAAVDLL 271

>YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}
            BCK1Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway, which
            controls cell integrity; upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1478

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 78/279 (27%), Positives = 126/279 (45%), Gaps = 42/279 (15%)

Query: 31   GGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLN--------SLRAEVDAMKLLKAHK 82
            G F  +Y       +  +  +  +K+V VP   S N        +LR+EV  +K L  H 
Sbjct: 1184 GSFGAVYLCL----NVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLD-HL 1238

Query: 83   FVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQ 142
             +V Y+          N  Y +FL  EY A G +   +  R+  R  E  +  + +QV +
Sbjct: 1239 NIVQYLGFENK-----NNIYSLFL--EYVAGGSVGSLI--RMYGRFDEPLIKHLTTQVLK 1289

Query: 143  GVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILK 202
            G+A +H+    ++HRD+K +N+L+ +DG  K+ DF    G+ R  K+     Y   D+  
Sbjct: 1290 GLAYLHSKG--ILHRDMKADNLLLDQDGICKISDF----GISRKSKDI----YSNSDMTM 1339

Query: 203  NTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILH----SKF 258
              T  + +PEM+D  +G     K DIW+LG  + ++     P+     VA +     SK 
Sbjct: 1340 RGTVFWMAPEMVDTKQGYSA--KVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKS 1397

Query: 259  QFP----AYPQYSDQLKNLISALLRENPMQRPNICQLLA 293
              P      P  S   +N + A    NP +RP   +LL+
Sbjct: 1398 APPIPEDTLPLISQIGRNFLDACFEINPEKRPTANELLS 1436

>CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]
           {ON} similar to uniprot|P38990 Saccharomyces cerevisiae
           YER129w Serine/threonine-protein kinase
          Length = 1162

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 83/308 (26%), Positives = 136/308 (44%), Gaps = 55/308 (17%)

Query: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNN-GSYEVFLLMEYCARGGLID 118
           P K   + ++ E+  MK    HK VV  I+       L++  S +++L++EYC+RG +  
Sbjct: 188 PGKTENDKIKREIAIMKKCH-HKHVVKLIEV------LDDLKSRKIYLVLEYCSRGEVKW 240

Query: 119 FMNTRLQNRLK-----EFEVLK-IMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNF 172
                L+   K      F+  + I+  V  G+  +H     +IHRDIK  N+L+SE G  
Sbjct: 241 CPPDCLETEAKGPSPLSFQFTREILRGVVLGLEYLH--YQGIIHRDIKPANLLLSETGIV 298

Query: 173 KVCDFGSVCGVIRPPKNPQELNYVQHDILKNT-TAQYRSPEMI--------------DLY 217
           K+ DFG          +  +    + ++ K   T  + +PE+               +L+
Sbjct: 299 KISDFGVSLAASSSNVDGSDETIDELELAKTAGTPAFFAPEICLGEDAFEKYQLDREELF 358

Query: 218 RGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSKFQFPA-YPQYSDQLKN---- 272
           +G  +  K DIWALGV LY L +   PF  + E+ +       P  +P+YSD LKN    
Sbjct: 359 KGSCISFKIDIWALGVTLYCLVFGMLPFVSSFELELFEKIVNDPVKFPKYSDMLKNNQVL 418

Query: 273 -------------LISALLRENPMQRPNICQL------LAEVSRIQGVPCPVKNFYLERK 313
                        L++ LL +NP++R NI ++        +   + G      +  LE K
Sbjct: 419 QMTEEAEYEAAKDLLTRLLEKNPIKRINIEEIKRHPFVCWDFDHLDGESEQELSLKLEEK 478

Query: 314 MLLQQQQQ 321
           M  Q  Q+
Sbjct: 479 MNFQCAQR 486

>KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 1016

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 66/265 (24%), Positives = 122/265 (46%), Gaps = 37/265 (13%)

Query: 68  LRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNR 127
           +R E+  +  LK    +  Y  S+   + L       +++MEYCA G L   +   +   
Sbjct: 59  IRKEIQFLSSLKQTPNITHYYGSYLIDTKL-------WVIMEYCAGGSLRTLLRPGI--- 108

Query: 128 LKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPP 187
           ++E  +  IM ++   + ++H  +  +IHRDIK  N+LI+ +G+ K+CDFG         
Sbjct: 109 IEEKYIGVIMREILVALISIH--RDNVIHRDIKAANILIANNGSVKLCDFGVAA------ 160

Query: 188 KNPQELNYVQHDILKNTTAQ----YRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTT 243
                   +   +LK  T      + +PE+I    G+  D K DIW+LG+  Y++     
Sbjct: 161 -------QLSQSMLKRQTMAGTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNP 211

Query: 244 PFEKAGEVAILH--SKFQFPAYP--QYSDQLKNLISALLRENPMQRPNICQLLAE--VSR 297
           P+     +  +   +K + P     +YS  LK  I+  L E+P +RP   +L     + +
Sbjct: 212 PYCHMEAIRAMQMITKSKPPRLEGREYSQPLKEFIALCLDEDPKERPYAEELFKSKLIKQ 271

Query: 298 IQGVPCPVKNFYLERKMLLQQQQQQ 322
            +G    +    + R +L +++ +Q
Sbjct: 272 EKGTSTVILKELITRYLLFREKNEQ 296

>KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5.406
           YHR102W
          Length = 1008

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 71/284 (25%), Positives = 132/284 (46%), Gaps = 30/284 (10%)

Query: 47  NSSSIACLKRV-LVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVF 105
           N+  +  +K + L  D+  +  ++ E+  +  LK    +  Y  S+   +SL       +
Sbjct: 56  NTKHVYAIKVLNLDSDEDEVEDVQKEIQFLASLKQLPNITRYYGSYLKNTSL-------W 108

Query: 106 LLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVL 165
           ++MEYC  G L   +      ++ E  +  IM ++   +  +H  +  +IHRDIK  NVL
Sbjct: 109 IIMEYCGGGSLRSLLR---PGKIDEKYIGVIMREILIALKYIH--KDNVIHRDIKAANVL 163

Query: 166 ISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEK 225
           I+ DG+ K+CDFG    + +     Q +           T  + +PE+I    G+  D K
Sbjct: 164 INNDGSIKLCDFGVAAQLNQTKSRRQTM---------AGTPYWMAPEVI--MEGVYYDTK 212

Query: 226 SDIWALGVFLYKLCYYTTPF--EKAGEVAILHSKFQFPAYP--QYSDQLKNLISALLREN 281
           +DIW+ G+  Y++     P+   +A     L +K + P      YS  +K  I+  L E+
Sbjct: 213 ADIWSTGITAYEVTTGNPPYCDVEALRAMQLIAKSKPPRLEGRNYSALIKEFIATCLDED 272

Query: 282 PMQRPNICQLL--AEVSRIQGVPCPVKNFYLERKMLLQQQQQQQ 323
           P +RP   +LL  A +   + +P  +    + R +L + + +++
Sbjct: 273 PSERPTADELLKTAFIKTYKPLPTSILKELISRYLLFRDKTKRE 316

>KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.24
           YDR523C
          Length = 507

 Score = 87.0 bits (214), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 76/270 (28%), Positives = 124/270 (45%), Gaps = 36/270 (13%)

Query: 31  GGFAHIYSAEISPPDPNSSSIACLKRV-LVPDKPSLNSLRAEVDAMKLLKAHKFVVSYID 89
           G F  +Y A     D  +     +K + L      ++ L  E+  +  LK+  ++++YI 
Sbjct: 25  GNFGDVYKA----IDNITKKYVAIKVINLEYSDEDIDLLAQEIFFLAELKSD-YIINYIT 79

Query: 90  SHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHA 149
           +     S+       +++M+YC  G   D +     N + E +V  I+  V  G+  +H 
Sbjct: 80  TIMEDVSM-------WIVMDYCGGGSCSDLIKIVYPNGIVEEKVSFIVKNVLLGLQYLHE 132

Query: 150 LQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYR 209
            +   IHRDIK  N+L+++DG  K+ DFG V G I+          ++ D     T  + 
Sbjct: 133 QKK--IHRDIKAANILLTDDGQVKLGDFG-VSGQIKAT--------LKRDTFVG-TPYWM 180

Query: 210 SPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHS-------KFQFPA 262
           +PE+I+       DEK DIW+LG+  Y+L     P  K   V ++ S       K   P 
Sbjct: 181 APEVINKEINNGYDEKVDIWSLGITTYELLKGVPPLSKYDPVKVMTSLVKRKPPKLHGP- 239

Query: 263 YPQYSDQLKNLISALLRENPMQRPNICQLL 292
              Y+D  K+ IS  L ++P  RPN+  LL
Sbjct: 240 ---YNDFTKSFISFCLIKDPKLRPNVQNLL 266

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 90/355 (25%), Positives = 162/355 (45%), Gaps = 74/355 (20%)

Query: 17  VGSHKARIIKYLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLNSLRA-----E 71
           VG++K  I+K +  G F  +Y A   P    +     LK     DK   N +R      +
Sbjct: 34  VGNYK--IMKQIGEGSFGKVYLASHKP----THRKVVLK---TSDKNDPNVVREVFYHRQ 84

Query: 72  VDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEF 131
            D + + + ++ +V+                +V++ +EYC    L + +      R+   
Sbjct: 85  FDYLYITRLYEVIVT--------------ETKVWMALEYCPGKELYEHL--LALKRISLD 128

Query: 132 EVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQ 191
           E  ++ +Q+   +   H+L    +HRD+K+EN+L+ + GN K+ DFG     +       
Sbjct: 129 ECSRLFAQIVGAIYYAHSLN--CVHRDLKLENILLDKKGNAKLTDFGFTRECVSKS---- 182

Query: 192 ELNYVQHDILKNTTAQYRSPEMIDL--YRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAG 249
                Q D +  TT  Y +PE+ +   Y G  +    DIWALGV LY +   + PF++  
Sbjct: 183 -----QLDTICGTTV-YMAPELTERKSYDGFKI----DIWALGVILYTMINGSMPFDEDD 232

Query: 250 EVAILHSKFQF-PAYPQYSDQL-----KNLISALLRENPMQRPNICQLLAE-VSRIQGVP 302
           E     +K++     P+ ++ L     K+LI  LL ++P +RP+I ++L     +  G+P
Sbjct: 233 EAK---TKWKIVNEMPEINEDLVSPDAKDLIEQLLAKDPNERPSIEKILTHPFLQPYGIP 289

Query: 303 CPVK-------------NFY--LERKMLLQQQQQQQQQLQPLRHSVSQPQMEAIT 342
              K             +F+  LERK LL++ +Q     Q ++ SV + + +A++
Sbjct: 290 LMEKTQKILRKQRRGSVHFHSKLERK-LLKRLKQMGFDTQSMKASVQKKKCDALS 343

>Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 aa]
           {ON} YDR507C (REAL)
          Length = 1024

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 70/231 (30%), Positives = 109/231 (47%), Gaps = 42/231 (18%)

Query: 67  SLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQN 126
           ++  E+  MKLL +H  V+S  D     ++L       +L++EY  +G L + +  R   
Sbjct: 65  NIEREIVVMKLL-SHPNVLSLYDVWETNNNL-------YLILEYAEKGELFNLLVDR--G 114

Query: 127 RLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRP 186
            L E E +K   Q+   ++  HAL   ++HRD+K EN+L+  D N K+ DFG        
Sbjct: 115 PLPEKEAVKCFRQIIIAISYCHALG--IVHRDLKPENLLLDNDYNIKIADFGMAA----- 167

Query: 187 PKNPQELNYVQHD--ILKNTTA--QYRSPEMIDL--YRGLPVDEKSDIWALGVFLYKLCY 240
                    +Q D  +L+ +     Y +PE++    YRG      SD+W+ GV L+ L  
Sbjct: 168 ---------LQTDARLLETSCGSPHYAAPEIVSGLPYRGFA----SDVWSCGVILFALLT 214

Query: 241 YTTPF-EKAGEVAIL-----HSKFQFPAYPQYSDQLKNLISALLRENPMQR 285
              PF E  G V  L       +F+ P   + S   +NLIS +L  +P QR
Sbjct: 215 GRLPFDEDNGNVRDLLLKVQRGQFEMPDATEISKDAQNLISRILVVDPTQR 265

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 87.4 bits (215), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 77/278 (27%), Positives = 131/278 (47%), Gaps = 38/278 (13%)

Query: 27  YLTSGGFAHIYSAEISPPDPNSSSIACLKRVL---VPDKPSLNSLRAEVDAMKLLKAHKF 83
           +L  GGFA  +  +      +S  I   K V    +  + +   L +E+   K + AH  
Sbjct: 87  FLGEGGFARCFQIK-----DDSGEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSM-AHPN 140

Query: 84  VVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQG 143
           +V ++D     S+       V++L+E C  G L++ +  R    L E EV    +Q+   
Sbjct: 141 IVQFVDCFEDDSN-------VYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGA 191

Query: 144 VAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKN 203
           +  MH+ +  +IHRD+K+ N+    + N K+ DFG +  V+    N  E  Y        
Sbjct: 192 IKYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVL---ANESERKYTI-----C 240

Query: 204 TTAQYRSPE-MIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSK----- 257
            T  Y +PE ++  + G   +   DIW+LGV LY L     PF+ A +V  ++ +     
Sbjct: 241 GTPNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQ-ARDVNTIYERIKCRD 297

Query: 258 FQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEV 295
           F FP     SD+ K LI  +L  +P++RP++ +++  V
Sbjct: 298 FSFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
           YDR507C
          Length = 1125

 Score = 87.8 bits (216), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 80/289 (27%), Positives = 128/289 (44%), Gaps = 42/289 (14%)

Query: 8   TYPSGTVLTVGS-HKARIIKYLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLN 66
           ++  G  L +GS  K ++    T+G  A I    IS      S++  +     PD     
Sbjct: 17  SWKMGETLGLGSTGKVQLAYNKTTGNQAAIKV--ISKTIFQDSNVTSMVDNTTPDALPY- 73

Query: 67  SLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQN 126
            +  E+  MKLL  H  V+   D     S+L       ++++EY  +G L + +  R   
Sbjct: 74  GIEREIVIMKLLN-HANVLRLYDVWETNSNL-------YMVLEYAEKGELFNLLVER--G 123

Query: 127 RLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRP 186
            L E E ++   Q+  G++  HAL   ++HRD+K EN+L+    N K+ DFG        
Sbjct: 124 PLPENEAIRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDTKYNIKIADFGMAA----- 176

Query: 187 PKNPQELNYVQHDILKNTTA---QYRSPEMIDLYRGLPVDE-KSDIWALGVFLYKLCYYT 242
                       D L  T+     Y +PE++    G+P     SD+W+ GV LY L    
Sbjct: 177 --------LETEDKLLETSCGSPHYAAPEIVS---GIPYHGFASDVWSCGVILYALLTGR 225

Query: 243 TPF-EKAGEV-----AILHSKFQFPAYPQYSDQLKNLISALLRENPMQR 285
            PF E+ G +      +   +F+ P   + S + +NLIS +L  NP +R
Sbjct: 226 LPFDEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAER 274

>TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {ON}
           Anc_1.24 YDR523C
          Length = 482

 Score = 86.3 bits (212), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 75/269 (27%), Positives = 124/269 (46%), Gaps = 35/269 (13%)

Query: 31  GGFAHIYSAEISPPDPNSSSIACLKRV-LVPDKPSLNSLRAEVDAMKLLKAHKFVVSYID 89
           G F  +Y A     D N S +  +K V L      +  L  E+  +  LK+  F+ +YI 
Sbjct: 24  GNFGDVYKA----IDKNESKVVAIKIVNLENTDEDIELLTQEIFFLSELKS-PFITNYIT 78

Query: 90  SHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHA 149
           +     ++       +++MEYC  G   D +       + E +V  I+    +G+  +H 
Sbjct: 79  TLTEDVTM-------WIVMEYCGGGSCADLIKMVYSKGIPESKVSYILRDTVKGLKYLHD 131

Query: 150 LQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYR 209
            +   IHRDIK  N+L+++ G  K+ DFG V G IR     +   +V        T  + 
Sbjct: 132 QKK--IHRDIKAANILLTDCGKVKLGDFG-VSGQIRATM--KRGTFVG-------TPYWM 179

Query: 210 SPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSKFQFPA------Y 263
           +PE+I+  +    +EK+DIW+LG+  Y+L     P  K     ++      P       +
Sbjct: 180 APEVIN-KQCKGYNEKADIWSLGITAYELLKGVPPLSKYDPFKVM---LNIPKRKPPKLH 235

Query: 264 PQYSDQLKNLISALLRENPMQRPNICQLL 292
            QYS++ K  +S  L ++P QRP+I  LL
Sbjct: 236 GQYSEKAKYFVSLCLIKDPKQRPSIEALL 264

>TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1237

 Score = 87.4 bits (215), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 58/184 (31%), Positives = 88/184 (47%), Gaps = 22/184 (11%)

Query: 115  GLIDFMN-TRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFK 173
            G ID  +   L+  + EFE   I  QV  G+  +H  +  ++HRDIK ENV++   G  K
Sbjct: 1069 GSIDLFDLIELKTNMTEFEAKLIFKQVISGIKHLH--EQGIVHRDIKDENVIVDSKGFVK 1126

Query: 174  VCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMI--DLYRGLPVDEKSDIWAL 231
            + DFGS   V   P           D+   T   Y +PE++  + Y G P     DIWA+
Sbjct: 1127 LIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGEPYEGKP----QDIWAV 1171

Query: 232  GVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQL 291
            G+ LY + +   PF    E  I+    +F    + S++  NLI  +L +N  +RP I  +
Sbjct: 1172 GILLYTIVFKENPFYNIDE--IMEGTLKFSIGSEVSEECVNLIKKILNKNAPKRPTIQDI 1229

Query: 292  LAEV 295
              +V
Sbjct: 1230 YDDV 1233

>Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 87.0 bits (214), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 72/267 (26%), Positives = 119/267 (44%), Gaps = 32/267 (11%)

Query: 31  GGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDS 90
           G +  +Y A     + ++  +  +K ++  +   LN + AE+  +K L  H  +V Y   
Sbjct: 34  GSYGVVYKA----INKHTDQVVAIKEIVYENDEELNDIMAEISLLKNLNHHN-IVKY--- 85

Query: 91  HAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHAL 150
                     SYE+++L+EYCA G L   + +R    L E E    ++Q   G+  +H  
Sbjct: 86  ----HGFIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKTYVTQTLLGLKYLHG- 139

Query: 151 QPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRS 210
              +IHRDIK  N+L+S D   K+ DFG     +    N   L           T  + +
Sbjct: 140 -EGVIHRDIKAANILLSADNTVKLADFG-----VSTIVNSSALTLAG-------TLNWMA 186

Query: 211 PEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYP--QYSD 268
           PE++   RG      SDIW+LG  + ++     P+    +  I ++      YP   +S+
Sbjct: 187 PEILG-NRG--ASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSSFSE 243

Query: 269 QLKNLISALLRENPMQRPNICQLLAEV 295
            LK+ +S    +N  +RP   QLL  V
Sbjct: 244 SLKDFLSKCFVKNMYKRPTADQLLKHV 270

>Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W
           (REAL)
          Length = 1073

 Score = 87.0 bits (214), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 69/273 (25%), Positives = 122/273 (44%), Gaps = 29/273 (10%)

Query: 61  DKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFM 120
           D   +  ++ E+  +  LK    +  Y  S+   +SL       +++MEYCA G L   +
Sbjct: 59  DSDEVEDVQREIQFLASLKQISNITRYYGSYLKDTSL-------WIIMEYCAGGSLRSLL 111

Query: 121 NTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSV 180
                 ++ E  +  IM ++   +  +H  +  +IHRDIK  NVLI+ +GN K+CDFG  
Sbjct: 112 R---PGKIDEKYIGVIMRELLVALKCIH--KDNVIHRDIKAANVLITNEGNVKLCDFGVA 166

Query: 181 CGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCY 240
             V +     Q +           T  + +PE+I    G+  D K DIW+LG+  Y++  
Sbjct: 167 AQVNQTSLRRQTM---------AGTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEIAT 215

Query: 241 YTTPFEKAGEV----AILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAE-- 294
              P+     +     I+ SK        YS  LK  I+  L E+P +R +   LL    
Sbjct: 216 GNPPYCDVEALRAMQLIIKSKPPRLEGRSYSPSLKEFIALCLDEDPKERLSADDLLRSKF 275

Query: 295 VSRIQGVPCPVKNFYLERKMLLQQQQQQQQQLQ 327
           +   +  P  +    + R +L + + + + +++
Sbjct: 276 IKAHRATPTSILKELVSRYLLFRDKNKNKYRIE 308

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score = 86.7 bits (213), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 74/277 (26%), Positives = 132/277 (47%), Gaps = 36/277 (12%)

Query: 27  YLTSGGFAHIYSAEISPPDPNSSSIAC--LKRVLVPDKPSLNSLRAEVDAMKLLKAHKFV 84
           +L  GGFA  +  +    D +    A   + ++ +  + +   L +E+   K +K H  +
Sbjct: 78  FLGEGGFARCFQMK----DDSGKVFAAKTVAKISIKSEKTRKKLLSEIQIHKSMK-HPNI 132

Query: 85  VSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGV 144
           V + D     ++       V++L+E C  G L+D +  R Q  L E EV    +Q+   +
Sbjct: 133 VQFTDCFEDDTN-------VYILLEICPNGSLMDLLKQRKQ--LTEPEVRFFTTQIVGAI 183

Query: 145 AAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNT 204
             MH+ +  +IHRD+K+ N+   +  N K+ DFG +  V+    N +E  Y         
Sbjct: 184 KYMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFG-LAAVL---ANDRERKYT-----ICG 232

Query: 205 TAQYRSPEMI-DLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSK-----F 258
           T  Y +PE++   + G   +   DIW++GV +Y L     PF+ A EV  ++ +     F
Sbjct: 233 TPNYIAPEVLTGKHTGHSFE--VDIWSIGVMIYALLIGKPPFQ-AKEVNTIYERIKVCDF 289

Query: 259 QFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEV 295
            FP     S + K LI  +L  +P++RP++ +++  V
Sbjct: 290 SFPKDKPISSEAKVLIKDILSLDPLERPSLAEIMEYV 326

>Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {ON}
           complement(57430..60243) [2814 nt, 938 aa]
          Length = 937

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 73/269 (27%), Positives = 124/269 (46%), Gaps = 34/269 (12%)

Query: 31  GGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDS 90
           G    +Y+A     DP       +K++ +  +P    +  E+  MK  K H+ +V++IDS
Sbjct: 659 GASGGVYTAH----DPTREGYVAIKQMNLEKQPKKELIINEIIVMKESK-HENIVNFIDS 713

Query: 91  HAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHAL 150
           +  K  L       +++MEY   G L D +   L   L E +V  +  +   G+  +H+ 
Sbjct: 714 YLLKGDL-------WVIMEYMEGGSLTDVVTHCL---LTEAQVGAVCRETLSGLQFLHS- 762

Query: 151 QPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRS 210
              +IHRDIK +N+L+S  G+ K+ DFG  C  I       ELN  +  ++   T  + +
Sbjct: 763 -KGVIHRDIKSDNILLSMRGDIKLTDFG-FCAQI------NELNLKRTTMVG--TPYWMA 812

Query: 211 PEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPF--EKAGEVAILHSKFQFPAYPQ--- 265
           PE++      P   K DIW+LG+ + ++     P+  E       L +    P+  +   
Sbjct: 813 PEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPSLKEPEA 869

Query: 266 YSDQLKNLISALLRENPMQRPNICQLLAE 294
            SD L N +   L+ NP +R +   LL +
Sbjct: 870 LSDALNNFLGWCLKVNPDERASAKDLLLD 898

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 88/332 (26%), Positives = 149/332 (44%), Gaps = 60/332 (18%)

Query: 27  YLTSGGFAHIYSAEISPPDPNSSSIACLKRVL---VPDKPSLNSLRAEVDAMKLLKAHKF 83
           +L  GGFA  +  +      +S  I   K V    +  + +   L +E+   K + +H  
Sbjct: 87  FLGEGGFARCFQIK-----DDSGEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSM-SHPN 140

Query: 84  VVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQG 143
           +V +ID     S+       V++L+E C  G L++ +  R    L E EV    +Q+   
Sbjct: 141 IVQFIDCFEDDSN-------VYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGA 191

Query: 144 VAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKN 203
           +  MH+ +  +IHRD+K+ N+    + N K+ DFG +  V+    N  E  Y        
Sbjct: 192 IKYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVL---ANESERKYTI-----C 240

Query: 204 TTAQYRSPE-MIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSK----- 257
            T  Y +PE ++  + G   +   DIW+LGV LY L     PF+ A +V  ++ +     
Sbjct: 241 GTPNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQ-ARDVNTIYERIKCRD 297

Query: 258 FQFPAYPQYSDQLKNLISALLRENPMQRPNICQL------------------LAEVSRIQ 299
           F FP     SD+ K LI  +L  +P++RP++ ++                  ++EV   +
Sbjct: 298 FSFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPATVMSEVPNFE 357

Query: 300 GVPCP--VKNF--YLERKMLLQQQQQQQQQLQ 327
            VP    + NF   +ER +LL+     + Q Q
Sbjct: 358 SVPDEQSLINFKDCMERSLLLESMSSDKSQRQ 389

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 98/208 (47%), Gaps = 49/208 (23%)

Query: 103 EVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIE 162
           +V++ +EYC    L D + +   +R+   E +++ +Q+  GV   H+L    +HRD+K+E
Sbjct: 103 KVWMALEYCPGKELYDRVLS--MHRVPTDECVQLFAQIVGGVHYAHSLN--CVHRDLKLE 158

Query: 163 NVLISEDGNFKVCDFG------------SVCGVIRPPKNPQELNYVQHDILKNTTAQYRS 210
           N+L+ + G+ K+ DFG            ++CG                      T  Y +
Sbjct: 159 NILLDKSGDAKLTDFGFTRECMTKTTLETICG----------------------TTVYMA 196

Query: 211 PEMIDL--YRGLPVDEKSDIWALGVFLYKLCYYTTPF----EKAGEVAILHSKFQFPAYP 264
           PE+I+   Y G  +    DIW+LGV LY +   + PF    E   E  I+H   Q     
Sbjct: 197 PELIERKSYDGFKI----DIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQLNENI 252

Query: 265 QYSDQLKNLISALLRENPMQRPNICQLL 292
             +D  K+LI  LL +NP  RP + Q+L
Sbjct: 253 VTADA-KDLILRLLAKNPNDRPTVEQIL 279

>Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W
           (REAL)
          Length = 1076

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 70/273 (25%), Positives = 122/273 (44%), Gaps = 29/273 (10%)

Query: 61  DKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFM 120
           D   +  ++ E+  +  LK    +  Y  S+   +SL       ++LMEYCA G L   +
Sbjct: 59  DSDEVEDVQREIQFLASLKQMPNITRYYGSYLKDTSL-------WILMEYCAGGSLRSLL 111

Query: 121 NTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSV 180
                 ++ E  +  IM ++   +  +H  +  +IHRDIK  NVLI+ +G+ K+CDFG  
Sbjct: 112 R---PGKIDEKYIGVIMRELLVALKCIH--KDNVIHRDIKAANVLITNEGSVKLCDFGVA 166

Query: 181 CGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCY 240
             V +     Q +           T  + +PE+I    G+  D K DIW+LG+  Y++  
Sbjct: 167 AQVNQTSLRRQTM---------AGTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEIAT 215

Query: 241 YTTPFEKAGEV----AILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAE-- 294
              P+     +     I+ SK        YS  LK  I+  L E+P +R +   LL    
Sbjct: 216 GNPPYCDVEALRAMQLIIKSKPPRLEGRSYSSSLKEFIALCLDEDPKERLSADDLLRSKF 275

Query: 295 VSRIQGVPCPVKNFYLERKMLLQQQQQQQQQLQ 327
           +   +  P  +    + R +L + + + + +L+
Sbjct: 276 IKTHRATPTSILKELISRYLLFRDKNKNKYRLE 308

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 79/299 (26%), Positives = 132/299 (44%), Gaps = 49/299 (16%)

Query: 9   YPSGTVLTVGSHKARIIKYLTSGG----FAHIYSAEISPPDPNSSSIACLKRVLVPDKPS 64
           +  G  L +GS     + Y +S G       I  A  +  + N+S  A    +L PD   
Sbjct: 20  WKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFNNDNANASDSA----LLTPDSLP 75

Query: 65  LNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRL 124
              +  E+  MKLL  H  V+   D     S+L       ++++EY  +G L + +  R 
Sbjct: 76  Y-GIEREIIIMKLLN-HPNVLRLYDVWETDSNL-------YMVLEYAEKGELFNLLVER- 125

Query: 125 QNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVI 184
              L E E ++   Q+  G++  HAL   ++HRD+K EN+L+    N K+ DFG      
Sbjct: 126 -GPLPENEAIRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKYNIKIADFGMAA--- 179

Query: 185 RPPKNPQELNYVQHDILKNTTA---QYRSPEMIDL--YRGLPVDEKSDIWALGVFLYKLC 239
                         D L  T+     Y +PE+I    Y GL    ++D+W+ G+ L+ L 
Sbjct: 180 ----------LETEDKLLETSCGSPHYAAPEIISGLPYHGL----ETDVWSCGIILFALL 225

Query: 240 YYTTPF-EKAGEV-----AILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLL 292
               PF E+ G +      +   +F+ P   + S + ++LIS +L  +P +R    ++L
Sbjct: 226 TGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREIL 284

>Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}
           similar to Ashbya gossypii AFL143C
          Length = 363

 Score = 84.0 bits (206), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 78/352 (22%), Positives = 145/352 (41%), Gaps = 64/352 (18%)

Query: 5   PLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPS 64
           P   +  G  +++      +   L  G    +Y  +  P   +S  +  LK+V  P   +
Sbjct: 14  PCGFWFDGVRISINGKSYLVTTLLREGELTALYQVK-CPKRSHSGGVYALKKVTCPIGRA 72

Query: 65  LNSLRAEVDAMKLLKAHK-FVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTR 123
               RA  +     + +  ++ + +D   A+   +NG+  +++L+ Y   G L D +N  
Sbjct: 73  DFVTRAMTEISNYQRFNSPYITNILDFQVAQH--DNGTKIIYMLLPYFPAGSLQDLINNM 130

Query: 124 L--QNRLKEFEVLKIMSQVSQGVAAMH--------------------------------- 148
           +   + L E  V+++M  + +GV  MH                                 
Sbjct: 131 IIRGDSLSESRVVRLMLDICRGVRCMHEPSESDFRDPYDVAYFDAASLRYSDETHLLVDA 190

Query: 149 ----ALQPPL--------IHRDIKIENVLISEDGNFKVCDFGSVCGVIRPP---KNPQEL 193
                L PPL        +H  +  EN+++S +G   + +  S    +R P    +  +L
Sbjct: 191 MELDLLSPPLTNSEPSAYVHCGLNPENIMLSSEGLPVIYNMASC---VRAPLELTSNSKL 247

Query: 194 NYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVA- 252
             +Q  + +N+   Y  PE++DL+    +  + DIW+LG   Y L Y  + F +  ++  
Sbjct: 248 LGLQEWLNENSCLPYTCPELLDLHPNTSITNRCDIWSLGCICYALMYSISSFAREQQLCG 307

Query: 253 --ILHS----KFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRI 298
             I HS     F FP  P+YS  LK ++   L  +P +RP+I + LA+   +
Sbjct: 308 TPIKHSISTGNFSFPDEPRYSQSLKRIVQRCLVIDPHKRPDIYETLAQFQEL 359

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 87/367 (23%), Positives = 160/367 (43%), Gaps = 100/367 (27%)

Query: 17  VGSHKARIIKYLTSGGFAHIYSAEISPPDPNSSSIACLKRVL-VPDKPSLNSLRA----- 70
           VG++  RI+K +  G F  +Y A        S  +   K VL +  K   N +R      
Sbjct: 34  VGNY--RILKIVGEGSFGKVYLA--------SHRLTHQKVVLKMGSKNDPNVVREVFYHR 83

Query: 71  EVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKE 130
           + D + + K ++ +V+                 V++ +EYC    L +++   ++ R+  
Sbjct: 84  QFDYVYITKLYEVIVT--------------ENSVWMALEYCPGKELYEYL--LIKKRIPL 127

Query: 131 FEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFG------------ 178
            E   + SQ+   V   H+++   +HRD+K+EN+L+ + G  K+ DFG            
Sbjct: 128 DECSHLFSQIVGAVFYAHSMK--CVHRDLKLENILLDKKGQAKLTDFGFTRECATKGILE 185

Query: 179 SVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDL--YRGLPVDEKSDIWALGVFLY 236
           +VCG                      T  Y +PE+I+   Y G  +    D W+LG+ LY
Sbjct: 186 TVCG----------------------TTVYMAPELIERKPYEGYKI----DTWSLGIILY 219

Query: 237 KLCYYTTPFEKAGEVAILHSKFQF-PAYPQYSDQL-----KNLISALLRENPMQRPNICQ 290
            + +   PF++  ++    +K++     P Y D       K+LI  LL+++P QRP++ Q
Sbjct: 220 TMIHGAMPFDEEDDIK---TKYRIVNNEPFYDDNFIDANGKDLIMQLLQKDPSQRPSLTQ 276

Query: 291 LLA----------------EVSRIQGVPCPVKNFYLERKMLLQQQQQQQQQLQPLRHSVS 334
           +L                 +  + Q   C   +  LER+ LL++ +Q     Q ++ SV+
Sbjct: 277 VLQHPFMFPHGSSILEKTDKTIKRQSQGCKHFHSKLERR-LLKKLKQSGFDTQAIKQSVN 335

Query: 335 QPQMEAI 341
           + + +A+
Sbjct: 336 KKKCDAL 342

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 77/278 (27%), Positives = 131/278 (47%), Gaps = 38/278 (13%)

Query: 27  YLTSGGFAHIYSAEISPPDPNSSSIACLKRVL---VPDKPSLNSLRAEVDAMKLLKAHKF 83
           +L  GGFA  +  +      +S  I   K V    +  + +   L +E+   K + +H  
Sbjct: 87  FLGEGGFARCFQIK-----DDSGEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSM-SHPN 140

Query: 84  VVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQG 143
           +V +ID     S+       V++L+E C  G L++ +  R    L E EV    +Q+   
Sbjct: 141 IVQFIDCFEDDSN-------VYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGA 191

Query: 144 VAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKN 203
           +  MH+ +  +IHRD+K+ N+    + N K+ DFG +  V+    N  E  Y        
Sbjct: 192 IKYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVL---ANESERKYTI-----C 240

Query: 204 TTAQYRSPE-MIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSK----- 257
            T  Y +PE ++  + G   +   DIW+LGV LY L     PF+ A +V  ++ +     
Sbjct: 241 GTPNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQ-ARDVNTIYERIKCRD 297

Query: 258 FQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEV 295
           F FP     SD+ K LI  +L  +P++RP++ +++  V
Sbjct: 298 FSFPRDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 76/276 (27%), Positives = 131/276 (47%), Gaps = 34/276 (12%)

Query: 27  YLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFV-- 84
           +L  GGFA  +       + +S  I   K V      S  + R  +  +++ K+ K V  
Sbjct: 88  FLGEGGFARCFQF-----NDDSGKIFAAKTVAKLSIKSEKTRRKLLSEIQIHKSMKNVNI 142

Query: 85  VSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGV 144
           V +ID     ++       V++L+E C  G L+D +  R    L E EV    +Q+   +
Sbjct: 143 VQFIDCFEDDTN-------VYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAI 193

Query: 145 AAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNT 204
             MH+ +  +IHRD+K+ N+   +D N K+ DFG +  V+    N +E  Y         
Sbjct: 194 KYMHSRR--VIHRDLKLGNIFFDKDYNLKIGDFG-LAAVL---ANDRERKYTV-----CG 242

Query: 205 TAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSK-----FQ 259
           T  Y +PE++ + +      + DIW++GV LY L     PF+ + +V  ++ +     F 
Sbjct: 243 TPNYIAPEVL-MGKHTGHSYEVDIWSIGVMLYALLIGKPPFQ-SKDVNTIYERIKCCDFT 300

Query: 260 FPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEV 295
           FP     S + K LI  LL  +P++RP++ +++  V
Sbjct: 301 FPKDKYISPEAKILIQDLLSLDPLERPSVDEIIDYV 336

>TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa]
           {ON} Anc_1.24 YDR523C
          Length = 468

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 75/270 (27%), Positives = 129/270 (47%), Gaps = 37/270 (13%)

Query: 31  GGFAHIYSAEISPPDPNSSSIACLKRV-LVPDKPSLNSLRAEVDAMKLLKAHKFVVSYID 89
           G F  +Y A     +  S  +  +K V L      +N L  E+  +  LK+  ++ +YI 
Sbjct: 26  GNFGDVYKA----CEKVSGKVVAVKVVNLEHTDEDINLLAQEIFFLAELKS-PYITNYIT 80

Query: 90  SHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHA 149
           +     S+       +++MEYC  G   D +       L E +   I  +V +G+  +H 
Sbjct: 81  TMTEDVSM-------WIIMEYCGGGSCADLLRNIYNCGLPESKSAYITREVLKGLEYLHE 133

Query: 150 LQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYR 209
            +   IHRDIK  N+L++++G  K+ DFG V G IR     +   +V        T  + 
Sbjct: 134 QKK--IHRDIKAANILLTDEGKVKLGDFG-VSGQIRA--TLKRGTFV-------GTPFWM 181

Query: 210 SPEMI----DLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHS--KFQFPA- 262
           +PE++    D Y     DEK+DIW+LG+ +Y+L   + P  K   + ++ +  K + P  
Sbjct: 182 APEVVSKDSDGY-----DEKADIWSLGITVYELLKGSPPLYKCDPMKVMVNLPKRKPPVL 236

Query: 263 YPQYSDQLKNLISALLRENPMQRPNICQLL 292
           +  YS   K+ +++ L +NP  RP+  +LL
Sbjct: 237 HGHYSSAAKHFVASCLVKNPKNRPSAVELL 266

>YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Protein
           kinase of the PAK/Ste20 family, required for cell
           integrity; physically interacts with Cdc31p (centrin),
           which is a component of the spindle pole body; part of
           the RAM network that regulates cellular polarity and
           morphogenesis
          Length = 1080

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 68/273 (24%), Positives = 122/273 (44%), Gaps = 29/273 (10%)

Query: 61  DKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFM 120
           D   +  ++ E+  +  LK    +  Y  S+   +SL       +++ME+CA G L   +
Sbjct: 59  DSDEVEDVQREIQFLASLKQISNITRYYGSYLKDTSL-------WIIMEHCAGGSLRSLL 111

Query: 121 NTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSV 180
                 ++ E  +  IM ++   +  +H  +  +IHRDIK  NVLI+ +GN K+CDFG  
Sbjct: 112 R---PGKIDEKYIGVIMRELLVALKCIH--KDNVIHRDIKAANVLITNEGNVKLCDFGVA 166

Query: 181 CGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCY 240
             V +     Q +           T  + +PE+I    G+  D K DIW+LG+  Y++  
Sbjct: 167 AQVNQTSLRRQTM---------AGTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEIAT 215

Query: 241 YTTPFEKAGEV----AILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAE-- 294
              P+     +     I+ SK        YS  LK  I+  L E+P +R +   LL    
Sbjct: 216 GNPPYCDVEALRAMQLIIKSKPPRLEDRSYSTSLKEFIALCLDEDPKERLSADDLLKSKF 275

Query: 295 VSRIQGVPCPVKNFYLERKMLLQQQQQQQQQLQ 327
           +   +  P  +    + R +L + + + + +++
Sbjct: 276 IRAHKATPTSILKELISRYLLFRDKNKNKYKIE 308

>Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL095W
            (REAL)
          Length = 1478

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 78/298 (26%), Positives = 129/298 (43%), Gaps = 42/298 (14%)

Query: 31   GGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLN--------SLRAEVDAMKLLKAHK 82
            G F  +Y       +  +  +  +K+V VP   S N        +LR+EV  +K L  H 
Sbjct: 1184 GSFGAVYLCL----NVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLD-HL 1238

Query: 83   FVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQ 142
             +V Y+          N      L +EY A G +   +  R+  R  E  +  + +QV +
Sbjct: 1239 NIVQYL-------GFENKDNIYSLFLEYVAGGSVGSLI--RMYGRFDEPLIKHLTTQVLK 1289

Query: 143  GVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILK 202
            G+A +H+    ++HRD+K +N+L+ +DG  K+ DF    G+ R  K+     Y   D+  
Sbjct: 1290 GLAYLHS--KGILHRDMKADNLLLDQDGICKISDF----GISRKSKDI----YSNSDMTM 1339

Query: 203  NTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILH----SKF 258
              T  + +PEM+D  +G     K DIW+LG  + ++     P+     VA +     SK 
Sbjct: 1340 RGTVFWMAPEMVDTKQGYSA--KVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKS 1397

Query: 259  QFP----AYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQGVPCPVKNFYLER 312
              P      P  S   +  + A    NP +RP   +LL+    +  V    K+  L +
Sbjct: 1398 APPIPEDTLPLISQVGRGFLDACFEINPEKRPTATELLSHRFSVVNVTFDFKSTELAK 1455

>KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON}
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase
          Length = 1338

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 69/253 (27%), Positives = 115/253 (45%), Gaps = 34/253 (13%)

Query: 31   GGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPS--------LNSLRAEVDAMKLLKAHK 82
            G F  +Y A     +  +  +  +K+V VP+  S        + +L++EV  +K L  H 
Sbjct: 1047 GSFGAVYLAL----NVTTGEMLAVKQVTVPEFSSQDESAISMVEALKSEVSTLKDLN-HV 1101

Query: 83   FVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQ 142
             +V Y+          NG Y +FL  EY A G +   +  R+  R  +  +  +  QV +
Sbjct: 1102 NIVQYLGFEE-----KNGIYSLFL--EYVAGGSVGSLI--RMYGRFDDQLIRHLTKQVLE 1152

Query: 143  GVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILK 202
            G+A +H+    ++HRD+K +N+L+  DG  K+ DF    G+ R   N     Y   D+  
Sbjct: 1153 GLAYLHSKG--ILHRDMKADNLLLDNDGVCKISDF----GISRKSNNI----YSNSDMTM 1202

Query: 203  NTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSKFQFPA 262
              T  + +PEM+D   G     K DIW+LG  + ++     P+     VA +    +   
Sbjct: 1203 RGTVFWMAPEMVDTAHGYSA--KVDIWSLGCVVLEMFAGKRPWSNFEVVAAMFQIGKSKT 1260

Query: 263  YPQYSDQLKNLIS 275
             P   D  K+L+S
Sbjct: 1261 APPIPDDTKDLVS 1273

>CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa] {ON}
            similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095w BCK1
          Length = 1447

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 79/282 (28%), Positives = 127/282 (45%), Gaps = 50/282 (17%)

Query: 31   GGFAHIY-SAEISPPDPNSSSIACLKRVLVPD--------KPSLNSLRAEVDAMKLLKAH 81
            G F  +Y S  I+     +  +  +K+V VP         K  + +L++EV  +K L  H
Sbjct: 1160 GSFGAVYLSLNIT-----TGEMMAVKQVEVPKYGTQNELVKDMVEALKSEVATLKDLD-H 1213

Query: 82   KFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVS 141
              +V Y+ S      +    Y +FL  EY A G +   +  RL  R  E  +  + +QV 
Sbjct: 1214 LNIVQYLGSE-----IRGNIYSLFL--EYVAGGSVGSLI--RLYGRFDEKLIRHLNTQVL 1264

Query: 142  QGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDIL 201
             G+  +H+    ++HRD+K +N+L+ EDG  K+ DF    G+ +  KN     Y   D+ 
Sbjct: 1265 SGLKYLHS--KGILHRDMKADNLLLDEDGICKISDF----GISKKSKNI----YSNSDMT 1314

Query: 202  KNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSKFQF- 260
               T  + +PEM+D  +G     K DIW+LG  + ++     P+     VA +   FQ  
Sbjct: 1315 MRGTVFWMAPEMVDTKQGYSA--KVDIWSLGCVVLEMFAGKRPWSNLEVVAAM---FQIG 1369

Query: 261  -----PAYPQYSDQL-----KNLISALLRENPMQRPNICQLL 292
                 P  P  + QL     K+ +S     +P +RP    LL
Sbjct: 1370 KSKSAPPIPDDTIQLISSKGKDFLSKCFEIDPEKRPTADDLL 1411

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 70/274 (25%), Positives = 133/274 (48%), Gaps = 30/274 (10%)

Query: 27  YLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVS 86
           +L  GGFA  +  +I        +   + ++ +  + +   L +E+   K +K H+ +V 
Sbjct: 150 FLGEGGFARCF--QIRDDSGKLFAAKTVAKLSIKTEKTRKKLLSEIQIHKSMK-HQNIVQ 206

Query: 87  YIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAA 146
           +ID     ++       V++L+E C  G L++ +  R Q  L E EV    +Q+   +  
Sbjct: 207 FIDCFEDDTN-------VYILLEICPNGSLMELLKKRKQ--LTEPEVRFFTTQICGAIKY 257

Query: 147 MHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTA 206
           MH+ +  +IHRD+K+ N+    + N K+ DFG +  V+    N +E  +         T 
Sbjct: 258 MHSRR--VIHRDLKLGNIFFDRNYNLKIGDFG-LAAVL---ANDRERKFTV-----CGTP 306

Query: 207 QYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSK-----FQFP 261
            Y +PE++ + +      + D+W++GV +Y L     PF+ A +V  ++ +     F FP
Sbjct: 307 NYIAPEVL-MGKHSGHSYEVDVWSIGVMVYALLVGKPPFQ-AKDVNTIYERIKCCDFIFP 364

Query: 262 AYPQYSDQLKNLISALLRENPMQRPNICQLLAEV 295
                S + K L+  LL  +P++RP+I +++  V
Sbjct: 365 KEKPISHEAKVLVQDLLSLDPLERPSISEIMDYV 398

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 102/201 (50%), Gaps = 35/201 (17%)

Query: 103 EVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIE 162
           +V++ +EYC    L D++   +  R+   E  ++ +Q+   V   H+L    +HRD+K+E
Sbjct: 102 KVWMSLEYCPGKELYDYL--LVMRRIPLDECSRLFAQIVGAVYYAHSLN--CVHRDLKLE 157

Query: 163 NVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMI--DLYRGL 220
           N+L+   GN K+ DF    G  R      +L  +        T  Y +PE++  D Y G 
Sbjct: 158 NILLDMQGNAKLADF----GFTRECATKNQLETIC------GTTVYMAPELLRRDTYDGF 207

Query: 221 PVDEKSDIWALGVFLYKLCYYTTPFEKAGEV----AILHSKFQFPAYPQYSDQLKN---- 272
            +    DIW+LGV LY L   + PF++  E      I++ +      P Y++++ N    
Sbjct: 208 KI----DIWSLGVILYTLINGSMPFDEEDETRTEWKIINEE------PDYNEKIFNANSI 257

Query: 273 -LISALLRENPMQRPNICQLL 292
            LI +LL ++P +RP++ ++L
Sbjct: 258 ELIKSLLIKDPKKRPSMTEIL 278

>NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa]
           {ON} Anc_1.24
          Length = 489

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 79/272 (29%), Positives = 125/272 (45%), Gaps = 37/272 (13%)

Query: 31  GGFAHIYSAEISPPDPNSSSIACLKRV-LVPDKPSLNSLRAEVDAMKLLKAHKFVVSYID 89
           G F  +Y A     D  +  I  +K V L      +  +  E+  +  LK+  ++ +YI 
Sbjct: 30  GNFGDVYKA----IDKLTGEIVAIKVVNLESSDEDIELIAQEIFFLAELKS-PYITNYIT 84

Query: 90  SHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHA 149
           +     S+       +++MEYC  G   D +       L E +V  I   V +G+  +H 
Sbjct: 85  TMLEDVSM-------WIVMEYCGGGSCSDLIRYHYNEGLHEDKVAFITKNVLRGLQYLHE 137

Query: 150 LQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNT---TA 206
            +   IHRD+K  NVL+++DG  K+ DFG V G +R                +NT   T 
Sbjct: 138 QRK--IHRDVKAANVLLTDDGLVKLADFG-VSGQLRSTAK------------RNTFVGTP 182

Query: 207 QYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEK--AGEVA--ILHSKFQFPA 262
            + +PE+I        +EK+DIW+LG+ +Y+L     P+ K  AG+V   I     Q   
Sbjct: 183 YWMAPEIIS-NSSHGYNEKADIWSLGITVYELLKGCPPYAKYDAGKVMRNIPKKNLQ-DC 240

Query: 263 YPQYSDQLKNLISALLRENPMQRPNICQLLAE 294
              +SD  K  ISA L ++P +RP   +LL +
Sbjct: 241 MVSFSDAAKLFISACLIKDPDERPTATELLQQ 272

>KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON} 
          Length = 649

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 64/259 (24%), Positives = 117/259 (45%), Gaps = 35/259 (13%)

Query: 55  KRVLVPDKPSLNSLRAEVDAMKLL--KAHKFVVSYIDS-HAAKSSLNNGSYEVFLLMEYC 111
           K+V  P+K +   +  E++  K++    H  +V+  D+    K S       ++++++YC
Sbjct: 70  KKVHCPNKENKRKIIKELEIYKVICRSHHNHIVALRDAFQWGKESC------IYMILDYC 123

Query: 112 ARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGN 171
           +   L   +  R    L E E  ++M Q+  G+  +H     +IH D+K+ N+L  E   
Sbjct: 124 SNNSLQSILQYR--GSLNEVECKELMIQLCGGIYWLHL--NNVIHGDLKLSNILFDEGQQ 179

Query: 172 FKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPE---MIDLYRGLPVDEKSDI 228
            K+CDFGS       P+ P E+    + +   T   +++     M  L    P+    DI
Sbjct: 180 LKICDFGSSFIATSSPRGPGEIMGTPYYLAPETVYTHKNINKSGMAILLISFPI----DI 235

Query: 229 WALGVFLYKLCYYTTPFEKAGEVAILHS-------------KFQFPAYPQYSDQLKNLIS 275
           W++G+ LY L Y   PF K+  V  LH+               +FP         + LI 
Sbjct: 236 WSMGIVLYSLLYGINPFIKS--VDELHNVSLDELMQRITSGVIEFPTNKAVGAGAQQLIL 293

Query: 276 ALLRENPMQRPNICQLLAE 294
            +L +NP++R  + +++ +
Sbjct: 294 KMLSQNPLERITLVEIVCD 312

>Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}
            complement(18696..23039) [4344 nt, 1448 aa]
          Length = 1447

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 111/238 (46%), Gaps = 30/238 (12%)

Query: 64   SLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTR 123
            ++++LR EV  +K L  H  +V Y+   A      NG Y +FL  EY A G +   +  R
Sbjct: 1186 TVDALRLEVSTLKDLD-HLNIVQYLGFEAK-----NGIYSLFL--EYVAGGSVGSLI--R 1235

Query: 124  LQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGV 183
            +  R  +  +  +  QV QG++ +H+    ++HRD+K +N+L+ +DG  K+ DF    G+
Sbjct: 1236 MYGRFDDILIRHLTIQVLQGLSYLHSRG--ILHRDMKADNLLLDQDGVCKISDF----GI 1289

Query: 184  IRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTT 243
             R   +     Y   ++    T  + +PEM+D  +G     K DIW+LG  + ++     
Sbjct: 1290 SRKSNDI----YSNSEMTMKGTVFWMAPEMVDTKQGYSA--KVDIWSLGCIVLEMFAGKR 1343

Query: 244  PFEKAGEVAILHSKFQFPA--------YPQYSDQLKNLISALLRENPMQRPNICQLLA 293
            P+     VA +    Q  +         P  S+  K  +      +P +RP   +LL+
Sbjct: 1344 PWSNFEVVAAMFKIGQAKSAPPIPEDTLPLISENAKEFLDCCFEIDPEKRPTADKLLS 1401

>TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1347

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 59/217 (27%), Positives = 107/217 (49%), Gaps = 18/217 (8%)

Query: 104 VFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIEN 163
           ++ L+EY + G L+  +  +      E   +   +Q+   +  +H++   +IHRDIK EN
Sbjct: 334 LYFLLEYASNGDLLTLL--KKYGSFDETSTIYFTAQIIDSIHYIHSMG--IIHRDIKPEN 389

Query: 164 VLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNT-----TAQYRSPEMI-DLY 217
           +L+++D   K+ DFG+   ++ P +  Q  +    ++L+ +     TA+Y SPE++ D Y
Sbjct: 390 ILLTKDFKIKLTDFGT-AKILDPSQPSQSQSQPHFNLLERSKSFVGTAEYVSPELLTDSY 448

Query: 218 RGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHS--KFQFPAYPQYSDQLKNLIS 275
                D + DIWA G  L++L     PF+   E        K Q+     +   L++LI 
Sbjct: 449 ----TDSRCDIWAFGCILFQLIAGKPPFKATNEYLTFQKIIKLQYAFTAGFPTILRDLIK 504

Query: 276 ALLRENPMQRPNICQLLAEV-SRIQGVPCPVKNFYLE 311
            +L +NP  R  I Q+ + +  R +    P   +YL+
Sbjct: 505 KILIKNPNNRLTIHQIKSHLFYRSKDFSNPWNIWYLD 541

>TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.406
           YHR102W
          Length = 975

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 69/250 (27%), Positives = 118/250 (47%), Gaps = 35/250 (14%)

Query: 58  LVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLI 117
           L  D   +  ++ E+  +  LK    +  Y  S+   +SL       +++MEYCA G + 
Sbjct: 75  LESDLDEVADIQREIQFLVSLKQVPNITRYYASYLKDTSL-------WIIMEYCAGGSVR 127

Query: 118 DFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPP-LIHRDIKIENVLISEDGNFKVCD 176
             +      ++ E  +  IM ++   + A+H +    +IHRDIK  N+LI+ +GN K+CD
Sbjct: 128 TLLR---PGKIDEKYIAVIMREL---LVALHYIHKDNVIHRDIKAANLLITNEGNVKLCD 181

Query: 177 FGSVCGVIRPPKNPQELNYVQHDILKNTTA---QYRSPEMIDLYRGLPVDEKSDIWALGV 233
           FG             +LN  Q+ + + T A    + +PE+I    G+  D K+DIW++G+
Sbjct: 182 FGVAA----------QLN--QNTMRRQTMAGTPYWMAPEVI--MEGISYDTKADIWSVGI 227

Query: 234 FLYKLCYYTTPFEKAGEV----AILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNIC 289
             Y++     PF +   +     I  SK        +   LK  I+  L E+P +RP   
Sbjct: 228 TAYEIATGNPPFCEMEALRAMQVISKSKPARLEGKNHDPLLKEFIAMCLDEDPQERPTAD 287

Query: 290 QLLAEVSRIQ 299
           +LL E + I+
Sbjct: 288 KLLHESAFIK 297

>NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {ON}
           Anc_8.279
          Length = 1049

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 108/234 (46%), Gaps = 44/234 (18%)

Query: 101 SYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIK 160
           S   ++L EY + G L+D++       LKE        Q+   +  +H+    ++HRD+K
Sbjct: 172 SNHFYMLFEYVSGGQLLDYIIQ--HGSLKESRARTFTRQICSALKYLHSHN--IVHRDLK 227

Query: 161 IENVLISEDGNFKVCDFG------------SVCGVIRPPKNPQELNYVQHDILKNTTAQY 208
           IEN++IS+DGN K+ DFG            + CG          L +   ++LK T   Y
Sbjct: 228 IENIMISKDGNIKLIDFGLSNLYDKCNKLKTYCG---------SLYFAAPELLKATP--Y 276

Query: 209 RSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSKFQFPA--YPQY 266
             PE+             D+W+ GV LY L     PF+      +LH K +     YPQ+
Sbjct: 277 IGPEI-------------DVWSFGVVLYVLVCGKVPFDDENS-NVLHEKIKQGKVFYPQF 322

Query: 267 -SDQLKNLISALLRENPMQRPNICQLLAEVSRIQGVPCPVKNFYLERKMLLQQQ 319
            S ++ +L+S +L  +P +R  + Q++     ++    P K++  +R  L  +Q
Sbjct: 323 LSIEVISLLSKMLVVDPFKRATLDQVMNHHWMVRDCDGPPKSYIPDRPPLTIEQ 376

>NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141
          Length = 905

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 87/333 (26%), Positives = 147/333 (44%), Gaps = 78/333 (23%)

Query: 13  TVLTVGSHKARIIKYLTSGGFAHIYSAE-ISPPDP-------NSSSI---ACLKRVLVP- 60
           T + VGS +  + K +  G FA ++ A  I+P  P       +SSSI    C    +VP 
Sbjct: 29  TTIYVGSDRYIVDKEIGKGSFATVHRAHLITPTSPHLHQSVVDSSSINNPTCFAIKIVPR 88

Query: 61  ----DKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGL 116
               +K  L +L  E+  +K + +H  +V  ID           S + +L+MEYC+ G L
Sbjct: 89  SKLKNKKLLENLEIEIAILKKI-SHPHIVKLID-------FERTSKDFYLIMEYCSLGDL 140

Query: 117 IDFMNTRLQ----------------------NRLKEFEVLKIMSQVSQGVAAMHALQPPL 154
              +  R Q                      N L +  +L  + Q+S  +  + +    L
Sbjct: 141 TFLIKKRQQLIKNHPLLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFLRS--KNL 198

Query: 155 IHRDIKIENVLIS-------EDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQ 207
           +HRDIK +N+L+S       +  +F   D G V     P     +  + +   L NT+  
Sbjct: 199 VHRDIKPQNLLLSAPLINYNDPKSFH--DLGFVGIYNLPILKIADFGFAR--FLPNTSMA 254

Query: 208 --------YRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSKFQ 259
                   Y +PE+++  +    + K+D+W++G  LY++CY   PF+ +  +  L+ K +
Sbjct: 255 ETLCGSPLYMAPEILNYQK---YNAKADLWSVGTVLYEMCYGNPPFKASNHLE-LYKKIK 310

Query: 260 -------FPAYPQYSDQLKNLISALLRENPMQR 285
                  FP Y +  + LK+LIS LL  +P +R
Sbjct: 311 KANDLIYFPTYIEIDNNLKSLISKLLTFDPQER 343

>YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}
           CDC15Protein kinase of the Mitotic Exit Network that is
           localized to the spindle pole bodies at late anaphase;
           promotes mitotic exit by directly switching on the
           kinase activity of Dbf2p; required for spindle
           disassembly after meiosis II
          Length = 974

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 73/267 (27%), Positives = 119/267 (44%), Gaps = 32/267 (11%)

Query: 31  GGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDS 90
           G +  +Y A     + ++  +  +K V+  +   LN + AE+  +K L  H  +V Y   
Sbjct: 34  GSYGVVYKA----INKHTDQVVAIKEVVYENDEELNDIMAEISLLKNLN-HNNIVKY--- 85

Query: 91  HAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHAL 150
                     SYE+++L+EYCA G L   + +R    L E E    ++Q   G+  +H  
Sbjct: 86  ----HGFIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKTYVTQTLLGLKYLHG- 139

Query: 151 QPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRS 210
              +IHRDIK  N+L+S D   K+ DFG     +    N   L           T  + +
Sbjct: 140 -EGVIHRDIKAANILLSADNTVKLADFG-----VSTIVNSSALTLAG-------TLNWMA 186

Query: 211 PEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYP--QYSD 268
           PE++   RG      SDIW+LG  + ++     P+    +  I ++      YP   +S+
Sbjct: 187 PEILG-NRG--ASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSSFSE 243

Query: 269 QLKNLISALLRENPMQRPNICQLLAEV 295
            LK+ +S    +N  +RP   QLL  V
Sbjct: 244 PLKDFLSKCFVKNMYKRPTADQLLKHV 270

>YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}
           SPS1Putative protein serine/threonine kinase expressed
           at the end of meiosis and localized to the prospore
           membrane, required for correct localization of enzymes
           involved in spore wall synthesis
          Length = 490

 Score = 84.0 bits (206), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 77/275 (28%), Positives = 127/275 (46%), Gaps = 45/275 (16%)

Query: 31  GGFAHIYSAEISPPDPNSSSIACLKRV-LVPDKPSLNSLRAEVDAMKLLKAHKFVVSYID 89
           G F  +Y A     D  +  I  +K V L      +  L  E+  +  LK+   + +YI 
Sbjct: 27  GNFGDVYKA----VDRVTQEIVAIKVVNLEHSDEDIELLAQEIFFLAELKS-PLITNYIA 81

Query: 90  SHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHA 149
           +     S+       +++MEYC  G   D +     N L E +V  I+ +V+ G+  +H 
Sbjct: 82  TMLEDVSM-------WIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHE 134

Query: 150 LQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYR 209
            +   IHRDIK  N+L++E+G  K+ DFG V G IR        + ++ D     T  + 
Sbjct: 135 QRK--IHRDIKAANILLNEEGMVKLGDFG-VSGHIR--------STLKRDTFVG-TPYWM 182

Query: 210 SPEM----IDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHS-------KF 258
           +PE+    +D Y     +EK+DIW+LG+  Y+L     P  K   + ++ +       K 
Sbjct: 183 APEVVCCEVDGY-----NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKL 237

Query: 259 QFPAYPQYSDQLKNLISALLRENPMQRPNICQLLA 293
           Q P    +SD  K+ ++  L + P  RP+   LL+
Sbjct: 238 QGP----FSDAAKDFVAGCLVKTPADRPSAYNLLS 268

>Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}
           (4910..5845,5849..7711) [2799 nt, 933 aa]
          Length = 932

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 59/179 (32%), Positives = 91/179 (50%), Gaps = 23/179 (12%)

Query: 116 LIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVC 175
           L DF+  +  +++ E E   I  Q+  G+  +H L   +IHRDIK EN++I  +G  +V 
Sbjct: 766 LFDFIEKK--DKIDEVEQKLIFKQIVAGIKHIHGL--GIIHRDIKTENIIIDSEGCVQVI 821

Query: 176 DFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEK-SDIWALGVF 234
           DFGS       P        V H      T  Y SPE++   +G P + K  D+WALG+ 
Sbjct: 822 DFGSAAYATNGPFQ------VFH-----GTIDYASPEVL---KGEPYEGKPQDVWALGIL 867

Query: 235 LYKLCYYTTPFEKAGEVAILHSKFQF-PAYPQ-YSDQLKNLISALLRENPMQRPNICQL 291
           LY + +  TPF    E  I+ ++ +  PA+ +  SDQ + LI  +L +    RP I ++
Sbjct: 868 LYIITFKQTPFNSVAE--IIENELEIDPAHSENVSDQCRVLIHKMLDKKAWARPKISEI 924

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 72/277 (25%), Positives = 132/277 (47%), Gaps = 36/277 (12%)

Query: 27  YLTSGGFAHIYSAEISPPDPNSSSIAC--LKRVLVPDKPSLNSLRAEVDAMKLLKAHKFV 84
           +L  GGFA  +  +    D +    A   + ++ +  + +   L +E+   K ++ H  +
Sbjct: 78  FLGEGGFARCFQMK----DDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMR-HPNI 132

Query: 85  VSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGV 144
           V + D     ++       V++L+E C  G L+D +  R Q  L E EV    +Q+   +
Sbjct: 133 VQFTDCFEDDTN-------VYILLEICPNGSLMDLLKQRKQ--LTEPEVRFFTTQIVGAI 183

Query: 145 AAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNT 204
             MH+ +  +IHRD+K+ N+   +  N K+ DFG +  V+    N +E  Y         
Sbjct: 184 KYMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFG-LAAVL---ANDRERKYT-----ICG 232

Query: 205 TAQYRSPEMI-DLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSK-----F 258
           T  Y +PE++   + G   +   D+W++GV +Y L     PF+ A EV  ++ +     F
Sbjct: 233 TPNYIAPEVLTGKHTGHSFE--VDVWSIGVMIYALLIGKPPFQ-AKEVNTIYERIKVCDF 289

Query: 259 QFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEV 295
            FP     S + K LI  +L  +P++RP++ +++  V
Sbjct: 290 NFPRDKPISSEAKVLIKDILSLDPLERPSLTEIMEYV 326

>ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR102W
           (KIC1)
          Length = 947

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 66/241 (27%), Positives = 114/241 (47%), Gaps = 28/241 (11%)

Query: 100 GSY----EVFLLMEYCARGGLIDFMN-TRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPL 154
           GSY    +++++MEYCA G L   +   ++  +     V K++      +A ++  +  +
Sbjct: 89  GSYLYDTKLWVIMEYCAGGSLRTLLRPGKIDEKYLGVIVRKLL------IALVYIHKDNV 142

Query: 155 IHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMI 214
           IHRDIK  NVLI+ +G+ K+CDFG    +       Q +           T  + +PE+I
Sbjct: 143 IHRDIKAANVLITNEGHVKLCDFGVAAQLTAANHKRQTM---------AGTPYWMAPEVI 193

Query: 215 DLYRGLPVDEKSDIWALGVFLYKLCYYTTPF--EKAGEVAILHSKFQFPAYP--QYSDQL 270
               G+  + K+DIW+LG+  Y++     P+   +A     L +K + P      YS  L
Sbjct: 194 --MEGVYYNTKADIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPPRLEGRNYSPLL 251

Query: 271 KNLISALLRENPMQRPNICQLLAE--VSRIQGVPCPVKNFYLERKMLLQQQQQQQQQLQP 328
           K  I+  L E+P +RP    LL+   V   +G    +    + R +L  ++  ++  L P
Sbjct: 252 KEFIALCLDEDPEERPTAEDLLSSKFVKAHKGSSATILKELISRYLLFSEKHNRESVLIP 311

Query: 329 L 329
           L
Sbjct: 312 L 312

>TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1137

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 109/235 (46%), Gaps = 38/235 (16%)

Query: 68  LRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNR 127
           +  E+  MKLL  H  V+   D     ++L       ++++EY  +G L + +  +    
Sbjct: 90  IEREIIIMKLLN-HTNVLRLYDVWETNNNL-------YMVLEYAEKGELFNLLVEK--GP 139

Query: 128 LKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPP 187
           L E E ++   Q+  G++  HAL   ++HRD+K EN+L+    N K+ DFG         
Sbjct: 140 LAENEAVRFFRQIIIGMSYCHAL--GIVHRDLKPENILLDHKSNIKIADFGMAA------ 191

Query: 188 KNPQELNYVQHDILKNTTA---QYRSPEMIDLYRGLPVDE-KSDIWALGVFLYKLCYYTT 243
                      D L  T+     Y +PE++    GLP +  ++DIW+ GV L+ L     
Sbjct: 192 -------LETEDKLLETSCGSPHYAAPEIVS---GLPYNGLETDIWSCGVILFALLTGRL 241

Query: 244 PF-EKAGEV-----AILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLL 292
           PF E+ G +      +   +F+ P   + S + ++LI  +L  NP QR    ++L
Sbjct: 242 PFDEEDGNIRNLLLKVQKGEFEMPGSDELSLEAQDLIGKILTVNPKQRIKTREIL 296

>KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly
           similar to uniprot|Q03306 Saccharomyces cerevisiae
           YDR466W
          Length = 653

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 58/194 (29%), Positives = 95/194 (48%), Gaps = 20/194 (10%)

Query: 104 VFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIEN 163
           ++ ++E+ + G L+  +  R   RL E    +I SQ+   V  MHA    +IHRD+K EN
Sbjct: 87  LYYVLEFVSGGELLGLV--RRMGRLPEEWCRRIASQLVDTVDYMHAKG--VIHRDLKPEN 142

Query: 164 VLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVD 223
           VL+S++G   + DFG+ C        P   +     +    TA+Y SPE++   +     
Sbjct: 143 VLLSQEGRIVITDFGAACCASEGGSAPGAADRAASFV---GTAEYVSPELLLHSQ---CS 196

Query: 224 EKSDIWALGVFLYKLCYYTTPFEKAGE------VAILHSKFQFPAYPQYSDQLKNLISAL 277
             SD+WALG  +Y+L     PF    E      +  L  ++ + A P     +  L+ ++
Sbjct: 197 FGSDVWALGCIIYQLTQGAPPFRGDTELQSFEKIVALDYRWVYAAPP----LIVALVQSI 252

Query: 278 LRENPMQRPNICQL 291
           L  +P+QRP+  QL
Sbjct: 253 LVLDPLQRPSAKQL 266

>NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141
          Length = 349

 Score = 82.4 bits (202), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 65/186 (34%), Positives = 93/186 (50%), Gaps = 23/186 (12%)

Query: 104 VFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIEN 163
           V+LLMEY   G L   +  R      +    + + Q++  +  +H  Q  +IHRD+K EN
Sbjct: 164 VYLLMEYLVYGELYKLL--RSHGPFNDVIASRFVFQIADALNYLHDKQ--IIHRDLKPEN 219

Query: 164 VLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVD 223
           +LI  +   K+ DFG    +I P         V+   L  T   Y SPEMI   R    D
Sbjct: 220 ILIGFNNVIKLTDFG--WSIINPRG-------VKRKTLCGTI-DYLSPEMI---RSREYD 266

Query: 224 EKSDIWALGVFLYKLCYYTTPFEK-AGEVA---ILHSKFQFPAYPQYSDQLKNLISALLR 279
           +K D+WALGV  Y+L   + PFE+   E+    IL +  +FP     S  +K+LIS LL+
Sbjct: 267 DKVDVWALGVLTYELIVGSPPFEEDTKELTYKRILKNDIKFPE--TVSHDVKDLISKLLK 324

Query: 280 ENPMQR 285
            NP +R
Sbjct: 325 YNPSER 330

>Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C
           (SPS1) - serine/threonine kinase homologous to Ste20p;
           expressed in middle/late meiosis [contig 123] FULL
          Length = 505

 Score = 83.6 bits (205), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 75/292 (25%), Positives = 137/292 (46%), Gaps = 36/292 (12%)

Query: 9   YPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNSSSIACLKRV-LVPDKPSLNS 67
           +P  T +   S    I + +  G F  +Y A     D  +  +  +K + L   +  ++ 
Sbjct: 23  HPPDTAVEKPSQLYDIKECVGKGSFGDVYRA----IDKETGEMVAVKIINLEETQDDIDV 78

Query: 68  LRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNR 127
           L  E+  +  L+A  FV +Y  ++    S+       +++ME+C  G   D +    ++R
Sbjct: 79  LAQEIYFLSELRA-PFVTTYYKTYVEDVSM-------WIVMEFCGGGSCADLLKHLPEHR 130

Query: 128 LKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPP 187
           L E +V  I+ +V  G+  +H+ +   IHRD+K  N+L++++G  K+ DFG V G I   
Sbjct: 131 LPENKVAYIIREVLYGLEYLHSQRK--IHRDVKAANILLTDEGEVKLGDFG-VSGQIMAT 187

Query: 188 KNPQELNYVQHDILKNT---TAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTP 244
                       + +NT   T  + +PE+I    G   DEK+DIW+LG+   +L     P
Sbjct: 188 ------------LKRNTFVGTPYWMAPEIIARDNGY--DEKADIWSLGITAMELLTGQPP 233

Query: 245 FEKAGEVAILHS-KFQFPAYPQ--YSDQLKNLISALLRENPMQRPNICQLLA 293
           + K   + +L +   + P   Q  ++   ++ I+  L ++P  RP    LL+
Sbjct: 234 YAKYDPMKVLMNIPLRKPPRLQGRFTSSARDFIALCLTKDPALRPTASDLLS 285

>KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7.86
            YAL017W
          Length = 1055

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 59/191 (30%), Positives = 92/191 (48%), Gaps = 22/191 (11%)

Query: 105  FLLMEYCARGGLIDFMN-TRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIEN 163
            ++ +E     G ID  +   L+  + EFE   I  Q+  G+  +H     ++HRDIK EN
Sbjct: 877  YIELESHGETGSIDLFDLIELKTNMTEFEAKLIFKQIVSGIKYLH--DQGIVHRDIKDEN 934

Query: 164  VLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMI--DLYRGLP 221
            V++  +G  K+ DFGS          P E+ +V        T  Y +PE++  + Y+G P
Sbjct: 935  VIVDSNGFVKLIDFGSAA---YTKTGPFEV-FVG-------TIDYAAPEILGGNPYKGKP 983

Query: 222  VDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLREN 281
                 DIWALGV LY L Y   PF    E  IL  + +F      +    +LI  +L ++
Sbjct: 984  ----QDIWALGVLLYTLIYKENPFYNVDE--ILEGQLRFDGTCNVTQDCIDLIRWILTKS 1037

Query: 282  PMQRPNICQLL 292
               RP+I +++
Sbjct: 1038 VNDRPSIDEIV 1048

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 71/275 (25%), Positives = 133/275 (48%), Gaps = 30/275 (10%)

Query: 26  KYLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVV 85
           ++L  GGFA  +  +I        +   + ++ +  + +   L +E+   K +K H+ +V
Sbjct: 146 QFLGEGGFARCF--QIKDESGKIFAAKTVAKISIKTEKTRRKLLSEIQIHKSMK-HQNIV 202

Query: 86  SYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVA 145
            ++D    +  +N     V++L+  C  G L++ +  R    L E EV     Q+   + 
Sbjct: 203 QFVD--CFEDHIN-----VYILLGMCPNGSLMELLKKR--KILTEPEVRFFTVQICGAIK 253

Query: 146 AMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTT 205
            MH+ +  +IHRD+K+ N+   E+ N K+ DFG +  V+    N +E  Y         T
Sbjct: 254 YMHSRR--VIHRDLKLGNIFFDENYNLKIGDFG-LAAVL---ANDRERKYTVCG-----T 302

Query: 206 AQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSK-----FQF 260
             Y +PE++ L +      + DIW++GV ++ L     PF+ A +V  ++S+     + F
Sbjct: 303 PNYIAPEVL-LGKHSGHSYEVDIWSIGVMIFALLIGKPPFQ-AKDVNTIYSRIKNSEYTF 360

Query: 261 PAYPQYSDQLKNLISALLRENPMQRPNICQLLAEV 295
           P     S + K LI  +L  +P+ RP+I +++  V
Sbjct: 361 PINKSISQEAKTLIQDILINDPIARPSINEIMEYV 395

>Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {ON}
            YJL095W (REAL)
          Length = 1484

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 75/279 (26%), Positives = 126/279 (45%), Gaps = 42/279 (15%)

Query: 31   GGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLN--------SLRAEVDAMKLLKAHK 82
            G F  +Y       +  +  +  +K+V VP   S N        +LR+EV  +K L  H 
Sbjct: 1190 GSFGAVYLCL----NVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLD-HL 1244

Query: 83   FVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQ 142
             +V Y+          N  Y +FL  EY A G +   +  R+  R  E  +  + +QV +
Sbjct: 1245 NIVQYLGFEN-----KNSIYSLFL--EYVAGGSVGSLI--RMYGRFDESLIKHLTTQVLR 1295

Query: 143  GVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILK 202
            G+A +H+    ++HRD+K +N+L+ +DG  K+ DF    G+ R  K+     Y   D+  
Sbjct: 1296 GLAYLHS--KGILHRDMKADNLLLDQDGICKISDF----GISRKSKDI----YSNSDMTM 1345

Query: 203  NTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILH----SKF 258
              T  + +PEM+D  +G     K DIW+LG  + ++     P+     VA +     SK 
Sbjct: 1346 RGTVFWMAPEMVDTKQGYSA--KVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKS 1403

Query: 259  QFP----AYPQYSDQLKNLISALLRENPMQRPNICQLLA 293
              P      P  +   ++ + A    +P +RP   +LL+
Sbjct: 1404 APPIPEDTLPLITRVGRSFLDACFEIDPEKRPTATKLLS 1442

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 108/232 (46%), Gaps = 38/232 (16%)

Query: 71  EVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKE 130
           E+  MKLL  H  V+   D    KS+L       ++++EY  +G L + +  R    L E
Sbjct: 89  EIIIMKLLN-HTNVLRLYDVWETKSNL-------YMVLEYVEKGELFNLLVER--GPLPE 138

Query: 131 FEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNP 190
            E ++   Q+  G++  HAL   ++HRD+K EN+L+    N K+ DFG            
Sbjct: 139 NEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFGMAA--------- 187

Query: 191 QELNYVQHDILKNTTA---QYRSPEMIDLYRGLPVDE-KSDIWALGVFLYKLCYYTTPF- 245
                   D L  T+     Y +PE++    GLP    +SD+W+ GV LY L     PF 
Sbjct: 188 ----LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALLTGRLPFD 240

Query: 246 EKAGEVAIL-----HSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLL 292
           E  G +  L       +++ P   + S + ++LI+ +L  +P +R    ++L
Sbjct: 241 EDNGNIRSLLLKVQSGEYEMPGNDEISSEAQDLIAKILTVDPDRRIKTREIL 292

>CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON}
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102w NRK1 ser/thr protein kinase
          Length = 1072

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 69/263 (26%), Positives = 120/263 (45%), Gaps = 35/263 (13%)

Query: 68  LRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNR 127
           ++ E+  +  LK    +  Y  S+   +SL       +++MEYCA G L   +      +
Sbjct: 59  VQREIQFLASLKQIPNITRYYGSYLRGTSL-------WIIMEYCAGGSLRSLLR---PGK 108

Query: 128 LKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPP 187
           + E  +  IM ++   +  +H  +  +IHRDIK  NVLI+ +G  K+CDFG         
Sbjct: 109 IDEKYIGVIMRELLVALKVIH--KDNVIHRDIKAANVLITNEGQVKLCDFGVAA------ 160

Query: 188 KNPQELNYVQHDILKNTTAQ---YRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTP 244
               +LN  Q  + + T A    + +PE+I    G+  D K DIW+LG+  Y++     P
Sbjct: 161 ----QLN--QTSLRRQTMAGTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPP 212

Query: 245 FEKAGEV----AILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAE--VSRI 298
           +     +     I+ SK        Y+ QLK  I+  L E+P +R +  +LL    +   
Sbjct: 213 YCDVEALRAMQLIIKSKPPRLEERNYTPQLKEFIALCLDEDPQERLSAEELLKTKFIKTH 272

Query: 299 QGVPCPVKNFYLERKMLLQQQQQ 321
           +  P  +    + R +L + + +
Sbjct: 273 KATPTTILKELISRYLLFRDKNK 295

>SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102W KIC1 Protein kinase of the PAK/Ste20 kinase
           family required for cell integrity possibly through
           regulating 1 6-beta-glucan levels in the wall physically
           interacts with Cdc31p (centrin) which is a component of
           the spindle pole body
          Length = 885

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 69/242 (28%), Positives = 113/242 (46%), Gaps = 35/242 (14%)

Query: 53  CLKRVLVPD--KPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEY 110
           C  +VL  D  +  +  ++ E+  +  LK    +  Y  S+   + L       +++MEY
Sbjct: 52  CAIKVLNLDTSEDEVEDVQKEIQFLSSLKQVPNITHYYGSYLYDTKL-------WIIMEY 104

Query: 111 CARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDG 170
           CA G L   +      ++ E  +  IM ++   VA ++  +  +IHRDIK  NVLI+ DG
Sbjct: 105 CAGGSLRTLLR---PGKIDEKYIGVIMRELL--VALLYIHKDNVIHRDIKAANVLITNDG 159

Query: 171 NFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTA---QYRSPEMIDLYRGLPVDEKSD 227
             K+CDFG    +             Q ++ + T A    + +PE+I    G+  D K D
Sbjct: 160 RVKLCDFGVAAQL------------TQSNVRRQTMAGTPYWMAPEVI--MEGVYYDTKVD 205

Query: 228 IWALGVFLYKLCYYTTPF--EKAGEVAILHSKFQFPAYP--QYSDQLKNLISALLRENPM 283
           IW+LG+  Y++     P+   +A     L +K + P     QYS  LK  I+  L E+P 
Sbjct: 206 IWSLGITTYEITTGNPPYCDVEALRAMQLITKSKPPRLEGRQYSPLLKEFIALCLDEDPK 265

Query: 284 QR 285
           +R
Sbjct: 266 ER 267

>CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31 or
            uniprot|Q08217 Saccharomyces cerevisiae YOL045w
          Length = 1206

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 88/186 (47%), Gaps = 20/186 (10%)

Query: 112  ARGGLIDFMNT-RLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDG 170
             + G +D  +    ++ + EFE   I  Q+  G+  +H     ++HRDIK ENV++   G
Sbjct: 1035 GQTGSVDLFDIIEFKSNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKG 1092

Query: 171  NFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKS-DIW 229
              K+ DFGS   V   P           D+   T   Y +PE++    G P + KS DIW
Sbjct: 1093 FVKLIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLG---GNPYEGKSQDIW 1138

Query: 230  ALGVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNIC 289
            A+G+ LY L Y   PF    E  IL  + +F      S + K LI+ +L     +RP I 
Sbjct: 1139 AIGILLYTLIYKENPFYNIDE--ILEGELRFNDSADVSQECKALITKILNRCVRKRPTID 1196

Query: 290  QLLAEV 295
            ++  +V
Sbjct: 1197 EICQDV 1202

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score = 84.7 bits (208), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 66/234 (28%), Positives = 115/234 (49%), Gaps = 39/234 (16%)

Query: 68  LRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNR 127
           +  E+  MKL+ +H  V+  ++    KS       E++L++EY   G L D++ ++   +
Sbjct: 173 IEREIVIMKLI-SHPNVMGLLEVWENKS-------ELYLVLEYVDGGELFDYLVSK--GK 222

Query: 128 LKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGN-FKVCDFGSVCGVIRP 186
           L E E +   +Q+ QGV+  H+    + HRD+K EN+L+ +     K+ DFG +  +  P
Sbjct: 223 LSEPEAVHYFTQIIQGVSYCHSFN--ICHRDLKPENLLLDKKNKVIKIADFG-MAALELP 279

Query: 187 PKNPQELNYVQHDILKNTTA--QYRSPEMI--DLYRGLPVDEKSDIWALGVFLYKLCYYT 242
            K           +L+ +     Y SPE++    Y G P    SD+W+ G+ L+ L    
Sbjct: 280 NK-----------LLETSCGSPHYASPEIVMGKPYHGGP----SDVWSCGIILFALLTGH 324

Query: 243 TPFE----KAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLL 292
            PF     K   + +   +FQ P Y   ++  K+LI+ +L  NP +R  I ++L
Sbjct: 325 LPFNDDNIKKLLLKVQAGRFQLPPY--LTNDAKDLITRILVTNPEKRLTINEIL 376

>Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C
           (REAL)
          Length = 974

 Score = 84.0 bits (206), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 71/264 (26%), Positives = 117/264 (44%), Gaps = 32/264 (12%)

Query: 31  GGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDS 90
           G +  +Y A     + ++  +  +K ++      LN + AE+  +K L  H  +V Y   
Sbjct: 34  GSYGVVYKA----INKHTDQVVAIKEIVYESDEELNDIMAEISLLKNLN-HDNIVKY--- 85

Query: 91  HAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHAL 150
                     SYE+++L+EYCA G L   + +R    L E E    ++Q   G+  +H  
Sbjct: 86  ----HGFIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKSYVTQTLLGLKYLHG- 139

Query: 151 QPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRS 210
              +IHRDIK  N+L+S D   K+ DFG     +    N   L           T  + +
Sbjct: 140 -EGVIHRDIKAANILLSADNTVKLADFG-----VSTIVNSSALTLAG-------TLNWMA 186

Query: 211 PEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYP--QYSD 268
           PE++   RG      SDIW+LG  + ++     P+    +  I ++      YP   +S+
Sbjct: 187 PEILG-NRG--ASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSSFSE 243

Query: 269 QLKNLISALLRENPMQRPNICQLL 292
            LK+ +S    +N  +RP   QLL
Sbjct: 244 SLKDFLSKCFVKNMYKRPTADQLL 267

>Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON}
           (25064..28447) [3384 nt, 1128 aa]
          Length = 1127

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 69/258 (26%), Positives = 116/258 (44%), Gaps = 47/258 (18%)

Query: 35  HIYSAEISPPDPNSSSIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAK 94
           H+Y+ ++   D +S  +  ++R              E+  +  LK    +  Y  S+   
Sbjct: 68  HVYAIKVLNLDSDSDEVEDVQR--------------EIQFLASLKQVPNITRYYGSYLQD 113

Query: 95  SSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPL 154
           ++L       +++MEYCA G L   +   +   + E  +  IM ++   +  +H  +  +
Sbjct: 114 TNL-------WIIMEYCAGGSLRTLLRPGM---IDEKYIGVIMRELLTALQCIH--KDNV 161

Query: 155 IHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQ---YRSP 211
           IHRDIK  NVLI+ +G  K+CDFG             +LN  Q  + + T A    + +P
Sbjct: 162 IHRDIKAANVLITNEGKVKLCDFGVAA----------QLN--QTSLRRQTMAGTPYWMAP 209

Query: 212 EMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEV----AILHSKFQFPAYPQYS 267
           E+I    G+  D K DIW+LG+  Y++     P+ +   +     I  SK       QYS
Sbjct: 210 EVI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCEIEALRAMQLITKSKPARLEGRQYS 267

Query: 268 DQLKNLISALLRENPMQR 285
             LK  I+  L E+P +R
Sbjct: 268 SGLKEFIALCLDEDPKER 285

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score = 83.6 bits (205), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 68/271 (25%), Positives = 127/271 (46%), Gaps = 30/271 (11%)

Query: 27  YLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVS 86
           +L  GGFA  +  +I        +   + ++ +  + +   L +E+   K +K H  +V 
Sbjct: 100 FLGEGGFARCF--QIRDDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMK-HVNIVQ 156

Query: 87  YIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAA 146
           +ID     ++       V++L+E C  G L+D +  R    L E EV    +Q+   +  
Sbjct: 157 FIDCFEDDTN-------VYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIKY 207

Query: 147 MHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTA 206
           MH+ +  +IHRD+K+ N+      N K+ DFG    +     N +E  Y         T 
Sbjct: 208 MHSRK--VIHRDLKLGNIFFDRKYNLKIGDFGLAATL----ANDRERKYTV-----CGTP 256

Query: 207 QYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSK-----FQFP 261
            Y +PE++ + +      + DIW++GV +Y L     PF+ + +V  ++ +     F FP
Sbjct: 257 NYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALIIGRPPFQ-SKDVNTIYERIKCRDFSFP 314

Query: 262 AYPQYSDQLKNLISALLRENPMQRPNICQLL 292
                S + K LI  +L  +P++RP++ +++
Sbjct: 315 KDKLISSEAKILIQDILSLDPLERPSVNEIM 345

>Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W
           (REAL)
          Length = 1032

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 69/238 (28%), Positives = 113/238 (47%), Gaps = 40/238 (16%)

Query: 67  SLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQN 126
           ++  E+  MKLL +H  V+S  D     ++L       +L++EY  +G L + +  R   
Sbjct: 73  NIEREIVIMKLL-SHPNVLSLYDVWETDNNL-------YLILEYAEKGELFNLLVDR--G 122

Query: 127 RLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRP 186
            L E E +K   Q+   ++  HAL   ++HRD+K EN+L+    N K+ DFG        
Sbjct: 123 PLPEREAIKCFKQIIIAISYCHAL--GIVHRDLKPENLLLDNSYNIKIADFGMAA----- 175

Query: 187 PKNPQELNYVQHD--ILKNTTA--QYRSPEMIDLYRGLPVDE-KSDIWALGVFLYKLCYY 241
                    +Q D  +L+ +     Y +PE++    GLP +   SD+W+ GV L+ L   
Sbjct: 176 ---------LQTDAGMLETSCGSPHYAAPEIVS---GLPYEGFASDVWSCGVILFALLTG 223

Query: 242 TTPF-EKAGEVAIL-----HSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLA 293
             PF E+ G V  L       +F+ P   + S   ++LI  +L  +P QR  I  +L+
Sbjct: 224 RLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILS 281

>KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1164

 Score = 84.0 bits (206), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 64/225 (28%), Positives = 104/225 (46%), Gaps = 38/225 (16%)

Query: 71  EVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKE 130
           E+  MKLL  H  V+   D     SSL       ++++EY  +G L + +  R    L E
Sbjct: 87  EIIIMKLLN-HPNVLRLYDVWETNSSL-------YMVLEYVEKGELFNLLVDR--GPLPE 136

Query: 131 FEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNP 190
            E ++   Q+  G++  HAL   ++HRD+K EN+L+    N K+ DFG            
Sbjct: 137 NEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFGMAA--------- 185

Query: 191 QELNYVQHDILKNTTA---QYRSPEMIDLYRGLPVDE-KSDIWALGVFLYKLCYYTTPF- 245
                   D L  T+     Y +PE++    GLP    +SD+W+ G+ L+ L     PF 
Sbjct: 186 ----LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGIILFALLTGRLPFD 238

Query: 246 EKAGEV-----AILHSKFQFPAYPQYSDQLKNLISALLRENPMQR 285
           E+ G +      +   KF+ P   + S + ++LI+ +L  +P  R
Sbjct: 239 EEDGNIRNLLLKVQSGKFEMPDTNEISGEAQDLIAKILTVDPAAR 283

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON}
           Anc_5.591 YDR466W
          Length = 1117

 Score = 84.0 bits (206), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 110/235 (46%), Gaps = 38/235 (16%)

Query: 68  LRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNR 127
           +  E+  MKLL+ H  V+S  D     S+L       ++++EY  +G L + +  +    
Sbjct: 81  IEREIIIMKLLR-HANVLSLYDVWETNSNL-------YMILEYAEKGELFNLLVEK--GP 130

Query: 128 LKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPP 187
           L E E ++   Q+  G++  HAL   ++HRD+K EN+L+    N K+ DFG         
Sbjct: 131 LPEKEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFGMAA------ 182

Query: 188 KNPQELNYVQHDILKNTTA---QYRSPEMIDLYRGLPVDE-KSDIWALGVFLYKLCYYTT 243
                      D L  T+     Y +PE++    G+P    +SD+W+ GV L+ L     
Sbjct: 183 -------LETEDKLLETSCGSPHYAAPEIVS---GIPYHGFESDVWSCGVILFALLTGRL 232

Query: 244 PF-EKAGEV-----AILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLL 292
           PF E+ G +      +   +F+ P   + S   ++LIS +L  +P +R    ++L
Sbjct: 233 PFDEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREIL 287

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 109/235 (46%), Gaps = 38/235 (16%)

Query: 68  LRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNR 127
           +  E+  MKLL  H  V+   D           S ++++++EY  +G L + +  R    
Sbjct: 73  IEREIIIMKLLN-HPNVLRLYDVWET-------SKDLYMVLEYVEKGELFNLLVER--GP 122

Query: 128 LKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPP 187
           L E E ++   Q+  G++  HAL   ++HRD+K EN+L+    N K+ DFG         
Sbjct: 123 LPENEAVRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKFNVKLADFGMAA------ 174

Query: 188 KNPQELNYVQHDILKNTTA---QYRSPEMIDLYRGLPVDE-KSDIWALGVFLYKLCYYTT 243
                      D L  T+     Y +PE++    GLP    +SD+W+ GV LY L     
Sbjct: 175 -------LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALLTGRL 224

Query: 244 PF-EKAGEV-----AILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLL 292
           PF E+ G +      +   KF+ P   + S + ++LI+ +L  +P QR    ++L
Sbjct: 225 PFDEEDGNIRNLLLKVQSGKFEMPGDDEISSEAQDLIARILTVDPEQRIKTREIL 279

>KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} similar to
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1433

 Score = 84.0 bits (206), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 111/237 (46%), Gaps = 30/237 (12%)

Query: 65   LNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRL 124
            L +L++EV  +K L  H  +V Y+          N ++   L +EY A G +   +  RL
Sbjct: 1193 LEALKSEVSTLKDLD-HVNIVQYL-------GFENKNHVYSLFLEYVAGGSVGSLI--RL 1242

Query: 125  QNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVI 184
              R  E  +  +  QV +G+A +H+    ++HRD+K +N+L+  DG  K+ DF    G+ 
Sbjct: 1243 FGRFDEDLIRFLAVQVLRGLAYLHSKG--ILHRDMKADNLLLDVDGICKISDF----GIS 1296

Query: 185  RPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTP 244
            +   N     Y   D+    T  + +PEM+D  +G     K DIW+LG  + ++     P
Sbjct: 1297 KKSNNI----YSNSDMTMRGTVFWMAPEMVDTKQGYSA--KVDIWSLGCVVLEMFAGKRP 1350

Query: 245  FEKAGEVAILHSKFQF---PAYPQYSDQL-----KNLISALLRENPMQRPNICQLLA 293
            +     VA +    +F   P  P+ + +L     K+ + A    +P +RP    LL+
Sbjct: 1351 WSNFEVVAAMFKIGKFKSAPPIPEDTQKLLSAEAKSFLDACFEIDPEKRPTADDLLS 1407

>CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} similar
           to uniprot|Q12236 Saccharomyces cerevisiae YOL100w PKH2
          Length = 1076

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 66/250 (26%), Positives = 117/250 (46%), Gaps = 26/250 (10%)

Query: 50  SIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLME 109
           ++  L +  +  +  +  +  E +A++ L   + +V    +   +SSL       + L+E
Sbjct: 209 AVKVLNKEYLIKQKKVKYVNIEKNALQRLNNSRGIVKLFFTFQDESSL-------YFLLE 261

Query: 110 YCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISED 169
           Y   G  +  M  +    L E       +Q+  G+  +H+    +IHRDIK EN+L+ +D
Sbjct: 262 YAPNGDFLSVM--KKYGSLSEDCTRYYSAQIIDGIKYLHS--KGIIHRDIKPENILLDKD 317

Query: 170 GNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNT-----TAQYRSPEMI-DLYRGLPVD 223
              K+ DFG+    I  PKN  E N  + ++L  +     TA+Y SPE++ D Y    VD
Sbjct: 318 MKVKITDFGT--AKILEPKNEDEDN-PEFNLLTRSKSFVGTAEYVSPELLNDSY----VD 370

Query: 224 EKSDIWALGVFLYKLCYYTTPFEKAGEVAILHS--KFQFPAYPQYSDQLKNLISALLREN 281
            + DIWA G  ++++     PF+   E        K Q+     +   +++L+  +L + 
Sbjct: 371 ARCDIWAFGCMVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPVVVRDLVKRILLKV 430

Query: 282 PMQRPNICQL 291
           P QR  I Q+
Sbjct: 431 PEQRLTIPQI 440

>KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1381

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 84/191 (43%), Gaps = 35/191 (18%)

Query: 100  GSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDI 159
            GS ++F L+E+ +               + EFE+  +  QV  GV  +H     ++HRDI
Sbjct: 1213 GSIDLFDLIEFTSN--------------MTEFEIKLLFKQVVSGVKHLH--DQGIVHRDI 1256

Query: 160  KIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMI--DLY 217
            K EN+++   G  K+ DFGS   V   P           D+   T   Y +PE++  + Y
Sbjct: 1257 KDENIIVDNKGFIKIIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGNPY 1305

Query: 218  RGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISAL 277
             G P     DIWALG+ LY + +   PF    E  IL    +F      S     LI  +
Sbjct: 1306 EGKP----QDIWALGILLYTIVFKENPFYNIDE--ILEGDLKFNDPENISQDCIELIKLI 1359

Query: 278  LRENPMQRPNI 288
            L  N  +RP I
Sbjct: 1360 LNRNVFKRPTI 1370

>KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {ON}
           Anc_5.406 YHR102W
          Length = 1027

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 71/272 (26%), Positives = 125/272 (45%), Gaps = 35/272 (12%)

Query: 61  DKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFM 120
           D+  +  ++ E+  +  LK    V  Y  S+   +SL       +++MEYCA G L   +
Sbjct: 77  DEDEVEDVQREIQFLASLKQLPNVTRYYGSYLKNTSL-------WIIMEYCAGGSLRSLL 129

Query: 121 NTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSV 180
                 ++ E  +  IM ++   +  +H  +  +IHRDIK  NVLI+ +G  K+CDFG  
Sbjct: 130 R---PGKIDEKYIGVIMRELLVALKFIH--KDNIIHRDIKAANVLITNEGGVKLCDFGVA 184

Query: 181 CGVIRPPKNPQELNYVQHDILKNTTAQ---YRSPEMIDLYRGLPVDEKSDIWALGVFLYK 237
                      +LN  Q  + + T A    + +PE+I    G+  D K DIW+LG+  Y+
Sbjct: 185 A----------QLN--QRTLRRQTMAGTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYE 230

Query: 238 LCYYTTPF--EKAGEVAILHSKFQFPAYP--QYSDQLKNLISALLRENPMQRPNICQLLA 293
           +     P+   +A     L +K + P      Y+  +K  I+  L E+P +R +  +LL 
Sbjct: 231 ISTGNPPYCDVEALRAMQLITKSKPPRLEGRNYTPLIKEFIALCLDEDPNERLSADELLK 290

Query: 294 E--VSRIQGVPCPVKNFYLERKMLLQQQQQQQ 323
              +   +  P  V    + R +L + +  ++
Sbjct: 291 SKFIKAHKTTPTIVLKELITRYLLFRDKNNRE 322

>Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {ON}
           YDR490C (REAL)
          Length = 758

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 94/200 (47%), Gaps = 17/200 (8%)

Query: 104 VFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIEN 163
           ++ L+EY   G  +  +  +    L E       SQ+   V ++H++   +IHRDIK EN
Sbjct: 199 LYFLLEYAPHGDFLGLI--KKYGSLNEICARYYASQIIDAVDSLHSIG--IIHRDIKPEN 254

Query: 164 VLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNT-----TAQYRSPEMI-DLY 217
           +L+ +D   K+ DFG+   +   P N  +      D+   +     TA+Y SPE++ D Y
Sbjct: 255 ILLDKDMKVKLTDFGTAKILPEQPSNAADGKPC-FDLYAKSKSFVGTAEYVSPELLNDSY 313

Query: 218 RGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHS--KFQFPAYPQYSDQLKNLIS 275
                D + DIWA G  LY++     PF+ A E        K Q+     +   +K+L+ 
Sbjct: 314 ----TDSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTAGFPQIVKDLVK 369

Query: 276 ALLRENPMQRPNICQLLAEV 295
            LL  +P  R  I Q+ A V
Sbjct: 370 KLLVRDPNDRLAIEQIKAHV 389

>Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {ON}
           YER129W (REAL)
          Length = 1147

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 74/265 (27%), Positives = 120/265 (45%), Gaps = 48/265 (18%)

Query: 66  NSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNN-GSYEVFLLMEYCARGGLI----DFM 120
           + ++ E+  MK    HK VV  I+       L++  S +++L++EYC+RG +     D +
Sbjct: 187 DKIKREIAIMKKCH-HKHVVQLIEV------LDDLKSRKIYLVLEYCSRGEVKWCPPDCL 239

Query: 121 NTRLQN-RLKEF-EVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFG 178
            +  +   L  F E  +I+  V  G+  +H     +IHRDIK  N+LISEDG  K+ DFG
Sbjct: 240 ESDAKGPSLLSFQETREILRGVVLGLEYLHYQG--IIHRDIKPANLLISEDGTVKISDFG 297

Query: 179 SVCGVIRPPKNPQELNYVQHDILKNT-TAQYRSPEMI--------------DLYRGLPVD 223
                     +    +  + ++ K   T  + +PEM               +L+RG  + 
Sbjct: 298 VSLAASSTNSSDSSESLNELELAKTVGTPAFFAPEMCLGEDAFTKYNLTKDNLFRGSCIS 357

Query: 224 EKSDIWALGVFLYKLCYYTTPFEKAGEV----AILHSKFQFPAYPQYSDQ---------- 269
              DIWA+GV LY L +   PF    E+     I+    +FP Y +              
Sbjct: 358 FMIDIWAVGVTLYCLLFGMLPFFSDFELKLFEKIVDDPLKFPTYEEMQSNNVSKISCEEE 417

Query: 270 ---LKNLISALLRENPMQRPNICQL 291
               K+L+S LL +NP +R  I ++
Sbjct: 418 YQMAKDLLSKLLEKNPQKRMTIPEI 442

>ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {ON}
           weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 943

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 67/239 (28%), Positives = 113/239 (47%), Gaps = 33/239 (13%)

Query: 61  DKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFM 120
           D+  +  ++ EV  +  +K    +  Y  S+   ++L       ++++EYCA G L   +
Sbjct: 65  DEDEVEDVQREVQFLASMKQTPNITHYYGSYLKDTTL-------WIIIEYCAGGSLRTLL 117

Query: 121 NTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSV 180
                 ++ E  +  IM +V   +  +H  +  +IHRDIK  NVLI+ +G+ K+CDFG  
Sbjct: 118 R---PGKIDEKYIGIIMREVLIALKYIH--KDNVIHRDIKAANVLITNEGHVKLCDFGVA 172

Query: 181 CGVIRPPKNPQELNYVQHDILKNTTAQ---YRSPEMIDLYRGLPVDEKSDIWALGVFLYK 237
                      +LN  Q  + + T A    + +PE+I    G+  D K DIW+LG+  Y+
Sbjct: 173 A----------QLN--QSSLKRQTMAGTPYWMAPEVI--MEGVSYDTKVDIWSLGITTYE 218

Query: 238 LCYYTTPF--EKAGEVAILHSKFQFPAYP--QYSDQLKNLISALLRENPMQRPNICQLL 292
           +     P+   +A     L +K + P      YS  LK  I+  L E+P +R +   LL
Sbjct: 219 IATGNPPYCDVEALRAMQLITKSKPPRLEGRHYSPMLKEFIALCLDEDPKERLSADDLL 277

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 73/277 (26%), Positives = 132/277 (47%), Gaps = 36/277 (12%)

Query: 27  YLTSGGFAHIYSAEISPPDPNSSSIAC--LKRVLVPDKPSLNSLRAEVDAMKLLKAHKFV 84
           +L  GGFA  +  +    D +    A   + ++ +  + +   L +E+   K +K H  +
Sbjct: 82  FLGEGGFARCFQMK----DDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMK-HPNI 136

Query: 85  VSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGV 144
           V +ID     ++       V++L+E C  G L+D +  R    L E EV    +Q+   +
Sbjct: 137 VQFIDCFEDDTN-------VYILLEICPNGSLMDLLKKR--KVLTEPEVRYFTTQIVGAI 187

Query: 145 AAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNT 204
             MH  +  +IHRD+K+ N+    + N K+ DFG +  V+    N +E  Y         
Sbjct: 188 KYMHNRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVL---ANDRERKYTV-----CG 236

Query: 205 TAQYRSPEMI-DLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSKFQ---- 259
           T  Y +PE++   + G   +   DIW++GV +Y L     PF+ A EV I++ + +    
Sbjct: 237 TPNYIAPEVLAGKHSGHSYE--VDIWSIGVMIYALLIGKPPFQ-AKEVNIIYERIKSGDY 293

Query: 260 -FPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEV 295
            FP     S ++  LI  +L  +P++RP++ +++  V
Sbjct: 294 IFPREKPTSKEVMVLIQDILSIDPIERPSLDEIMDYV 330

>CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31
          Length = 1336

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 87/190 (45%), Gaps = 33/190 (17%)

Query: 100  GSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDI 159
            GS ++F L+E+              +  + E E   +  QV  GV  +H     ++HRDI
Sbjct: 1168 GSIDLFDLIEF--------------KTNMTEIEAKLLFKQVVSGVKHLH--DQGIVHRDI 1211

Query: 160  KIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRG 219
            K EN+++   G  K+ DFGS   V   P           D+   T   Y +PE++    G
Sbjct: 1212 KDENIIVDSQGFVKIIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLG---G 1257

Query: 220  LPVDEK-SDIWALGVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALL 278
             P + K  DIWA+G+ LY + +   PF    E  IL  + +F +    S+Q   LI+ +L
Sbjct: 1258 SPYEGKPQDIWAIGILLYTIVFKENPFYNIDE--ILEGELKFNSSELVSEQCTTLIAKIL 1315

Query: 279  RENPMQRPNI 288
              N  +RP I
Sbjct: 1316 NRNVQKRPTI 1325

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 66/234 (28%), Positives = 110/234 (47%), Gaps = 39/234 (16%)

Query: 68  LRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNR 127
           +  E+  MKL+ +H  V+   +    KS       E++L++EY   G L D++ +R   R
Sbjct: 163 IEREIVIMKLI-SHANVLGLYEVWENKS-------ELYLVLEYVDGGELFDYLVSR--GR 212

Query: 128 LKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISE-DGNFKVCDFGSVCGVIRP 186
           L E E +    Q+ QGV+  HA    + HRD+K EN+L+ + +   K+ DFG        
Sbjct: 213 LCEREAVHYFKQIIQGVSYCHAFN--ICHRDLKPENLLLDKKNSTIKIADFGMAAL---- 266

Query: 187 PKNPQELNYVQHDILKNTTA--QYRSPEMI--DLYRGLPVDEKSDIWALGVFLYKLCYYT 242
                    V + +L+ +     Y SPE++    Y G P    SD+W+ G+ L+ L    
Sbjct: 267 --------EVSNKLLQTSCGSPHYASPEIVMGKQYHGGP----SDVWSCGIILFALLTGH 314

Query: 243 TPFE----KAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLL 292
            PF     K   + +   K+Q P     S + ++LI+ +L  NP +R    ++L
Sbjct: 315 LPFNDDSIKKLLLKVQSGKYQMPQ--NLSKEAQDLIAKILTVNPAKRLTTEEIL 366

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507c GIN4
          Length = 1103

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 65/236 (27%), Positives = 110/236 (46%), Gaps = 38/236 (16%)

Query: 67  SLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQN 126
           ++  E+  MKLL  H  V+   D     S L       +L++EY  +G L + +  R   
Sbjct: 75  NIEQEIIIMKLLN-HPNVLRLFDVWETNSDL-------YLVLEYAEKGELFNMLVER--G 124

Query: 127 RLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRP 186
            L E E ++   Q+  G++  H+L   ++HRD+K EN+L+    N K+ DFG        
Sbjct: 125 PLPENEAVRAFRQIIIGISYCHSL--GVVHRDLKPENLLLDNKLNIKIADFGMAA----- 177

Query: 187 PKNPQELNYVQHDILKNTTA---QYRSPEMIDLYRGLPVDE-KSDIWALGVFLYKLCYYT 242
                       D L  T+     Y +PE+I    GLP +   SD+W+ GV L+ L    
Sbjct: 178 --------LESEDKLLETSCGSPHYAAPEIIS---GLPYEGFSSDVWSCGVILFALLTGR 226

Query: 243 TPF-EKAGEV-----AILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLL 292
            PF E+ G +      +   +F+ P   + + + ++L++ LL  +P +R  I ++L
Sbjct: 227 LPFDEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREIL 282

>YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein
           kinase of the bud neck involved in the septin
           checkpoint, associates with septin proteins, negatively
           regulates Swe1p by phosphorylation, shows structural
           homology to bud neck kinases Gin4p and Hsl1p
          Length = 1037

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 67/236 (28%), Positives = 110/236 (46%), Gaps = 36/236 (15%)

Query: 67  SLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQN 126
           ++  E+  MKLL +H  V+S  D     ++L       +L++EY  +G L + +      
Sbjct: 73  NIEREIVIMKLL-SHPNVLSLYDVWETNNNL-------YLILEYAEKGELFNLLVD--HG 122

Query: 127 RLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRP 186
            L E E +    Q+  G++  HAL   ++HRD+K EN+L+    N K+ DFG        
Sbjct: 123 PLPEREAINCFRQIIIGISYCHALG--IVHRDLKPENLLLDSFYNIKIADFGMAAL---- 176

Query: 187 PKNPQELNYVQHDILKNTTA--QYRSPEMIDLYRGLPVDE-KSDIWALGVFLYKLCYYTT 243
                       D+L+ +     Y +PE++    GLP +   SD+W+ GV L+ L     
Sbjct: 177 --------QTDADLLETSCGSPHYAAPEIV---SGLPYEGFASDVWSCGVILFALLTGRL 225

Query: 244 PF-EKAGEVAIL-----HSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLA 293
           PF E+ G V  L       +F+ P   + S   ++LI  +L  +P QR  I  +L+
Sbjct: 226 PFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILS 281

>Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {ON}
           YDR523C (REAL)
          Length = 490

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 77/275 (28%), Positives = 125/275 (45%), Gaps = 45/275 (16%)

Query: 31  GGFAHIYSAEISPPDPNSSSIACLKRV-LVPDKPSLNSLRAEVDAMKLLKAHKFVVSYID 89
           G F  +Y A     D  +  I  +K V L      +  L  E+  +  LK+   + +YI 
Sbjct: 27  GNFGDVYKAM----DRVTQEIVAIKVVNLEHSDEDIELLAQEIFFLAELKS-PLITNYIT 81

Query: 90  SHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHA 149
           +     S+       +++MEYC  G   D +     N L E +V  I+ QV+ G+  +H 
Sbjct: 82  TMLEDVSM-------WIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHQVTLGLKYLHE 134

Query: 150 LQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYR 209
            +   IHRDIK  N+L++E+G  K+ DFG V G IR        +  + D     T  + 
Sbjct: 135 QRK--IHRDIKAANILLNEEGMVKLGDFG-VSGHIR--------STFKRDTFVG-TPYWM 182

Query: 210 SPEM----IDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHS-------KF 258
           +PE+    +D Y     +EK+DIW+LG+  Y+L     P  K   + ++ +       K 
Sbjct: 183 APEVVCCEVDGY-----NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKL 237

Query: 259 QFPAYPQYSDQLKNLISALLRENPMQRPNICQLLA 293
           Q P    +S+  K  ++  L + P  RP+   LL+
Sbjct: 238 QGP----FSEAAKEFVAGCLVKTPADRPSAYDLLS 268

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 72/274 (26%), Positives = 129/274 (47%), Gaps = 30/274 (10%)

Query: 27  YLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVS 86
           +L  GGFA  +  +I        +   + ++ +  + +   L +E+   K ++ H  +V 
Sbjct: 84  FLGEGGFARCF--QIKDDGGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMR-HTNIVQ 140

Query: 87  YIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAA 146
           ++D     ++       V++L+E C  G L+D +  R    L E EV    +Q+   V  
Sbjct: 141 FVDCFEDDTN-------VYILLEICPNGSLMDLLKRR--KMLTEPEVRFFTTQIVGAVKY 191

Query: 147 MHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTA 206
           MH+ +  +IHRD+K+ N+   +  N KV DFG +  V+    N +E  Y         T 
Sbjct: 192 MHSRR--VIHRDLKLGNIFFDKHYNLKVGDFG-LAAVL---ANDRERKYTV-----CGTP 240

Query: 207 QYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSK-----FQFP 261
            Y +PE++   +      + DIW+ GV +Y L     PF+ A EV I++ +     F FP
Sbjct: 241 NYIAPEVLT-GKHTGHSYEVDIWSCGVMIYALLIGKPPFQ-AKEVNIIYERIKCGDFVFP 298

Query: 262 AYPQYSDQLKNLISALLRENPMQRPNICQLLAEV 295
                S +   LI  +L  +P++RP++ +++  V
Sbjct: 299 KDKFISPEALVLIKDILSIDPLERPSLDEIIDYV 332

>KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa]
           {ON} 
          Length = 1009

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 57/199 (28%), Positives = 104/199 (52%), Gaps = 31/199 (15%)

Query: 103 EVFLLMEYCARGGLIDFMNTRLQ-NRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKI 161
           +V++ +EYC    L D +   LQ  R+   E +++ SQ+   V   H+L    +HRD+K+
Sbjct: 111 KVWMALEYCPGRELYDHV---LQMKRIPAEECIQLFSQIVGAVYYAHSLN--CVHRDLKL 165

Query: 162 ENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDL--YRG 219
           EN+L+ +DGN K+ DFG            + +  V  + +  TT  Y +PE+ +   Y G
Sbjct: 166 ENILLDKDGNAKLTDFGFT---------RECMEKVNLETICGTTV-YMAPELTERKPYDG 215

Query: 220 LPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSKFQ-FPAYPQYSDQL-----KNL 273
             +    DIW+LGV LY +   + PF++  E     +K++     P+Y+ +      ++L
Sbjct: 216 FKI----DIWSLGVILYTMLSGSMPFDEDDEAK---TKWKIINEEPEYNSKFMTAEGEDL 268

Query: 274 ISALLRENPMQRPNICQLL 292
           +  LL+++   RP++ ++L
Sbjct: 269 VRKLLQKDSNLRPSVREIL 287

>KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1095

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 59/244 (24%), Positives = 111/244 (45%), Gaps = 18/244 (7%)

Query: 50  SIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLME 109
           ++  L +  +  +  +  +  E +A++ +   K +V    +   +SSL       + L+E
Sbjct: 206 AVKVLNKEYLIKQKKVKYVNIEKNALQRINNSKMIVKLFFTFQDESSL-------YFLLE 258

Query: 110 YCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISED 169
           YC  G  +  M  +    L E       +QV   +  +H     +IHRDIK EN+L+ ++
Sbjct: 259 YCPNGDFLSLM--KKYGSLNETVACYYSAQVIDAIDYLHT--NGIIHRDIKPENILLDKE 314

Query: 170 GNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIW 229
              K+ DFG+   +     N  +L       +   TA+Y +PE+++      VD + D+W
Sbjct: 315 FKIKLTDFGTAKILDSSTNNKFDLLTRSKSFV--GTAEYVAPELLN---DSFVDYRCDVW 369

Query: 230 ALGVFLYKLCYYTTPFEKAGEVAILHS--KFQFPAYPQYSDQLKNLISALLRENPMQRPN 287
           A G  LY++     PF+   E        K Q+     +   +++L+  +L ++  QRP+
Sbjct: 370 AFGCILYQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLIIRDLVKKILVKDLNQRPS 429

Query: 288 ICQL 291
           I Q+
Sbjct: 430 ISQI 433

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 129/274 (47%), Gaps = 30/274 (10%)

Query: 27  YLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVS 86
           +L  GGFA  +  +I        +   + ++ +  + +   L +E+   K ++ H  +V 
Sbjct: 84  FLGEGGFARCF--QIKDDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMR-HFNIVQ 140

Query: 87  YIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAA 146
           +ID     ++       V++L+E C  G L+D +  R    L E EV    +Q+   V  
Sbjct: 141 FIDCFEDDTN-------VYILLEICPNGSLMDLLKRR--KVLTEPEVRFFTTQIVGAVKY 191

Query: 147 MHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTA 206
           MH+ +  +IHRD+K+ N+   +  N K+ DFG +  V+    N +E  Y         T 
Sbjct: 192 MHSRR--VIHRDLKLGNIFFDKHYNLKIGDFG-LAAVL---ANDRERKYTV-----CGTP 240

Query: 207 QYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSK-----FQFP 261
            Y +PE++   +      + DIW+ GV +Y L     PF+ A EV I++ +     + FP
Sbjct: 241 NYIAPEVLT-GKHTGHSYEVDIWSCGVMIYALLIGKPPFQ-AKEVNIIYERIKCGDYVFP 298

Query: 262 AYPQYSDQLKNLISALLRENPMQRPNICQLLAEV 295
                S +   LI  +L  +P++RP++ +++  V
Sbjct: 299 RDKCISQEALTLIRDILSIDPLERPSLDEIIDYV 332

>KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1229

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 88/193 (45%), Gaps = 22/193 (11%)

Query: 105  FLLMEYCARGGLIDFMN-TRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIEN 163
            +L  E     G ID  +   L+  + EFE   +  QV+ G+  +H     ++HRDIK EN
Sbjct: 1051 YLETEMHGETGSIDLFDLIELKTNMTEFEAKLLFKQVASGIKHLH--DNGIVHRDIKDEN 1108

Query: 164  VLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMI--DLYRGLP 221
            V++   G  K+ DFGS   V   P           D+   T   Y +PE++  + Y G P
Sbjct: 1109 VIVDNKGFVKLIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGEPYEGKP 1157

Query: 222  VDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLREN 281
                 DIWA+GV LY + Y   PF    E  IL    +  +  + S +   LI  +L  +
Sbjct: 1158 ----QDIWAIGVLLYTIIYKENPFYNIDE--ILDGDLRIQSTHEVSAECVALIRKILNRS 1211

Query: 282  PMQRPNICQLLAE 294
              +RP I  ++ +
Sbjct: 1212 VSKRPTIDDIMED 1224

>NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {ON}
           Anc_5.406
          Length = 1020

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 64/236 (27%), Positives = 110/236 (46%), Gaps = 27/236 (11%)

Query: 61  DKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFM 120
           D+  +  ++ E+  +  LK    +  Y  S+   +SL       +++MEYCA G L   +
Sbjct: 78  DEDEVEDVQREIQFLASLKQLPNITRYYGSYLKDTSL-------WIIMEYCAGGSLRTLL 130

Query: 121 NTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSV 180
                 ++ E  +  I  ++   +  +H  +  +IHRDIK  NVLI+ +G+ K+CDFG  
Sbjct: 131 R---PGKIDEKYIGVITREILIALKYIH--KDNIIHRDIKAANVLITNEGSIKLCDFGVA 185

Query: 181 CGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCY 240
             + +  K  Q +           T  + +PE+I    G+  D K DIW+LG+  Y++  
Sbjct: 186 AQLNQSTKRRQTM---------AGTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEIAT 234

Query: 241 YTTPF--EKAGEVAILHSKFQFPAYP--QYSDQLKNLISALLRENPMQRPNICQLL 292
              P+   +A     L +K + P      YS  LK  ++  L E+P +R +   LL
Sbjct: 235 GNPPYCEIEALRAMQLITKSKPPRLEGRNYSPLLKEFVALCLDEDPKERMSAEDLL 290

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 57/192 (29%), Positives = 91/192 (47%), Gaps = 24/192 (12%)

Query: 105  FLLMEYCARG--GLIDFMN-TRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKI 161
            +  +E    G  G ID  +   ++  + E E + I  Q++ G+  +H     ++HRDIK 
Sbjct: 1033 YYYIETAVHGTSGSIDLFDLIEMKTDMTEHEAMLIFKQIASGIKNLH--DNGIVHRDIKD 1090

Query: 162  ENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMI--DLYRG 219
            ENV++  +G  K+ DFGS   V   P           D+   T   Y +PE++  + Y G
Sbjct: 1091 ENVIVDCNGFVKIVDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGEPYEG 1139

Query: 220  LPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLR 279
             P     DIWA+GV LY + Y   PF    E  IL +  +  +  + SD    LI  +L 
Sbjct: 1140 KP----QDIWAIGVLLYTIIYKENPFYNIDE--ILDADLRVNSSERISDDCIALIRKILN 1193

Query: 280  ENPMQRPNICQL 291
             +  +RP+I ++
Sbjct: 1194 RSVSKRPSIDEI 1205

>KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {ON}
           Anc_6.262 YPL236C
          Length = 387

 Score = 80.5 bits (197), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 73/303 (24%), Positives = 134/303 (44%), Gaps = 61/303 (20%)

Query: 54  LKRVLVP--DKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYC 111
           +++++ P  D  S+++   E+D  +  K+  +++  +DS   +    +GS  V +L+ Y 
Sbjct: 88  VRQIMCPFGDIESVSNALKEIDNYRYFKS-PYIMQCLDSQVIQR--RDGSKTVLILLPYL 144

Query: 112 ARGGLIDFMNTRLQN--RLKEFEVLKIMSQVSQGVAAMH-------------------AL 150
             G L D ++  L +  R+ E EV+++M    +G+  +H                   A+
Sbjct: 145 PLGSLRDAIDRNLLDGIRMSESEVIRVMIGTCRGLLYLHDPTSRGNLGSSMGPQNGMDAV 204

Query: 151 QPPL----------------------------IHRDIKIENVLISEDGNFKVCDFGSVCG 182
              L                             H +IK  N+L S DG   + + GS+  
Sbjct: 205 SMTLSDDAAMLLDGTPFEMDMLSSHSMKMDSYAHMNIKPSNILFSSDGLPVITELGSLQK 264

Query: 183 VIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYT 242
           +    +N + L  ++    ++ T  Y  PE+++L  G  +D   DIW+LG  LY L +  
Sbjct: 265 LDLKIENVKMLKSIKEWTEEHCTVYYMPPELLNLKVGTVLDCSVDIWSLGCTLYTLLFGI 324

Query: 243 TPF---EKAGEV----AILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEV 295
           +PF   E+  EV     I  +++ FP    YS +L ++I   L+ NP  RP + +LL ++
Sbjct: 325 SPFKREEQVNEVPLKYGISKARYSFPEGHVYSKKLVSVIETCLQVNPTMRPTVNELLGQL 384

Query: 296 SRI 298
             I
Sbjct: 385 QDI 387

>SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {ON}
           weakly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141C Hypothetical ORF
          Length = 919

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 65/258 (25%), Positives = 125/258 (48%), Gaps = 36/258 (13%)

Query: 46  PNSSSIACLKRVLVPDKPSLN-SLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEV 104
           P   +I  ++R  VP        +  E++A+K L  H  +V        +  L N  Y +
Sbjct: 72  PKQVAIKLIRRDTVPKNSDKEVKIYREINALKHL-THPNIVRL------EEVLQNSKY-I 123

Query: 105 FLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENV 164
            +++EY + G    ++  +   RLKE    ++ +Q+  GV  MH+    L+HRD+K+EN+
Sbjct: 124 GIVLEYASGGEFYRYIQKK--RRLKEHAACRLFAQLISGVHYMHSKG--LVHRDLKLENL 179

Query: 165 LISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQ--YRSPEMIDLYRGLPV 222
           L+ ++ N  + DFG V           E N+ +++++K +     Y +PE++   +    
Sbjct: 180 LLDKNENLLITDFGFV----------NEFNH-KNELMKTSCGSPCYAAPELVVTTKPYEA 228

Query: 223 DEKSDIWALGVFLYKLCYYTTPFEKAGE-------VAILHSKFQFP-AYPQYSDQL-KNL 273
             K+DIW+ GV +Y +     P++   E         + H   + P  +P+Y + + ++L
Sbjct: 229 -RKADIWSCGVIMYAMLAGYLPWDDDSENPEGDDIAKLYHYITKTPLKFPEYINPVPRDL 287

Query: 274 ISALLRENPMQRPNICQL 291
           +  +L  NP +R N+ Q+
Sbjct: 288 LRRILVSNPKKRLNLRQV 305

>KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.496
           YHL007C
          Length = 798

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 68/254 (26%), Positives = 120/254 (47%), Gaps = 34/254 (13%)

Query: 48  SSSIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLL 107
           S+ +  +K++ +  +P    +  E+  MK  + H  VV++I++H +K +L       +++
Sbjct: 539 SNELVAIKQMDLEKQPKKELILNEIIVMKESR-HNNVVNFINAHLSKGNL-------WIV 590

Query: 108 MEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLIS 167
           MEY   G L D +   L   L E ++  +  +  +G+  +H+    +IHRDIK +NVL+S
Sbjct: 591 MEYMEGGSLTDVVTHCL---LSEGQIGAVCRETLEGLKFLHS--KGVIHRDIKSDNVLLS 645

Query: 168 EDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSD 227
             G+ K+ DFG  C  I    N  +LN          T  + +PE++      P   K D
Sbjct: 646 MKGDIKLTDFG-FCAQI----NDIDLNRTT----MVGTPYWMAPEVVSRKEYGP---KVD 693

Query: 228 IWALGVFLYKLCYYTTPFEKAGEVAILH-------SKFQFPAYPQYSDQLKNLISALLRE 280
           IW+LG+ + ++     P+     +  L+        K + P     SD   N +   LR 
Sbjct: 694 IWSLGIMIIEMIEGEPPYLNEAPLKALYLIATNGTPKLKEPE--NLSDVFSNFLDRCLRV 751

Query: 281 NPMQRPNICQLLAE 294
            P +R +  +LLA+
Sbjct: 752 EPEERASAIELLAD 765

>Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 73/274 (26%), Positives = 120/274 (43%), Gaps = 52/274 (18%)

Query: 31  GGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLNSLRAEVDAMK------LLKAHKFV 84
           G +  +Y A     + ++  +  +K ++  +   LN + AE+  +K      ++K H F+
Sbjct: 34  GSYGVVYKA----INKHTDQVVAIKEIVYENDEELNDIMAEISLLKNLNNNNIVKYHGFI 89

Query: 85  VSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNR----LKEFEVLKIMSQV 140
                           SYE+++L+EYCA G L      RL +R    L E E    ++Q 
Sbjct: 90  --------------RKSYELYILLEYCANGSL-----RRLVSRSPTGLSENESKTYVTQT 130

Query: 141 SQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDI 200
             G+  +H     +IHRDIK  N+L+S D   K+ DFG     +    N   L       
Sbjct: 131 LWGLKYLHG--EGVIHRDIKAANILLSADNTVKLADFG-----VSTIVNSSALTLAG--- 180

Query: 201 LKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSKFQF 260
               T  + +PE++   RG      SDIW+LG  + +L     P+    +  I ++    
Sbjct: 181 ----TLNWMAPEILG-NRG--ASTLSDIWSLGATVVELLTKNPPYHNLTDANIYYAVEND 233

Query: 261 PAYP--QYSDQLKNLISALLRENPMQRPNICQLL 292
             YP   +S+ LK+ +S    +N  +RP   QLL
Sbjct: 234 TYYPPTAFSESLKDFLSKCFVKNMYKRPTADQLL 267

>KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 993

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 95/192 (49%), Gaps = 14/192 (7%)

Query: 104 VFLLMEYCARGGLIDFMNT-RLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIE 162
           ++ L+EY   G   DF++  +    L +   +   +Q+   +  +H  Q  +IHRDIK E
Sbjct: 237 LYFLLEYAPNG---DFLSVIKKYGSLNQDCSVYYSAQILDAIDYLH--QKGVIHRDIKPE 291

Query: 163 NVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMI-DLYRGLP 221
           N+L+ +D   K+ DFG+   ++   +  Q  N ++       TA+Y SPE++ D Y    
Sbjct: 292 NILLDKDMKVKLTDFGT-AKLVEKDETTQTYNLLERSKSFVGTAEYVSPELLNDNY---- 346

Query: 222 VDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHS--KFQFPAYPQYSDQLKNLISALLR 279
           VD K DIWA G  L+++     PF+   E        K Q+     +   +++LI  +L 
Sbjct: 347 VDYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLIIRDLIKQILV 406

Query: 280 ENPMQRPNICQL 291
           +NP QR +  Q+
Sbjct: 407 KNPEQRLDTLQV 418

>TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1.271
            YJL095W
          Length = 1429

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 70/259 (27%), Positives = 121/259 (46%), Gaps = 38/259 (14%)

Query: 51   IACLKRVLVPDKPSLN--------SLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSY 102
            +  +K+V VP   S N        +LRAE+  +K L  H  +V Y+    AK  +N+   
Sbjct: 1149 MMAVKQVEVPKYGSQNEQIIHTVEALRAEMSTLKNLD-HLNIVQYL-GFEAKDHMNS--- 1203

Query: 103  EVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIE 162
               L +EY A G +   +  R+  R  E  +  + +QV +G++ +H+    ++HRD+K +
Sbjct: 1204 ---LFLEYVAGGSVGSLI--RMYGRFDEVMIKHLTTQVLRGLSYLHSRG--ILHRDMKAD 1256

Query: 163  NVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPV 222
            N+L+ ++G  K+ DF    G+ R  K+     Y   ++    T  + +PEM+D  +G   
Sbjct: 1257 NLLLDQEGVCKISDF----GISRKSKDI----YSNSEMTMRGTVFWMAPEMVDTAQGYSA 1308

Query: 223  DEKSDIWALGVFLYKLCYYTTPFEKAGEVA----ILHSKFQFP----AYPQYSDQLKNLI 274
              K DIW++G  + ++     P+     VA    I  SK   P      P  S   ++ I
Sbjct: 1309 --KVDIWSMGCVVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQSGRDFI 1366

Query: 275  SALLRENPMQRPNICQLLA 293
             A  + +P  RP   + L+
Sbjct: 1367 DACFQIDPEARPTADKQLS 1385

>Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 80.9 bits (198), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 76/275 (27%), Positives = 125/275 (45%), Gaps = 45/275 (16%)

Query: 31  GGFAHIYSAEISPPDPNSSSIACLKRV-LVPDKPSLNSLRAEVDAMKLLKAHKFVVSYID 89
           G F  +Y A     D  +  I  +K V L      +  L  E+  +  LK+   + +YI 
Sbjct: 22  GNFGDVYKAM----DRTTQEIVAIKVVNLEHSDEDIELLAQEIFFLAELKS-PLITNYIT 76

Query: 90  SHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHA 149
           +     S+       +++MEYC  G   D +     N L E +V  I+ QV+ G+  +H 
Sbjct: 77  TMLEDVSM-------WIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLHE 129

Query: 150 LQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYR 209
            +   IHRDIK  N+L++E+G  K+ DFG V G +R        + ++ D     T  + 
Sbjct: 130 QRK--IHRDIKAANILLNEEGMVKLGDFG-VSGHLR--------STMKRDTFVG-TPYWM 177

Query: 210 SPEM----IDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHS-------KF 258
           +PE+    +D Y     +EK+DIW+LG+  Y+L     P  K   + ++ +       K 
Sbjct: 178 APEVVCCEVDGY-----NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKL 232

Query: 259 QFPAYPQYSDQLKNLISALLRENPMQRPNICQLLA 293
           Q      +SD  K  ++  L + P  RP+   LL+
Sbjct: 233 Q----GSFSDAAKEFVAGCLVKVPADRPSAYDLLS 263

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 66/255 (25%), Positives = 117/255 (45%), Gaps = 46/255 (18%)

Query: 68  LRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNR 127
           +  E+  MKL+  H  +++  +    KS       E++L++EY   G L D++  R   +
Sbjct: 111 IEREIIIMKLI-THPNIMALYEVWENKS-------ELYLVLEYVEGGELFDYLIAR--GK 160

Query: 128 LKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISE-DGNFKVCDFGSVCGVIRP 186
           L E E +    Q+ QGV+  H     + HRD+K EN+L+ + +   K+ DFG        
Sbjct: 161 LPEQEAIHYFKQIVQGVSYCHNFN--ICHRDLKPENLLLDKKNKTVKIADFGMAAL---- 214

Query: 187 PKNPQELNYVQHDILKNTTA--QYRSPEMI--DLYRGLPVDEKSDIWALGVFLYKLCYYT 242
                      + +L+ +     Y SPE++    Y G P    SD+W+ G+ L+ L    
Sbjct: 215 --------ETTNRLLETSCGSPHYASPEIVMGQKYHGSP----SDVWSCGIILFALLTGH 262

Query: 243 TPFEKAGEVAIL----HSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRI 298
            PF       +L    H ++Q P+    S + K+LIS +L  +P +R  + ++L     +
Sbjct: 263 LPFNDDNVRKLLLKVQHGRYQMPS--NVSKEAKDLISKILVVDPEKRITVDKILEHPLLV 320

Query: 299 Q-------GVPCPVK 306
           +       G+ CP++
Sbjct: 321 KYDNPGKGGLACPLE 335

>NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa] {ON}
            
          Length = 1515

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 73/279 (26%), Positives = 122/279 (43%), Gaps = 42/279 (15%)

Query: 31   GGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPS--------LNSLRAEVDAMKLLKAHK 82
            G F  +Y       +  +  +  +K+V VP   S        + +LR+EV  +K L  H 
Sbjct: 1223 GSFGAVYLCL----NVTTGEMMAVKQVEVPKYSSQDEAIISTVEALRSEVSTLKDLD-HL 1277

Query: 83   FVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQ 142
             +V Y+          N      L +EY A G +   +  R+  R  E  +  + +QV +
Sbjct: 1278 NIVQYL-------GFENKDNIYSLFLEYVAGGSVGSLI--RMYGRFDEPLIRHLNTQVLR 1328

Query: 143  GVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILK 202
            G+A +H+    ++HRD+K +N+L+ +DG  K+ DF    G+ R  K+     Y   D+  
Sbjct: 1329 GLAYLHSRG--ILHRDMKADNLLLDQDGVCKISDF----GISRKSKDI----YSNSDMTM 1378

Query: 203  NTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILH----SKF 258
              T  + +PEM+D  +G     K DIW+LG  + ++     P+     VA +     SK 
Sbjct: 1379 RGTVFWMAPEMVDTKQGYSA--KVDIWSLGCIVLEMFAGKRPWSNYEVVAAMFKIGKSKS 1436

Query: 259  QFP----AYPQYSDQLKNLISALLRENPMQRPNICQLLA 293
              P      P  S   ++ + A    +P  RP    LL+
Sbjct: 1437 APPIPPDTLPLISQNGRDFLDACFEIDPDNRPTADNLLS 1475

>Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054W
           (REAL)
          Length = 388

 Score = 80.1 bits (196), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 66/220 (30%), Positives = 105/220 (47%), Gaps = 27/220 (12%)

Query: 24  IIKYLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSL--NSLRAEVDAMKLLKAH 81
           II++L  G +  + S +    +P  + IA  K   + +K  L   ++R E+  M   K H
Sbjct: 40  IIQFLGKGAYGTVCSVKFKGQNP-PAKIAVKKISNIFNKEILLKRAIR-ELKFMNFFKGH 97

Query: 82  KFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVS 141
           K +V+ ID     SS  +G Y    L++Y     L   +++ +Q  L EF +   + Q+ 
Sbjct: 98  KNIVNLIDLEIVSSSPYDGLYCYQELIDY----DLAKVIHSSVQ--LSEFHIKYFLYQIL 151

Query: 142 QGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGV------IRPPKNPQELNY 195
            G+  +H+    +IHRD+K  N+L + +G  K+CDFG   G+        P   P   NY
Sbjct: 152 CGLKYIHS--ADVIHRDLKPGNILCTLNGCLKICDFGLARGIHAEFFQCNPSVQPHITNY 209

Query: 196 VQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFL 235
           V        T  YR+PE+  L    P ++  DIWA+G  L
Sbjct: 210 V-------ATRWYRAPEL--LLSNQPYNKSIDIWAVGCIL 240

>Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 80.9 bits (198), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 76/275 (27%), Positives = 125/275 (45%), Gaps = 45/275 (16%)

Query: 31  GGFAHIYSAEISPPDPNSSSIACLKRV-LVPDKPSLNSLRAEVDAMKLLKAHKFVVSYID 89
           G F  +Y A     D  +  I  +K V L      +  L  E+  +  LK+   + +YI 
Sbjct: 22  GNFGDVYKAM----DRTTQEIVAIKVVNLEHSDEDIELLAQEIFFLAELKS-PLITNYIT 76

Query: 90  SHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHA 149
           +     S+       +++MEYC  G   D +     N L E +V  I+ QV+ G+  +H 
Sbjct: 77  TMLEDVSM-------WIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLHE 129

Query: 150 LQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYR 209
            +   IHRDIK  N+L++E+G  K+ DFG V G IR        + ++ D     T  + 
Sbjct: 130 QRK--IHRDIKAANILLNEEGMVKLGDFG-VSGHIR--------STMKRDTFVG-TPYWM 177

Query: 210 SPEM----IDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHS-------KF 258
           +PE+    +D Y     +EK+DIW+LG+  Y+L     P  K   + ++ +       K 
Sbjct: 178 APEVVCCEVDGY-----NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKL 232

Query: 259 QFPAYPQYSDQLKNLISALLRENPMQRPNICQLLA 293
           Q      +S+  K  ++  L + P  RP+   LL+
Sbjct: 233 Q----GSFSEAAKEFVAGCLVKAPADRPSAYDLLS 263

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 98/207 (47%), Gaps = 47/207 (22%)

Query: 103 EVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIE 162
           +V++  EYC    L D +   LQ R+     +++ +Q+   V   H+L    +HRD+K+E
Sbjct: 103 KVWMAQEYCPGKDLYDHV-LSLQ-RVPSSACIELFTQIVGAVYYAHSLN--CVHRDLKLE 158

Query: 163 NVLISEDGNFKVCDFG------------SVCGVIRPPKNPQELNYVQHDILKNTTAQYRS 210
           N+L+ ++GN K+ DFG            ++CG                      T  Y +
Sbjct: 159 NILLDKNGNAKLTDFGFTRECMTKTSLETICG----------------------TTVYMA 196

Query: 211 PEMI--DLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSKF-QFPAYPQ-- 265
           PE+I  + Y G  +    DIW+LGV LY +   + PF++  E         + P +    
Sbjct: 197 PELIKRESYDGFKI----DIWSLGVILYTMLNGSMPFDEDDETKTEWKIMNEMPVFNDTI 252

Query: 266 YSDQLKNLISALLRENPMQRPNICQLL 292
            S+  K+L+  LL ++P +RP++ ++L
Sbjct: 253 LSEDAKDLLIKLLSKDPNERPSMQEIL 279

>NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1411

 Score = 82.0 bits (201), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 82/183 (44%), Gaps = 22/183 (12%)

Query: 115  GLIDFMN-TRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFK 173
            G ID  +    +  + EFE   I  QV  G+  +H     ++HRDIK ENV++   G  K
Sbjct: 1243 GCIDLFDLIEFKTNMTEFEAKLIFKQVVSGIKHLH--HQGIVHRDIKDENVIVDSKGLVK 1300

Query: 174  VCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMI--DLYRGLPVDEKSDIWAL 231
            + DFGS   V   P           D+   T   Y +PE++  + Y G P     DIWAL
Sbjct: 1301 IIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLSGEPYEGKP----QDIWAL 1345

Query: 232  GVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQL 291
            G+ LY + +   PF    E  IL    +F +  + ++    LI  +L      RP I ++
Sbjct: 1346 GILLYTIVFKENPFYNIDE--ILEGDLKFDSNTEVTEDCMELIKKVLIRQVRNRPAIDEI 1403

Query: 292  LAE 294
              +
Sbjct: 1404 FDD 1406

>TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1057

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 61/229 (26%), Positives = 107/229 (46%), Gaps = 28/229 (12%)

Query: 71  EVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKE 130
           E +A++ L   + +V    +   +SSL       + L+EY   G  +  M  +    L E
Sbjct: 215 EKNALQRLNNSRGIVKLYFTFQDESSL-------YFLLEYAPNGDFLSIM--KKYGSLNE 265

Query: 131 FEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNP 190
                  +Q+   +  +H+    ++HRDIK EN+L+ +D   K+ DFG+   ++ P  N 
Sbjct: 266 DCACYYSAQIIDAIDFLHS--KGIVHRDIKPENILLDKDFKVKLTDFGT-AKILEPKPNT 322

Query: 191 QELNYVQHDILKNT-----TAQYRSPEMI-DLYRGLPVDEKSDIWALGVFLYKLCYYTTP 244
            +     +D+L  +     TA+Y SPE++ D Y    VD + DIWA G  L+++     P
Sbjct: 323 TD----SYDLLSRSKSFVGTAEYVSPELLNDNY----VDYRCDIWAFGCILFQMIAGKPP 374

Query: 245 FEKAGEVAILHS--KFQFPAYPQYSDQLKNLISALLRENPMQRPNICQL 291
           F+   E        K Q+     +   +++L+  +L + P QR  I Q+
Sbjct: 375 FKATNEYLTFQKVMKVQYAFTAGFPLVVRDLVKGILIKQPAQRLTIPQI 423

>CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096w KIN2 ser/thr protein kinase
          Length = 1192

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 60/223 (26%), Positives = 101/223 (45%), Gaps = 44/223 (19%)

Query: 101 SYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIK 160
           S   ++L EY A G L+D++       L+E    K    V+  +  +HA    ++HRD+K
Sbjct: 204 SNHFYMLFEYVAGGQLLDYIIQ--HGSLREHHARKFARGVASALQYLHANN--IVHRDLK 259

Query: 161 IENVLISEDGNFKVCDFG------------SVCGVIRPPKNPQELNYVQHDILKNTTAQY 208
           IEN++IS  G  K+ DFG            + CG          L +   ++LK     Y
Sbjct: 260 IENIMISNSGEIKIIDFGLSNVYDTRKQLHTFCG---------SLYFAAPELLK--AHPY 308

Query: 209 RSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSKFQFP--AYPQY 266
             PE+             D+W+ GV LY L     PF+     ++LH K +     YPQ+
Sbjct: 309 TGPEV-------------DVWSFGVVLYVLVCGKVPFDDENS-SVLHEKIKRGKVEYPQH 354

Query: 267 -SDQLKNLISALLRENPMQRPNICQLLAEVSRIQGVPCPVKNF 308
            S ++ +L+S +L  +P +R ++ Q++      +G   P  ++
Sbjct: 355 LSIEVMSLLSKMLVVDPSRRASLKQVVEHPWMTKGYDTPAPSY 397

>NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5.406
          Length = 1015

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 110/232 (47%), Gaps = 33/232 (14%)

Query: 61  DKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFM 120
           D+  +  ++ EV  +  LK    +  Y  S+   +SL       +++MEYCA G L   +
Sbjct: 73  DEDEVEDVQREVQFLSSLKQIPNITRYYGSYLKDTSL-------WIIMEYCAGGSLRSLL 125

Query: 121 NTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSV 180
                 ++ E  +  IM ++   +  +H  +  +IHRDIK  NVLI+ +G+ K+CDFG  
Sbjct: 126 R---PGKIDEKYIGVIMRELLVALKYIH--KDNVIHRDIKAANVLITNEGSVKLCDFGVA 180

Query: 181 CGVIRPPKNPQELNYVQHDILKNTTAQ---YRSPEMIDLYRGLPVDEKSDIWALGVFLYK 237
                      +LN  Q  + + T A    + +PE+I    G+  D K DIW+LG+  Y+
Sbjct: 181 A----------QLN--QSTLRRQTMAGTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYE 226

Query: 238 LCYYTTPF--EKAGEVAILHSKFQFPAYP--QYSDQLKNLISALLRENPMQR 285
           +     P+   +A     L +K + P      Y+  LK  I+  L E+P +R
Sbjct: 227 IATGNPPYCEVEALRAMQLITKSKPPRLESRSYTPLLKEFIALCLDEDPKER 278

>NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_1.271
          Length = 1555

 Score = 82.0 bits (201), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 73/278 (26%), Positives = 124/278 (44%), Gaps = 42/278 (15%)

Query: 31   GGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPS--------LNSLRAEVDAMKLLKAHK 82
            G F  +Y       +  +  +  +K+V VP   S        ++++++EV  +K L  H 
Sbjct: 1263 GSFGAVYLCL----NVTTGEMMAVKQVEVPKYSSQDEAIMSTVDAIKSEVSTLKDLD-HL 1317

Query: 83   FVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQ 142
             +V Y+          N      L +EY A G +   +  R+  R  E  +  +  QV +
Sbjct: 1318 NIVQYL-------GFENKDNIYSLFLEYVAGGSVGSLI--RIYGRFDEPLIRHLNIQVLR 1368

Query: 143  GVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILK 202
            G+A +HA    ++HRD+K +N+L+ +DG  K+ DF    G+ R  K+     Y   D+  
Sbjct: 1369 GLAYLHARG--ILHRDMKADNLLLDQDGVCKISDF----GISRKSKDI----YSNSDMTM 1418

Query: 203  NTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSKFQFPA 262
              T  + +PEM+D  +G     K DIW+LG  + ++     P+     VA +    +  +
Sbjct: 1419 RGTVFWMAPEMVDTKQGYSA--KVDIWSLGCIVLEMFAGKRPWSNFEVVAAMFKIGKSKS 1476

Query: 263  YPQYSDQLKNLISALLRE--------NPMQRPNICQLL 292
             P   +    LISA  RE        +P +RP   +LL
Sbjct: 1477 APPIPEDTLPLISAEGREFLDACFEIDPDKRPTADELL 1514

>CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa]
           {ON} similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007c STE20 Serine/threonine-protein kinase
          Length = 915

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 71/279 (25%), Positives = 125/279 (44%), Gaps = 38/279 (13%)

Query: 21  KARIIKYLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLNSLRAEVDAMKLLKA 80
           K R +  +  G    +Y A     D  S     +K++ +  +P    +  E+  M+  K 
Sbjct: 619 KYRDLIKIGQGASGGVYIAH----DTESEDSVAIKQMNLEKQPKKELILNEILVMRESK- 673

Query: 81  HKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQV 140
           H  +V++IDS+ AK  L       +++MEY   G L D +   L   L E ++  +  + 
Sbjct: 674 HSNIVNFIDSYLAKGDL-------WIVMEYMEGGSLTDVVTHCL---LSEGQIGAVCRET 723

Query: 141 SQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDI 200
            +G+  +H+    ++HRDIK +N+L+S  GN K+ DFG  C  I       E N  +  +
Sbjct: 724 LKGLQFLHS--KGVLHRDIKSDNILLSLKGNIKLTDFG-FCAQI------NENNLKRTTM 774

Query: 201 LKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILH----- 255
           +   T  + +PE++      P   K DIW+LG+ + ++     P+     +  L+     
Sbjct: 775 VG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATN 829

Query: 256 --SKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLL 292
              K + P     SD L   +   L+ +P +R    +LL
Sbjct: 830 GTPKLKEPE--ALSDTLTKFLDWCLKVDPSERATATELL 866

>ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1204

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 104/227 (45%), Gaps = 44/227 (19%)

Query: 101 SYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIK 160
           S   ++L EY + G L+D++       L+E    K    ++  +  +HA    ++HRD+K
Sbjct: 236 SNHFYMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGIASALQYLHANN--IVHRDLK 291

Query: 161 IENVLISEDGNFKVCDFG------------SVCGVIRPPKNPQELNYVQHDILKNTTAQY 208
           IEN++IS  G  K+ DFG            + CG          L +   ++LK   + Y
Sbjct: 292 IENIMISTSGEIKIIDFGLSNMFDPRTQLHTFCG---------SLYFAAPELLK--ASPY 340

Query: 209 RSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSKFQFPA--YPQY 266
             PE+             D+W+ GV LY L     PF+     ++LH K +     YPQ+
Sbjct: 341 VGPEV-------------DVWSFGVVLYVLVCGKVPFDDENS-SVLHEKIKQGKVDYPQH 386

Query: 267 -SDQLKNLISALLRENPMQRPNICQLLAEVSRIQGVPCPVKNFYLER 312
            S ++ +L+S +L  +P +R ++ Q++     I+G   P  ++   R
Sbjct: 387 LSIEVISLLSKMLVVDPRKRASLKQVVEHHWMIRGYDFPAPSYVPNR 433

>KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8.279
           YLR096W
          Length = 1095

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 61/227 (26%), Positives = 104/227 (45%), Gaps = 44/227 (19%)

Query: 101 SYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIK 160
           S   ++L EY + G L+D++       L+E    K    V+  +  +HA    ++HRD+K
Sbjct: 197 SNHFYMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGVASALQYLHANN--IVHRDLK 252

Query: 161 IENVLISEDGNFKVCDFG------------SVCGVIRPPKNPQELNYVQHDILKNTTAQY 208
           IEN++IS  G  K+ DFG            + CG          L +   ++LK     Y
Sbjct: 253 IENIMISTSGEIKIIDFGLSNVFDTRKQLHTFCG---------SLYFAAPELLK--ANPY 301

Query: 209 RSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSKFQFP--AYPQY 266
             PE+             DIW+ GV LY L     PF+     ++LH K +     YP +
Sbjct: 302 IGPEV-------------DIWSFGVVLYVLVCGKVPFDDENS-SVLHEKIKQGKVEYPNH 347

Query: 267 -SDQLKNLISALLRENPMQRPNICQLLAEVSRIQGVPCPVKNFYLER 312
            S ++ +L+S +L  +P++R N+ +++     I+G   P  ++  +R
Sbjct: 348 LSIEVISLLSKMLVVDPLKRANLTKVIEHPWMIRGYDFPPPSYLPKR 394

>NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score = 79.7 bits (195), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 64/196 (32%), Positives = 96/196 (48%), Gaps = 27/196 (13%)

Query: 104 VFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIEN 163
           V+L+MEY   G L   +  R      +    + + Q++  +  +H  +  +IHRD+K EN
Sbjct: 227 VYLIMEYLVYGELYKLL--RSHGPFNDIIASRFVYQIADALNHLH--EKGIIHRDLKPEN 282

Query: 164 VLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVD 223
           +LI  +   K+ DFG    +I P         V+   L  T   Y SPEMI   R    D
Sbjct: 283 ILIGFNNVLKLTDFG--WSIINPKG-------VKRKTLCGTI-DYLSPEMI---RSREYD 329

Query: 224 EKSDIWALGVFLYKLCYYTTPFEK-AGEVA---ILHSKFQFPAYPQYSDQLKNLISALLR 279
           +  D+WALGV  Y+L     PFE+ + E+    IL  + +FP     S  +++LIS LL+
Sbjct: 330 DTVDVWALGVLTYELVAGDPPFEEDSKELTYKRILKGEIRFPG--TVSQDVRDLISRLLK 387

Query: 280 ENPMQRPNICQLLAEV 295
            +P +R     LL EV
Sbjct: 388 NDPKER----ILLKEV 399

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 57/200 (28%), Positives = 99/200 (49%), Gaps = 31/200 (15%)

Query: 103 EVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIE 162
           E++L++EY   G L D++ ++   +L E E +    Q+  G++  H+    + HRD+K E
Sbjct: 209 ELYLVLEYVDGGELFDYLVSK--GKLTESEAVHYFKQIINGISYCHSFN--ICHRDLKPE 264

Query: 163 NVLISEDGNF-KVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTA--QYRSPEMI--DLY 217
           N+L+ +     K+ DFG                 V + +L+ +     Y SPE++    Y
Sbjct: 265 NLLLDKKRRIIKIADFGMAAL------------QVSNRLLQTSCGSPHYASPEIVMGKCY 312

Query: 218 RGLPVDEKSDIWALGVFLYKLCYYTTPFE----KAGEVAILHSKFQFPAYPQYSDQLKNL 273
            G P    SDIW+ G+ L+ L     PF     K   + + + ++Q P+Y   S + KNL
Sbjct: 313 NGAP----SDIWSCGIILFALLTGHLPFNDDNIKKLLIKVQNGRYQMPSY--ISQEAKNL 366

Query: 274 ISALLRENPMQRPNICQLLA 293
           IS +L  +P +R +  Q+L+
Sbjct: 367 ISRILVVDPSKRISTEQILS 386

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score = 79.3 bits (194), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 72/273 (26%), Positives = 115/273 (42%), Gaps = 40/273 (14%)

Query: 28  LTSGGFAHIYSAEISPPDPNSSSIACLKRVL----VPDKPSLNSLRAEVDAMKLLKAHKF 83
           L  G F  +Y     P     S + C  +V+    + +       + E+D    L     
Sbjct: 124 LGKGKFGKVYCVRHKP-----SGLICALKVMNKMEIVNFNVQKQFKREIDIQYHLNHKNL 178

Query: 84  VVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQG 143
              Y   H +K+        V+L+MEY   G L   +  +    + +      + Q++  
Sbjct: 179 TKLYAFFHDSKN--------VYLVMEYLIGGELYKLL--KKNGPMNDITASNYVYQMTDA 228

Query: 144 VAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKN 203
           +  MH  +  +IHRD+K EN+LI  +   K+ DFG     I  P N +            
Sbjct: 229 LNYMH--KRKIIHRDLKPENILIGFNNQIKLTDFG---WSIYNPNNQKRKTLC------- 276

Query: 204 TTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVA----ILHSKFQ 259
            T  Y SPE+I        DE  D+WALG+  Y+L     PFE+  +      I  S  +
Sbjct: 277 GTIDYLSPELIS---SREYDENVDVWALGILTYELVVGAPPFEEDTKEQTYKRIAKSDLK 333

Query: 260 FPAYPQYSDQLKNLISALLRENPMQRPNICQLL 292
           FP  P  S + ++LI+ LL+  P +R N+ Q++
Sbjct: 334 FP--PNVSSEARDLITNLLKVVPSERFNLQQVM 364

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa]
           {ON} YCL024W (REAL)
          Length = 1128

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 63/227 (27%), Positives = 106/227 (46%), Gaps = 36/227 (15%)

Query: 68  LRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNR 127
           +  E+  MKLL  H  V+   D     + L       +L++EY  +G L + +  R    
Sbjct: 78  IEREIIIMKLLN-HPNVLRLYDVWETNTDL-------YLVLEYAEKGELFNLLVER--GP 127

Query: 128 LKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPP 187
           L E E ++   Q+  GV+  HAL   ++HRD+K EN+L+    N K+ DFG         
Sbjct: 128 LPENEAIRFFRQIIIGVSYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMAAL----- 180

Query: 188 KNPQELNYVQHDILKNTTA--QYRSPEMIDLYRGLPVDE-KSDIWALGVFLYKLCYYTTP 244
                    +  +L+ +     Y +PE++    G+P     SD+W+ GV L+ L     P
Sbjct: 181 -------ETEGKLLETSCGSPHYAAPEIVS---GIPYQGFASDVWSCGVILFALLTGRLP 230

Query: 245 F-EKAGEVAIL-----HSKFQFPAYPQYSDQLKNLISALLRENPMQR 285
           F E+ G +  L       +F+ P+  + S + ++LIS +L  +P +R
Sbjct: 231 FDEEDGNIRALLLKVQKGEFELPSDDEISREAQDLISKILTVDPERR 277

>NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141
          Length = 948

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 78/322 (24%), Positives = 145/322 (45%), Gaps = 68/322 (21%)

Query: 15  LTVGSHKARIIKYLTSGGFAHIYSA---------EISPPDPNSSSIACLKRVLVPDKPSL 65
           +T+G     I K +  G FA ++ A         +++ P P + +I  + R  + +K  L
Sbjct: 30  ITIGPDTYMIDKEIGKGSFATVHRAHLLRKQIKDDLTSP-PLNFAIKIVSRSKLKNKKLL 88

Query: 66  NSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQ 125
            +L  E+  +K +  H  +V  ID     +       + +L+MEYCA G L  F+  +  
Sbjct: 89  ENLEIEIAILKKIN-HPHIVKLIDCERTTT-------DFYLIMEYCALGDLT-FLIKKRH 139

Query: 126 NRLKEFEVLK--------------------IMSQVSQGVAAMHALQPP-LIHRDIKIENV 164
             +K   +L+                    I++ + Q  +A+  L+   L+HRDIK +N+
Sbjct: 140 ELIKNHPLLEKIFEKYPSPNENYNGLHRAFILNYLQQLASALKFLRSKNLVHRDIKPQNL 199

Query: 165 LI-------SEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQ--------YR 209
           L+       ++   FK   F  +  +  P     +  + +   L NT+          Y 
Sbjct: 200 LLLTPLINYNDSKAFKKLGFIGIYEL--PILKIADFGFAR--FLPNTSMAETLCGSPLYM 255

Query: 210 SPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAIL------HSKFQFPAY 263
           +PE+++  +    + K+D+W++G  LY++CY T PF+ +  + +       ++K  FP Y
Sbjct: 256 APEILNYQK---YNAKADLWSVGTVLYEMCYGTPPFKASNHLELYKKIKRSNNKINFPNY 312

Query: 264 PQYSDQLKNLISALLRENPMQR 285
            Q  + +K LIS LL  +P +R
Sbjct: 313 IQIQNDMKILISKLLTFDPQRR 334

>Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}
           YGL179C (REAL)
          Length = 569

 Score = 80.5 bits (197), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 87/313 (27%), Positives = 135/313 (43%), Gaps = 60/313 (19%)

Query: 6   LETYPSGTVLTVGSH-KARIIKYLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPS 64
           L TY     L  G + K ++ + LT+GG                 +I  L R    +  S
Sbjct: 47  LNTYDILGTLGNGQYGKVKLARDLTTGGLV---------------AIKILNRFEKKNGYS 91

Query: 65  LNS------LRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNN-GSYEVFLLMEYCARGGLI 117
           L        +R E++ MK    H+ VV   D       LN+  S +V+L++EYC+RG + 
Sbjct: 92  LQGTVENPRIREEIEIMKRCH-HENVVKLYDI------LNDPESTKVYLVLEYCSRGPVK 144

Query: 118 DFMNTRLQNR-----LKEFE-VLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGN 171
                +L+ +     +  FE   KI+S V  G+  +H+    + HRDIK  N+LIS +G 
Sbjct: 145 WCPENQLEIKAVGPSILTFEQARKIVSDVVSGLEYLHS--QGITHRDIKPSNLLISSNGA 202

Query: 172 FKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTA---QYRSPEMIDLYRGLPVDEKSDI 228
            K+ DFG          N Q     Q  I K+ T     + +PE+             DI
Sbjct: 203 VKISDFGVSILTTTGSTNIQS---SQEQISKSKTLGTPAFFAPELCTADGDYRCSSAIDI 259

Query: 229 WALGVFLYKLCYYTTPFEKAGEVA----ILHSKFQFPAYPQYS------------DQLKN 272
           W+LGV LY + + T PF     +     I+     FP+Y Q S            +  K+
Sbjct: 260 WSLGVTLYCMLFGTLPFNANSALELFDNIISKPLSFPSYEQVSKRGHPNLAREEYNDAKD 319

Query: 273 LISALLRENPMQR 285
           +++ LL++NP +R
Sbjct: 320 ILNRLLKKNPSER 332

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score = 81.3 bits (199), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 95/199 (47%), Gaps = 31/199 (15%)

Query: 103 EVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIE 162
           E++L++EY   G L D++ ++   +L E E ++   Q+ +GV   H+    + HRD+K E
Sbjct: 234 ELYLVLEYVDGGELFDYLVSK--GKLTELEAVRYFKQIIRGVQYCHSFN--ICHRDLKPE 289

Query: 163 NVLISEDGNF-KVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTA--QYRSPEMI--DLY 217
           N+L+ +     K+ DFG                 V + +LK +     Y SPE++    Y
Sbjct: 290 NLLLDKKRKLIKIADFGMAAL------------QVSNTLLKTSCGSPHYASPEIVMGKTY 337

Query: 218 RGLPVDEKSDIWALGVFLYKLCYYTTPFE----KAGEVAILHSKFQFPAYPQYSDQLKNL 273
            G P    SD+W+ G+ L+ L     PF     K   + + + ++Q P Y   S   K+L
Sbjct: 338 NGGP----SDVWSCGIILFALLTGHLPFNDDSIKKLLIKVQNGRYQMPNY--LSKDAKDL 391

Query: 274 ISALLRENPMQRPNICQLL 292
           IS +L  NP  R    Q+L
Sbjct: 392 ISRILLVNPKARLTTEQIL 410

>KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 925

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 66/231 (28%), Positives = 110/231 (47%), Gaps = 28/231 (12%)

Query: 71  EVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKE 130
           E + ++ LK  K ++S   +   +SSL       + L+EY   G L+  M  R    + E
Sbjct: 203 EKNTLQRLKNTKGIISLYFTFQDESSL-------YFLLEYAPNGDLLSLM--RKHGSVNE 253

Query: 131 FEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNP 190
                  +Q+   +  MH     +IHRD+K EN+L+  D   K+ DFG+     R   + 
Sbjct: 254 KCTQYYAAQIIDALGFMH--DKGVIHRDLKPENILLDVDMKVKLTDFGTA----RLLDST 307

Query: 191 QELNYVQHDILKNT-----TAQYRSPEMI-DLYRGLPVDEKSDIWALGVFLYKLCYYTTP 244
            E + +++D+L  +     TA+Y SPE++ D Y    VD + DIWA G  L+++     P
Sbjct: 308 SE-DDLKYDLLTRSNSFVGTAEYVSPELLNDNY----VDFRCDIWAFGCILFQMIAGKPP 362

Query: 245 FEKAGEVAILHS--KFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLA 293
           F+   E        K QF     +   +++L+  +L +NP +R  I Q+ A
Sbjct: 363 FKANNEYLTFQKVMKVQFAFTAGFPMTVRDLVKNILIKNPERRLLINQIKA 413

>TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8.141
           YGL180W
          Length = 1154

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 76/298 (25%), Positives = 137/298 (45%), Gaps = 50/298 (16%)

Query: 26  KYLTSGGFAHIYSAEISPPDPNSS-SIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFV 84
           K +  G FA +Y    S  DPN   ++  + +  + +K  L +L  E+  +K L  HK +
Sbjct: 136 KEIGKGSFAVVYRG-YSNEDPNFKLAVKSVPKSKLKNKKILENLEIEISILKKLN-HKHI 193

Query: 85  VSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTR--------LQNRLKE------ 130
           V+ ID    K+       +  L+MEYC+ G L   +  R        L N++ +      
Sbjct: 194 VNLIDCQRNKN-------DFLLIMEYCSLGDLTFLIKKRNELIINHPLLNQIFQKFPSPN 246

Query: 131 -----FEVLKIMSQVSQGVAAMHALQP-PLIHRDIKIENVLIS-------EDGNFKVCDF 177
                  +  +++ + Q  +A+  L+   LIHRDIK +N+L+S       +   FK   +
Sbjct: 247 PDCNGLNIAFVLNYLQQLASALKFLRSRNLIHRDIKPQNLLLSTPYTDYHDQQTFKKLGY 306

Query: 178 -GSVCGVIRPPKNPQELNYVQHDILKNTTAQ---YRSPEMIDLYRGLPVDEKSDIWALGV 233
            G  C  I    +     ++ +  L  T      Y +PE+++  +    + K+D+W++G 
Sbjct: 307 IGISCLPILKIADFGFARFLPNTSLAETLCGSPLYMAPEILNYQK---YNAKADLWSVGT 363

Query: 234 FLYKLCYYTTPFEKAGEVAIL------HSKFQFPAYPQYSDQLKNLISALLRENPMQR 285
            LY++ Y   PF+    + +L      +    FP+Y +  D +K LIS LL+ +P++R
Sbjct: 364 VLYEMVYGKPPFKANNHLELLKKIKRTNDNIPFPSYIEIDDDMKFLISRLLKFDPIKR 421

>NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496
          Length = 895

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 84/319 (26%), Positives = 152/319 (47%), Gaps = 52/319 (16%)

Query: 22  ARIIKYLTSGGFAHIYSA-EISPPDPNSSSIACLKRVLVPDKPSLNSLRAEVDAMKLLKA 80
           A ++K +  GG A +Y+A E+      + S+A +K++ +  +P    +  E+  MK    
Sbjct: 614 ANLVK-IGRGGSALVYTAYEVG----TNLSVA-IKQINLEKQPRKQLILNEIIVMKK-SQ 666

Query: 81  HKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQV 140
           H  +V++IDS+     L       +++MEY   G L D +   +   L+E ++  +  +V
Sbjct: 667 HPNIVNFIDSYLVDGKL-------WVIMEYMEAGSLTDVVTRCI---LREGQIGAVCREV 716

Query: 141 SQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDI 200
            +G+  +H+    +IHRDIK +NVL+S DG+ K+ DFG  C          +LN +   +
Sbjct: 717 LKGLVFLHS--KGVIHRDIKSDNVLLSMDGDIKLTDFG-FCA---------QLNDIH--L 762

Query: 201 LKNT---TAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC-----YYTTPFEKAGEVA 252
            +NT   T  + +PE+++     P   K DIW+LGV + ++      Y   P  +A  + 
Sbjct: 763 KRNTMVGTPYWMAPEIVEKKHYCP---KVDIWSLGVMIIEMIEGEPPYLNEPPLRALYLI 819

Query: 253 ILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAE--VSRIQG----VPCPVK 306
             +   +     + S+ L   I+  L  +P  R    +LL    ++ I G    +   VK
Sbjct: 820 ATNGTPKLKDPEKLSETLSEFINCCLFVDPELRKTAAELLNHRFITEIAGPNKSLSHLVK 879

Query: 307 NFYLERKMLLQQQQQQQQQ 325
             YL++   L+++   Q Q
Sbjct: 880 LAYLQK---LEEKNGAQDQ 895

>SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 400

 Score = 79.0 bits (193), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 66/220 (30%), Positives = 97/220 (44%), Gaps = 54/220 (24%)

Query: 104 VFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIEN 163
           V+LLMEY   G L  + + R+     +      ++Q++  +  MH     ++HRDIK EN
Sbjct: 213 VYLLMEYLVNGEL--YRHLRVNGPFNDILASYYVNQMADALNYMHDRN--VLHRDIKPEN 268

Query: 164 VLISEDGNFKVCDFG------------SVCGVIRPPKNPQELNYVQHDILKNTTAQYRSP 211
           +LI      K+ DFG            ++CG                      T  Y SP
Sbjct: 269 ILIGFQNTLKLTDFGWSVISTTGAKRKTLCG----------------------TLDYLSP 306

Query: 212 EMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVA----ILHSKFQFPAYPQYS 267
           E++  YR    DEK D+WALGV  Y+L   T PFE+A +      I+    +FP   Q S
Sbjct: 307 ELVK-YRE--YDEKVDVWALGVLAYELLVGTPPFEEASKELTYKRIVRRDLRFPD--QMS 361

Query: 268 DQLKNLISALLRENPMQRPNICQLLAEVSRIQGVPCPVKN 307
              ++LI  LL  +P  R ++  +L+        P  VKN
Sbjct: 362 IDARDLIGRLLENDPSTRISLKDVLSH-------PWIVKN 394

>ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} similar
           to uniprot|P38991 Saccharomyces cerevisiae YPL209C IPL1
           Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 367

 Score = 78.6 bits (192), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 90/186 (48%), Gaps = 23/186 (12%)

Query: 104 VFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIEN 163
           V+LLMEY   G L   +  R +  L +      + Q++  +  MH  Q  +IHRD+K EN
Sbjct: 182 VYLLMEYLVNGELYKLL--RAKGPLDDIFASHYVYQMADALDYMH--QRNIIHRDVKPEN 237

Query: 164 VLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVD 223
           +LI  D   K+ DFG    +I P    ++            T  Y SPE+I        D
Sbjct: 238 ILIGFDNTVKLTDFG--WSIINPRGTKRK--------TMCGTLDYLSPELI---ASKEYD 284

Query: 224 EKSDIWALGVFLYKLCYYTTPFEK-AGEVA---ILHSKFQFPAYPQYSDQLKNLISALLR 279
           +K D+WALGV  ++L   + PFE+ + E+    I+    +FP +   S   ++LI+ LLR
Sbjct: 285 DKVDVWALGVLTFELVVNSPPFEEDSKELTSKRIVRGDLKFPNH--ISSDAQDLITKLLR 342

Query: 280 ENPMQR 285
            N   R
Sbjct: 343 HNSKDR 348

>ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa]
            {ON} similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095W BCK1 Mitogen-activated protein (MAP) kinase
            kinase kinase acting in the protein kinase C signaling
            pathway which controls cell integrity upon activation by
            Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1487

 Score = 80.9 bits (198), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 72/259 (27%), Positives = 121/259 (46%), Gaps = 38/259 (14%)

Query: 51   IACLKRVLVPDKPSLN--------SLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSY 102
            +  +K+V VP   S N        +LRAEV  +K L  H  +V Y+     K S+    Y
Sbjct: 1207 MMAVKQVEVPRYGSQNEAIISTVEALRAEVSTLKDLD-HLNIVQYL-GFEVKDSI----Y 1260

Query: 103  EVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIE 162
             +FL  EY A G +   +  R+  +  E  +  +  QV +G++ +H+    ++HRD+K +
Sbjct: 1261 SLFL--EYVAGGSVGSLI--RMYGKFDEKLIKHLTIQVLRGLSYLHSRG--ILHRDMKAD 1314

Query: 163  NVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPV 222
            N+L+ +DG  K+ DF    G+ R  K+     Y   ++    T  + +PEM+D  +G   
Sbjct: 1315 NLLLDQDGVCKISDF----GISRKSKDI----YSNSEMTMRGTVFWMAPEMVDTKQGYSA 1366

Query: 223  DEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRE-- 280
              K DIW+LG  + ++     P+     VA +    +  + P   D    LIS   R+  
Sbjct: 1367 --KVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPDDTLPLISQSGRDFL 1424

Query: 281  ------NPMQRPNICQLLA 293
                  +P +RP   +LL+
Sbjct: 1425 DQCFKIDPEERPTADKLLS 1443

>TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1.271
            YJL095W
          Length = 1434

 Score = 80.9 bits (198), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 72/293 (24%), Positives = 133/293 (45%), Gaps = 41/293 (13%)

Query: 9    YPSGTVLTVGSHKARIIKY-LTSGGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLNS 67
            +  G ++  GS  A  +   +T+G    +   E+  P   S S   L  V         +
Sbjct: 1135 WMKGEMIGKGSFGAVFLSLNITTGEMMAVKQIEV--PSYGSQSETMLNTV--------EA 1184

Query: 68   LRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNR 127
            +++EV  +K L  H  +V Y+        + +  Y +FL  EY A G +   +  R+  R
Sbjct: 1185 MKSEVSTLKDLD-HLNIVQYLGFE-----MKHNIYSLFL--EYVAGGSVGSLI--RMYGR 1234

Query: 128  LKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPP 187
              +  +  + +QV +G++ +H+    ++HRD+K +N+L+ +DG  K+ DFG         
Sbjct: 1235 FDDKLIRHLTNQVLEGLSYLHS--QGILHRDMKADNLLLDQDGICKISDFG-------IS 1285

Query: 188  KNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEK 247
            K  +++ Y   ++    T  + +PEM+D  +G   + K DIW+LG  + ++     P+  
Sbjct: 1286 KKSEDI-YSNSEMTMRGTVFWMAPEMVDTKQGY--NAKVDIWSLGCVVLEMFAGKRPWSN 1342

Query: 248  AGEVAILHSKFQFPAYPQYSDQLKNLISALLRE--------NPMQRPNICQLL 292
               V  ++   Q  + P   +  K+LIS   +         +P +RP   QLL
Sbjct: 1343 FEVVTAMYKIGQSKSAPPIPEDTKDLISPTAKNFLNQCFHIDPKERPTAGQLL 1395

>TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {ON}
           Anc_5.406 YHR102W
          Length = 987

 Score = 80.5 bits (197), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 64/236 (27%), Positives = 111/236 (47%), Gaps = 27/236 (11%)

Query: 61  DKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFM 120
           D+  +  ++ EV  +  +K    +  Y  S+   ++L       ++++EYCA G L   +
Sbjct: 62  DEDEVEDVQREVQFLASMKQVPNITQYYGSYLKDTTL-------WIIIEYCAGGSLRTLL 114

Query: 121 NTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSV 180
                 ++ E  +  IM ++   +  +H  +  +IHRD+K  NVLI+ DG  K+CDFG  
Sbjct: 115 R---PGKIDEKYIGVIMRELLIALKFIH--RDNVIHRDLKAANVLITNDGQVKLCDFGVA 169

Query: 181 CGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCY 240
             +        + N  +H +    T  + +PE+I    G+  D K DIW+LG+  Y+   
Sbjct: 170 AQL-------NQSNSRRHTMAG--TPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEAAT 218

Query: 241 YTTPF--EKAGEVAILHSKFQFPAYP--QYSDQLKNLISALLRENPMQRPNICQLL 292
              P+   +A     L +K + P      YS  LK  I+  L E+P +R +  +LL
Sbjct: 219 GNPPYCEVEALRAMQLITKSKPPRLEGRSYSPLLKEFIALCLDEDPKERLSAEELL 274

>Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON}
            similar to Ashbya gossypii ABR014W
          Length = 1122

 Score = 80.9 bits (198), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 73/271 (26%), Positives = 128/271 (47%), Gaps = 38/271 (14%)

Query: 31   GGFAHIYSA-EISPPDPNSSSIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYID 89
            G    +Y+A EI      ++S+A +K++ +  +P    +  E+  MK  K HK +V++ID
Sbjct: 845  GASGGVYTAYEIG----TNASVA-IKQMNLEKQPKKELIINEILVMKGSK-HKNIVNFID 898

Query: 90   SHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHA 149
            S+  K  L       +++MEY   G L D +   +   L E ++  +  +  +G+  +H+
Sbjct: 899  SYLLKGDL-------WVVMEYMEGGSLTDVVTHCI---LTEGQIAAVSRETLRGLHFLHS 948

Query: 150  LQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYR 209
                +IHRDIK +N+L+S DGN K+ DFG  C  I       E N  +  ++   T  + 
Sbjct: 949  --KGVIHRDIKSDNILLSMDGNIKLTDFG-FCAQI------NESNLKRTTMVG--TPYWM 997

Query: 210  SPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQ 269
            +PE++      P   K DIW+LG+ + ++     P+     +  L+        P+  D 
Sbjct: 998  APEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALY-LIATNGTPKLKDA 1053

Query: 270  ------LKNLISALLRENPMQRPNICQLLAE 294
                  LK  ++  L  NP  R    +LL++
Sbjct: 1054 GSLSSVLKRFLNWCLHVNPENRATAVELLSD 1084

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
           (REAL)
          Length = 1526

 Score = 80.9 bits (198), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 66/234 (28%), Positives = 113/234 (48%), Gaps = 39/234 (16%)

Query: 68  LRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNR 127
           +  E+  MKL+ +H  V++  +    KS       E++L++EY   G L D++ +R   +
Sbjct: 161 IEREIVIMKLI-SHANVMALFEVWENKS-------ELYLVLEYVDGGELFDYLVSR--GK 210

Query: 128 LKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISE-DGNFKVCDFGSVCGVIRP 186
           L E E +    Q+ +GV+  H+    + HRD+K EN+L+ + +   K+ DFG +  +  P
Sbjct: 211 LPEREAIHYFKQIVEGVSYCHSFN--ICHRDLKPENLLLDKKNKKIKIADFG-MAALELP 267

Query: 187 PKNPQELNYVQHDILKNTTA--QYRSPEMI--DLYRGLPVDEKSDIWALGVFLYKLCYYT 242
            K           +LK +     Y SPE++    Y G P    SD+W+ G+ L+ L    
Sbjct: 268 NK-----------LLKTSCGSPHYASPEIVMGRPYHGGP----SDVWSCGIVLFALLTGH 312

Query: 243 TPFE----KAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLL 292
            PF     K   + +   K+Q P     S + +NLIS +L  +P +R    ++L
Sbjct: 313 LPFNDDNIKKLLLKVQSGKYQMPM--NLSLEARNLISKILVIDPEKRITTQEIL 364

>KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 872

 Score = 80.5 bits (197), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 66/261 (25%), Positives = 121/261 (46%), Gaps = 40/261 (15%)

Query: 46  PNSSSIACLKRVLVPDKPSLN-SLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEV 104
           P   +I  ++R  +P        +  E++A+K L  H  +V        +  L N  Y +
Sbjct: 69  PKQVAIKLIRRDTIPKNSEKEVKIYREINALKHLN-HPNIVRL------EEVLQNSKY-I 120

Query: 105 FLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENV 164
            +++EY + G    ++  +   RLKE    ++ +Q+  GV  MH+    L+HRD+K+EN+
Sbjct: 121 GIVLEYASGGEFYKYIQKK--RRLKESAACRLFAQLISGVYYMHSKG--LVHRDLKLENL 176

Query: 165 LISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQ--YRSPEMIDLYRGLPV 222
           L+ ++ N  + DFG V   +  P+N         +++K +     Y +PE++   R    
Sbjct: 177 LLDKNENLLITDFGFVNEFL--PEN---------ELMKTSCGSPCYAAPELVVTARPYEA 225

Query: 223 DEKSDIWALGVFLYKLCYYTTPFEKAGE-----------VAILHSKFQFPAYPQYSDQLK 271
             K+DIW+ GV +Y +     P++   E             I  +  +FP Y   +   +
Sbjct: 226 -RKADIWSCGVIMYAMLAGYLPWDDDPENPDGDDIGKLYRYITRTPLKFPDY--IAPVPR 282

Query: 272 NLISALLRENPMQRPNICQLL 292
           +L+ A+L  +P +R  I Q L
Sbjct: 283 DLLRAILVADPKKRITIAQTL 303

>Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa]
           {ON} YDR507C (REAL)
          Length = 1136

 Score = 80.5 bits (197), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 63/227 (27%), Positives = 106/227 (46%), Gaps = 36/227 (15%)

Query: 68  LRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNR 127
           +  E+  MKLL  H  V+   D     + L       +L++EY  +G L + +  R    
Sbjct: 78  IEREIIIMKLLN-HPNVLRLYDVWETNADL-------YLVLEYAEKGELFNLLVER--GP 127

Query: 128 LKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPP 187
           L E E ++   Q+  GV+  HAL   ++HRD+K EN+L+    N K+ DFG         
Sbjct: 128 LPENEAIRFFRQIIIGVSYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMAAL----- 180

Query: 188 KNPQELNYVQHDILKNTTA--QYRSPEMIDLYRGLPVDE-KSDIWALGVFLYKLCYYTTP 244
                    +  +L+ +     Y +PE++    G+P     SD+W+ GV L+ L     P
Sbjct: 181 -------ETEGKLLETSCGSPHYAAPEIVS---GIPYQGFASDVWSCGVILFALLTGRLP 230

Query: 245 F-EKAGEVAIL-----HSKFQFPAYPQYSDQLKNLISALLRENPMQR 285
           F E+ G +  L       +F+ P+  + S + ++LIS +L  +P +R
Sbjct: 231 FDEEDGNIRTLLLKVQKGEFELPSDDEISREAQDLISRILTVDPERR 277

>ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} similar
           to uniprot|P34244 Saccharomyces cerevisiae YKL101W HSL1
           Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints associates with the
           assembled septin filament required along with Hsl7p for
           bud neck recruitment phosphorylation and degradation of
           Swe1p
          Length = 1616

 Score = 80.9 bits (198), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 110/234 (47%), Gaps = 39/234 (16%)

Query: 68  LRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNR 127
           +  E+  MKL+ +H  ++   +    KS       E++L++EY   G L D++ +R   +
Sbjct: 189 IEREIVIMKLI-SHSNILGLYEVWENKS-------ELYLVLEYVDGGELFDYLVSR--GK 238

Query: 128 LKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISE-DGNFKVCDFGSVCGVIRP 186
           L E E +    Q+ QGV+  H+    + HRD+K EN+L+ + + + K+ DFG        
Sbjct: 239 LGEREAVHYFKQIVQGVSYCHSFN--ICHRDLKPENLLLDKKNKSIKIADFGMAAL---- 292

Query: 187 PKNPQELNYVQHDILKNTTA--QYRSPEMI--DLYRGLPVDEKSDIWALGVFLYKLCYYT 242
                    V + +L+ +     Y SPE++    Y G P    SD+W+ G+ L+ L    
Sbjct: 293 --------EVSNKLLQTSCGSPHYASPEIVMGRPYHGGP----SDVWSCGIILFALLTGH 340

Query: 243 TPFE----KAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLL 292
            PF     K   + +   KF  P     S + K+L+S +L  NP +R    ++L
Sbjct: 341 LPFNDDNIKKLLLKVQSGKFHMPQ--NLSAEAKDLMSKILVVNPFKRIATEEIL 392

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR507C
           (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score = 80.5 bits (197), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 65/232 (28%), Positives = 104/232 (44%), Gaps = 38/232 (16%)

Query: 71  EVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKE 130
           E+  MKLL  H  V+   D       L       ++++EY  +G L + +  R    L E
Sbjct: 78  EIIIMKLLN-HPNVLRLYDVWETAQDL-------YMVLEYVEKGELFNLLVQR--GPLPE 127

Query: 131 FEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNP 190
            E ++   Q+  G++  HAL   ++HRD+K EN+L+    N K+ DFG            
Sbjct: 128 NEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKLADFGMAA--------- 176

Query: 191 QELNYVQHDILKNTTA---QYRSPEMIDLYRGLPVDE-KSDIWALGVFLYKLCYYTTPF- 245
                   D L  T+     Y +PE++    GLP    +SD+W+ GV LY L     PF 
Sbjct: 177 ----LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALLTGRLPFD 229

Query: 246 EKAGEV-----AILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLL 292
           E+ G +      +   K++ P   + S + ++LI  +L   P QR    ++L
Sbjct: 230 EEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREIL 281

>Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {ON}
            similar to Ashbya gossypii ACR281C
          Length = 1325

 Score = 80.5 bits (197), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 85/181 (46%), Gaps = 25/181 (13%)

Query: 115  GLIDFMN-TRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFK 173
            G ID  +   L+  + E+E   +  Q++ GV  +H     ++HRDIK ENV++   G  K
Sbjct: 1157 GSIDLFDLIELKTNMTEYEAKLLFKQITSGVKHLH--DNGIVHRDIKDENVIVDNKGCVK 1214

Query: 174  VCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMI--DLYRGLPVDEKSDIWAL 231
            + DFGS   V R P           D+   T   Y +PE++  D Y G P     DIWA+
Sbjct: 1215 LIDFGSAAYVKRGP----------FDVFVGTI-DYAAPEVLEGDPYEGKP----QDIWAI 1259

Query: 232  GVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRP---NI 288
            GV LY + Y   PF    E  IL    +       S++   LI+ +L  +  +RP   +I
Sbjct: 1260 GVLLYTIIYKENPFYNVDE--ILDGDLRINPSVIVSEECVALITMVLDRSLSKRPTVDDI 1317

Query: 289  C 289
            C
Sbjct: 1318 C 1318

>Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {ON}
           YHL007C (STE20) - serine/threonine protein kinase
           [contig 55] FULL
          Length = 955

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 70/270 (25%), Positives = 127/270 (47%), Gaps = 36/270 (13%)

Query: 31  GGFAHIYSA-EISPPDPNSSSIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYID 89
           G    +Y+A E+      ++S+A +K++ +  +P    +  E+  MK  K H  +V++ID
Sbjct: 676 GASGGVYTAYEVG----TNASVA-IKQMNLEKQPKKELIINEILVMKASK-HANIVNFID 729

Query: 90  SHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHA 149
           S+  +  L       +++MEY   G L D +   +   L E ++  +  +  +G+  +H+
Sbjct: 730 SYLLRGDL-------WVVMEYMEGGSLTDVVTHCI---LTEGQIGAVSRETLKGLQFLHS 779

Query: 150 LQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYR 209
               +IHRDIK +NVL+S  G  K+ DFG  C  I       E+N  +  ++   T  + 
Sbjct: 780 --KGVIHRDIKSDNVLLSMSGEIKLTDFG-FCAQI------NEINLKRTTMVG--TPYWM 828

Query: 210 SPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILH-----SKFQFPAYP 264
           +PE++      P   K DIW+LG+ + ++     P+     +  L+        +     
Sbjct: 829 APEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPELKDAD 885

Query: 265 QYSDQLKNLISALLRENPMQRPNICQLLAE 294
             SD LK+ +   L  NP +R    QLL++
Sbjct: 886 SLSDDLKSFLGWCLHVNPDERATASQLLSD 915

>NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {ON}
           Anc_2.496
          Length = 909

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 69/274 (25%), Positives = 122/274 (44%), Gaps = 42/274 (15%)

Query: 31  GGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDS 90
           G    +Y A     D +++    +K++ +  +P    +  E+  MK  K H  +V++IDS
Sbjct: 636 GASGGVYIAN----DVSTNESIAIKQMNLEKQPKKELIINEILVMKGSK-HPNIVNFIDS 690

Query: 91  HAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHAL 150
           +     L       +++MEY   G L D +   +   L E ++  +  +   G+  +H+ 
Sbjct: 691 YLLDGDL-------WVIMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLSGLQFLHS- 739

Query: 151 QPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTA---- 206
              ++HRDIK +N+L+S +GN K+ DFG  C              V    LK TT     
Sbjct: 740 -KGVLHRDIKSDNILLSINGNIKLTDFG-FCA------------QVNETTLKRTTMVGTP 785

Query: 207 QYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILH-----SKFQFP 261
            + +PE++      P   K DIW+LG+ + ++     P+     +  L+        +  
Sbjct: 786 YWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPELK 842

Query: 262 AYPQYSDQLKNLISALLRENPMQRPNICQLLAEV 295
              + SD LK+ +   L  NP QR +  +LL +V
Sbjct: 843 EREKLSDVLKHFLDWCLSVNPDQRASATELLEDV 876

>ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507C
          Length = 1189

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 75/261 (28%), Positives = 119/261 (45%), Gaps = 48/261 (18%)

Query: 36  IYSAEISPPDPNSSSIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKS 95
           I+SA+ +P    +SSIA       PD P    +  E+  MKLL  H  V+   D      
Sbjct: 55  IFSAKTAP---GNSSIAAS----TPD-PLPYGIEREIIIMKLLN-HPNVLRLYDVWETNP 105

Query: 96  SLNNGSYEVFLLMEYCARGGLIDFMNTRLQNR-LKEFEVLKIMSQVSQGVAAMHALQPPL 154
           SL       ++++EY  +G L + +   ++N  L E E +    Q+  GV+  HAL   +
Sbjct: 106 SL-------YMVLEYAEKGELFNLL---VENGPLPENEAVCFFRQIIIGVSYCHALG--I 153

Query: 155 IHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTA---QYRSP 211
           +HRD+K EN+L+  D N K+ DFG                    D L  T+     Y +P
Sbjct: 154 VHRDLKPENLLLDHDLNIKIADFGMAA-------------LETEDKLLETSCGSPHYAAP 200

Query: 212 EMIDLYRGLPVDE-KSDIWALGVFLYKLCYYTTPF-EKAGEV-----AILHSKFQFPAYP 264
           E++    G+P     SDIW+ GV  + L     PF E+ G +      +   KF+ P   
Sbjct: 201 EIVS---GIPYHGFASDIWSCGVIFFALLTGRLPFDEEDGNIRNLLLKVQSGKFEMPDDD 257

Query: 265 QYSDQLKNLISALLRENPMQR 285
           + S + ++L++ +L  +P  R
Sbjct: 258 EISPEAQDLLAKILTVDPECR 278

>AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL100W
           (PKH2) and YDR490C (PKH1)
          Length = 1033

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/195 (29%), Positives = 96/195 (49%), Gaps = 20/195 (10%)

Query: 104 VFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIEN 163
           ++ L+EY   G  +  M  +    L E       +Q+   +  +H  +  +IHRD+K EN
Sbjct: 276 LYFLLEYAPNGDFLSVM--KRFGTLSEECTKYYGAQILDAIHHLH--KQGIIHRDVKPEN 331

Query: 164 VLISEDGNFKVCDFGSVCGVIRPPKN-PQELNYVQHDILKNTTAQYRSPEMI-DLYRGLP 221
           +L+ +    K+ DFG+   + R  +N P +LN      +   TA+Y SPE++ D Y    
Sbjct: 332 ILLDKTMKIKLTDFGTAKLIGREDENKPYDLNTRSKSFV--GTAEYVSPELLNDNY---- 385

Query: 222 VDEKSDIWALGVFLYKLCYYTTPFEKAGEV----AILHSKFQFPA-YPQYSDQLKNLISA 276
           VD + DIWA G  L+++     PF+   E      ++  ++ F A +P     L++LI  
Sbjct: 386 VDSRCDIWAFGCILFQMVAGKPPFKATNEYLTFQKVMRVQYAFTAGFPMI---LRDLIKQ 442

Query: 277 LLRENPMQRPNICQL 291
           LL + P QR  I Q+
Sbjct: 443 LLVKKPEQRLTILQI 457

>TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {ON}
           Anc_2.496 YHL007C
          Length = 915

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 71/276 (25%), Positives = 133/276 (48%), Gaps = 40/276 (14%)

Query: 28  LTSGGFAHIYSA-EISPPDPNSSSIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVS 86
           +  G    +Y+A E+      ++S+A +K++ +  +P    +  E+  MK  K H+ +V+
Sbjct: 629 IGQGASGGVYTAYEVG----TNASVA-IKQMNLEKQPKKELIINEILVMKGSK-HQNIVN 682

Query: 87  YIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAA 146
           +IDS+  K  L       +++MEY   G L D +   +   L E ++  +  +  +G+  
Sbjct: 683 FIDSYVLKGDL-------WVVMEYMEGGSLTDVVTHCI---LTEAQIGAVCRETLRGLQF 732

Query: 147 MHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTA 206
           +H+    +IHRDIK +N+L+S +G  K+ DFG  C  I       E+N  +  ++   T 
Sbjct: 733 LHS--KGVIHRDIKSDNILLSMNGEIKLTDFG-FCAQI------NEINLKRTTMVG--TP 781

Query: 207 QYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILH-------SKFQ 259
            + +PE++      P   K DIW+LG+ + ++     P+     +  L+        K +
Sbjct: 782 YWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLK 838

Query: 260 FPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEV 295
            P     S +LK+ ++  L  NP  R +  +LL +V
Sbjct: 839 EPEV--LSPELKSFLAWCLNVNPDTRASATELLRDV 872

>TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8.279
           YLR096W
          Length = 1126

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 101/219 (46%), Gaps = 44/219 (20%)

Query: 101 SYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIK 160
           S   ++L EY + G L+D++       L+E    K    ++  +  +HA    ++HRD+K
Sbjct: 174 SNHFYMLFEYVSGGQLLDYIIQ--HGSLREHHARKFTRGIASALQYLHANN--IVHRDLK 229

Query: 161 IENVLISEDGNFKVCDFG------------SVCGVIRPPKNPQELNYVQHDILKNTTAQY 208
           IEN++IS  G  K+ DFG            + CG          L +   ++LK   + Y
Sbjct: 230 IENIMISTSGEIKIIDFGLSNLFDKSKQLHTFCG---------SLYFAAPELLK--ASPY 278

Query: 209 RSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSKFQFP--AYPQY 266
             PE+             D+W+ GV LY L     PF+     ++LH K +     YPQ+
Sbjct: 279 TGPEV-------------DVWSFGVVLYVLVCGKVPFDDENS-SVLHEKIKQGKVEYPQH 324

Query: 267 -SDQLKNLISALLRENPMQRPNICQLLAEVSRIQGVPCP 304
            S ++ +L+S +L  +P +R ++ Q++     ++G   P
Sbjct: 325 LSIEVISLLSKMLVVDPHRRASLKQVVEHHWMVRGYDGP 363

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa]
           {ON} YDR507C (REAL)
          Length = 1135

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/227 (27%), Positives = 105/227 (46%), Gaps = 36/227 (15%)

Query: 68  LRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNR 127
           +  E+  MKLL  H  V+   D     + L       +L++EY  +G L + +  R    
Sbjct: 78  IEREIIIMKLLN-HPNVLRLYDVWETNTDL-------YLVLEYAEKGELFNLLVER--GP 127

Query: 128 LKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPP 187
           L E E ++   Q+  GV+  HAL   ++HRD+K EN+L+    N K+ DFG         
Sbjct: 128 LPENEAIRFFRQIIIGVSYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMAAL----- 180

Query: 188 KNPQELNYVQHDILKNTTA--QYRSPEMIDLYRGLPVDE-KSDIWALGVFLYKLCYYTTP 244
                    +  +L+ +     Y +PE++    G+P     SD+W+ GV L+ L     P
Sbjct: 181 -------ETEGKLLETSCGSPHYAAPEIVS---GIPYQGFASDVWSCGVILFALLTGRLP 230

Query: 245 F-EKAGEVAIL-----HSKFQFPAYPQYSDQLKNLISALLRENPMQR 285
           F E+ G +  L       +F+ P+  + S + ++LI  +L  +P +R
Sbjct: 231 FDEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRR 277

>KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {ON}
           Anc_8.668 YPL150W
          Length = 879

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 69/263 (26%), Positives = 110/263 (41%), Gaps = 74/263 (28%)

Query: 9   YPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNSSSIACLKRVL-VPDKPSLNS 67
           + S  ++ VG++  RI+K +  G F  +Y A   P           K VL   DK   N 
Sbjct: 30  FMSDELIEVGNY--RILKQIGEGSFGKVYLALHRPTHR--------KVVLKTSDKNDPNI 79

Query: 68  LRA-----EVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNT 122
           +R      + D   + K ++ +V+                +V++ +EYC    L D +  
Sbjct: 80  VREVFYHRQFDYPYITKVYEIIVT--------------ETKVWMALEYCPGKELYDHL-- 123

Query: 123 RLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFG---- 178
               R+   E  ++ +Q+   V   H+L    +HRD+K+EN+L+ + G  K+ DFG    
Sbjct: 124 LFSKRIPIAECTELFAQIVGAVYYAHSLN--CVHRDLKLENILLDKHGRAKLTDFGFTRE 181

Query: 179 --------SVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDL--YRGLPVDEKSDI 228
                   +VCG                      T  Y +PE+I+   Y G  +    DI
Sbjct: 182 CMTRSTLETVCG----------------------TTVYMAPELIERKSYDGFKI----DI 215

Query: 229 WALGVFLYKLCYYTTPFEKAGEV 251
           WALGV LY + Y   PF++  EV
Sbjct: 216 WALGVILYTMIYGAMPFDEDDEV 238

>Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {ON}
           YDR490C (REAL)
          Length = 756

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 91/199 (45%), Gaps = 15/199 (7%)

Query: 104 VFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIEN 163
           ++ L+EY + G  +  +  +    L E       SQ+   V ++HA+   +IHRDIK EN
Sbjct: 199 LYFLLEYASHGDFLGLI--KKYGSLNEKCARYYASQIIDAVDSLHAIG--IIHRDIKPEN 254

Query: 164 VLISEDGNFKVCDFGSVCGVIRPPKNPQE----LNYVQHDILKNTTAQYRSPEMI-DLYR 218
           +L+ +D   K+ DFG+   +   P N  +     +          TA+Y SPE++ D Y 
Sbjct: 255 ILLDKDMKVKLTDFGTAKILPEQPSNNADGKPCFDLYARSKSFVGTAEYVSPELLNDSY- 313

Query: 219 GLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHS--KFQFPAYPQYSDQLKNLISA 276
               D + DIWA G  LY++     PF+ A E        K Q+     +    K+L+  
Sbjct: 314 ---TDSRCDIWAFGCILYQMVAGKPPFKAANEYLTFQKVMKIQYAFTAGFPLIAKDLVKK 370

Query: 277 LLRENPMQRPNICQLLAEV 295
           LL   P  R  + Q+ A V
Sbjct: 371 LLVREPNDRLTVEQIKAHV 389

>KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1117

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 75/288 (26%), Positives = 130/288 (45%), Gaps = 43/288 (14%)

Query: 9   YPSGTVLTVGS-HKARIIKYLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLNS 67
           +  G  L +GS  K ++    T+G  A I     S  + NS+  + L     PD      
Sbjct: 18  WKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLT---TPDALPY-G 73

Query: 68  LRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNR 127
           +  E+  MKLL  H  V+   D     S+L       ++++EY  +G L + +  +    
Sbjct: 74  IEREIIIMKLLN-HPNVLRLYDVWETNSNL-------YMVLEYAEKGELFNLLVEK--GP 123

Query: 128 LKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPP 187
           L+E E ++   Q+  G++  HAL   ++HRD+K EN+L+    N K+ DFG         
Sbjct: 124 LQEQEAIRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKYNIKIADFGMAA------ 175

Query: 188 KNPQELNYVQHDILKNTTA---QYRSPEMIDLYRGLPVDE-KSDIWALGVFLYKLCYYTT 243
                      D L  T+     Y +PE++    G+P     SD+W+ GV L+ L     
Sbjct: 176 -------LETEDKLLETSCGSPHYAAPEIVS---GIPYHGFASDVWSCGVILFALLTGRL 225

Query: 244 PF-EKAGEV-----AILHSKFQFPAYPQYSDQLKNLISALLRENPMQR 285
           PF E+ G +      +   +F+ P+  + S + ++L++ +L  +P +R
Sbjct: 226 PFDEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKR 273

>Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (REAL)
          Length = 1356

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 79/177 (44%), Gaps = 22/177 (12%)

Query: 115  GLIDFMN-TRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFK 173
            G ID  +    +  + EFE   I  QV  G+  +H     ++HRDIK ENV++   G  K
Sbjct: 1188 GCIDLFDLIEFKTNMTEFEAKLIFKQVVAGIKHLH--DQGIVHRDIKDENVIVDSKGFVK 1245

Query: 174  VCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMI--DLYRGLPVDEKSDIWAL 231
            + DFGS   V   P           D+   T   Y +PE++  + Y G P     DIWA+
Sbjct: 1246 IIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGNPYEGQP----QDIWAI 1290

Query: 232  GVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNI 288
            G+ LY + +   PF    E  IL    +F    + S+    LI ++L      RP I
Sbjct: 1291 GILLYTVVFKENPFYNIDE--ILEGDLKFNNAEEVSEDCIELIKSILNRRVPNRPTI 1345

>KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1432

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 65/234 (27%), Positives = 111/234 (47%), Gaps = 39/234 (16%)

Query: 68  LRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNR 127
           +  E+  MKL+ +H+ V+   +    K+ L       FL++EY   G L D++ ++   +
Sbjct: 162 IEREIVIMKLI-SHRNVMGLFEVWENKNDL-------FLVLEYVDGGELFDYLVSK--GK 211

Query: 128 LKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNF-KVCDFGSVCGVIRP 186
           L E+E +    Q+ +GVA  H+    + HRD+K EN+L+ +     K+ DFG +  +  P
Sbjct: 212 LPEWEAVHYFKQIIEGVAFCHSYN--ICHRDLKPENLLLDKKNKIIKIADFG-MAALELP 268

Query: 187 PKNPQELNYVQHDILKNTTA--QYRSPEMI--DLYRGLPVDEKSDIWALGVFLYKLCYYT 242
            K           +L+ +     Y SPE++    Y G P    SD+W+ G+ L+ L    
Sbjct: 269 NK-----------LLETSCGSPHYASPEIVMGKPYHGGP----SDVWSCGIILFALLTGH 313

Query: 243 TPFEKAGEVAIL----HSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLL 292
            PF       +L      +F+ P     S + ++LI+ +L  NP QR  I  +L
Sbjct: 314 LPFNDDNIRKLLLKVQSGRFRLPR--NISLEAQDLIAKILVVNPRQRIKISDIL 365

>TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.654
           YPL141C
          Length = 622

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 69/273 (25%), Positives = 131/273 (47%), Gaps = 43/273 (15%)

Query: 31  GGFAHIYSAEISPPDPNSSSIACLKR-VLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYID 89
           G ++H+         P   +I  ++R  L   K S   L  E++A+K+L  H  +V    
Sbjct: 94  GNYSHM---------PKQVAIKLIRRDTLSASKESEIKLYREINALKML-THPNIVK--- 140

Query: 90  SHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHA 149
               +  L N  Y + +++EY + G    ++  + + RLKE +   I +Q+  GV+ +H+
Sbjct: 141 ---LEEVLQNSKY-IGIVLEYASGGEFYKYI--KFKKRLKESKACTIFAQLISGVSYIHS 194

Query: 150 LQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYR 209
               L+HRD+K+EN+L+ + GN  + DFG V  V +        N + H      +  Y 
Sbjct: 195 --KGLVHRDLKLENLLLDKAGNLLITDFGFVNEVTK-------TNKLMHTPCG--SPCYA 243

Query: 210 SPEMIDLYRGLPVD-EKSDIWALGVFLYKLCYYTTPFE------KAGEVAILHSKF--QF 260
           +PE++      P +  K+DIW+ GV LY +     P++         ++  L+     Q 
Sbjct: 244 APELVTSVE--PYNARKADIWSCGVILYAMLAGYLPWDDDPKNINGTDIVKLYKYIENQP 301

Query: 261 PAYPQYSDQL-KNLISALLRENPMQRPNICQLL 292
             +P+Y + + ++L+  +L  +P +R ++  +L
Sbjct: 302 LKFPEYINMVPRDLLRRMLEIDPAKRMSMKHIL 334

>TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON}
           Anc_8.140 YGL179C
          Length = 1038

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 68/226 (30%), Positives = 104/226 (46%), Gaps = 42/226 (18%)

Query: 101 SYEVFLLMEYCARGGLI----DFMNTRLQNR-LKEFE-VLKIMSQVSQGVAAMHALQPPL 154
           S +++L++EYC+RG +     D M T  +   L  F+ V KI+  V+ G+  +H+    +
Sbjct: 220 SKKIYLILEYCSRGEVKWCPGDVMETEARGPPLLSFQRVRKILRDVTLGLEYLHSR--GI 277

Query: 155 IHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNT--TAQYRSPE 212
           IHRDIK  N+L+SEDG+ K+ DFG    VI   K     N +    L  T  T  + +PE
Sbjct: 278 IHRDIKPANLLLSEDGSVKISDFG--VSVISHNKEENGTNSIDELELAKTAGTPAFFAPE 335

Query: 213 M---------IDLYRGLPVDEK----SDIWALGVFLYKLCYYTTPFEKAGEVAILHSKFQ 259
           +          +L +    D K     D+WALG  LY L +   PF    E+ +      
Sbjct: 336 ICLGSEAKSKFNLKKDPSKDSKLIYMVDVWALGTTLYCLLFGMLPFISDYELKLFEKIVN 395

Query: 260 FP-AYPQYS----------------DQLKNLISALLRENPMQRPNI 288
            P  +P Y                 +  KN++  LL +NP +R +I
Sbjct: 396 DPLIFPDYEIMQKNGTSNIFSEEEYEAAKNILKELLTKNPAKRMSI 441

>NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52
          Length = 1022

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 106/228 (46%), Gaps = 38/228 (16%)

Query: 68  LRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNR 127
           +  E+  MKLL+ H  V+S  D     S L       ++++EY  +G L + +  R    
Sbjct: 77  IEREIIIMKLLR-HPNVLSLYDVWETNSKL-------YMILEYAEKGELFNLLVER--GP 126

Query: 128 LKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPP 187
           L E E ++   Q+  G++  HAL   ++HRD+K EN+L+    N K+ DFG         
Sbjct: 127 LPEKEAIRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKLNIKIADFGMAA------ 178

Query: 188 KNPQELNYVQHDILKNTTA---QYRSPEMIDLYRGLPVDE-KSDIWALGVFLYKLCYYTT 243
                      D +  T+     Y +PE++    G+P    +SD+W+ GV L+ L     
Sbjct: 179 -------LETKDKMLETSCGSPHYAAPEIVS---GVPYHGFQSDVWSCGVILFALLTGRL 228

Query: 244 PF-EKAGEV-----AILHSKFQFPAYPQYSDQLKNLISALLRENPMQR 285
           PF E+ G +      +   +++ P   + S + ++LI  +L  +P QR
Sbjct: 229 PFDEEDGNIRNLLLKVQSGEYEMPDDDEISKEAQDLIGRILTVDPEQR 276

>TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.668
           YPL150W
          Length = 988

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/208 (27%), Positives = 100/208 (48%), Gaps = 49/208 (23%)

Query: 103 EVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIE 162
           +V++ +EYC    L + +  RL  R+   E  ++ +Q+S  +   H+L    +HRD+K+E
Sbjct: 102 KVWMALEYCPGKELYEHL-LRLH-RIPVDECSRLFAQISGAMYYAHSLN--CVHRDLKLE 157

Query: 163 NVLISEDGNFKVCDFG------------SVCGVIRPPKNPQELNYVQHDILKNTTAQYRS 210
           N+L+ + GN K+ DFG            ++CG                      T  Y +
Sbjct: 158 NILLDKVGNAKLTDFGFTRECASKNILETICG----------------------TTVYMA 195

Query: 211 PEMI--DLYRGLPVDEKSDIWALGVFLYKLCYYTTPFE----KAGEVAILHSKFQFPAYP 264
           PE+I  + Y G  +    D+W+LGV LY L     PF+    K  E  I++    F +  
Sbjct: 196 PELIKRERYDGFKI----DVWSLGVILYTLLNGFMPFDEEQQKNTEWKIVNEMPSFDSTL 251

Query: 265 QYSDQLKNLISALLRENPMQRPNICQLL 292
              D + +L+S LL ++P+ RP++ ++L
Sbjct: 252 LGPDAV-DLLSKLLAKDPIDRPSMKEVL 278

>YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One of two
            (see also PSK2) PAS domain containing S/T protein
            kinases; coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1356

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 80/177 (45%), Gaps = 22/177 (12%)

Query: 115  GLIDFMN-TRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFK 173
            G ID  +    +  + EFE   I  QV  G+  +H     ++HRDIK ENV++   G  K
Sbjct: 1188 GCIDLFDLIEFKTNMTEFEAKLIFKQVVAGIKHLH--DQGIVHRDIKDENVIVDSKGFVK 1245

Query: 174  VCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMI--DLYRGLPVDEKSDIWAL 231
            + DFGS   V   P           D+   T   Y +PE++  + Y G P     DIWA+
Sbjct: 1246 IIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGNPYEGQP----QDIWAI 1290

Query: 232  GVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNI 288
            G+ LY + +   PF    E  IL    +F    + S+    LI ++L     +RP I
Sbjct: 1291 GILLYTVVFKENPFYNIDE--ILEGDLKFNNAEEVSEDCIELIKSILNRCVPKRPTI 1345

>YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON}
           GIN4Protein kinase involved in bud growth and assembly
           of the septin ring, proposed to have kinase-dependent
           and kinase-independent activities; undergoes
           autophosphorylation; similar to Kcc4p and Hsl1p
          Length = 1142

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/227 (27%), Positives = 105/227 (46%), Gaps = 36/227 (15%)

Query: 68  LRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNR 127
           +  E+  MKLL  H  V+   D     + L       +L++EY  +G L + +  R    
Sbjct: 78  IEREIIIMKLLN-HPNVLRLYDVWETNTDL-------YLVLEYAEKGELFNLLVER--GP 127

Query: 128 LKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPP 187
           L E E ++   Q+  GV+  HAL   ++HRD+K EN+L+    N K+ DFG         
Sbjct: 128 LPEHEAIRFFRQIIIGVSYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMAAL----- 180

Query: 188 KNPQELNYVQHDILKNTTA--QYRSPEMIDLYRGLPVDE-KSDIWALGVFLYKLCYYTTP 244
                    +  +L+ +     Y +PE++    G+P     SD+W+ GV L+ L     P
Sbjct: 181 -------ETEGKLLETSCGSPHYAAPEIVS---GIPYQGFASDVWSCGVILFALLTGRLP 230

Query: 245 F-EKAGEVAIL-----HSKFQFPAYPQYSDQLKNLISALLRENPMQR 285
           F E+ G +  L       +F+ P+  + S + ++LI  +L  +P +R
Sbjct: 231 FDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERR 277

>Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {ON}
           YDR490C (PKH1) - Ser/Thr protein kinase [contig 184]
           FULL
          Length = 984

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 94/201 (46%), Gaps = 32/201 (15%)

Query: 104 VFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQ----------PP 153
           ++ L+EY   G   DF++           V+K    +SQ  A  ++ Q            
Sbjct: 232 LYFLLEYAPNG---DFLS-----------VIKKFGSLSQECAVYYSAQILDAIDYLHHKG 277

Query: 154 LIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEM 213
           ++HRDIK EN+L+ +D   K+ DFG+   ++   +  Q  N ++       TA+Y SPE+
Sbjct: 278 IVHRDIKPENILLDKDMKVKLTDFGT-ARILEKDETTQTFNLLERSKSFVGTAEYVSPEL 336

Query: 214 I-DLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHS--KFQFPAYPQYSDQL 270
           + D Y    VD K DIWA G  L+++     PF+   E        K Q+     +   +
Sbjct: 337 LNDNY----VDYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLVI 392

Query: 271 KNLISALLRENPMQRPNICQL 291
           ++LI  +L ++P QR +  Q+
Sbjct: 393 RDLIKKILVKSPEQRLDASQI 413

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 72/241 (29%), Positives = 111/241 (46%), Gaps = 41/241 (17%)

Query: 63  PSLNS--LRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFM 120
           PS NS  +  E+  MKL+ +H  V+   +    KS       E++L++EY   G L D++
Sbjct: 139 PSNNSYGIEREIVIMKLI-SHPNVMGLYEVWENKS-------ELYLVLEYVDGGELFDYL 190

Query: 121 NTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGN-FKVCDFGS 179
            +R   +L E E +    Q+ QGVA  HA    + HRD+K EN+L+ +     K+ DFG 
Sbjct: 191 VSR--GKLPEREAVHYFKQIIQGVAYCHAFN--ICHRDLKPENLLLDKKNKIIKIADFGM 246

Query: 180 VCGVIRPPKNPQELNYVQHDILKNTTA---QYRSPEMI--DLYRGLPVDEKSDIWALGVF 234
               +              D L +T+     Y SPE++    Y G P    +D+W+ G+ 
Sbjct: 247 AALEVS-------------DKLLSTSCGSPHYASPEIVMGKSYHGSP----TDVWSCGII 289

Query: 235 LYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSD---QLKNLISALLRENPMQRPNICQL 291
           L+ L     PF     +  L  K Q   Y   SD     K+LIS +L  +P +R    ++
Sbjct: 290 LFALLTGHLPFNH-DNIKKLLLKVQSGVYHMPSDLSPDAKDLISKILVVDPDKRLTTTEI 348

Query: 292 L 292
           L
Sbjct: 349 L 349

>Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 619

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 118/249 (47%), Gaps = 34/249 (13%)

Query: 52  ACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYC 111
             +K++ +  +P    +  E+  MK  K H  +V++IDS+  K  L       +++MEY 
Sbjct: 355 VAIKQMNLEKQPKKELIINEILVMKGSK-HSNIVNFIDSYLLKGDL-------WVVMEYM 406

Query: 112 ARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGN 171
             G L D +   +   L E ++  +  +  +G+  +H+    +IHRDIK +N+L+S +G+
Sbjct: 407 EGGSLTDVVTHCI---LTEGQIGAVCRETLKGLQFLHS--KGVIHRDIKSDNILLSMNGD 461

Query: 172 FKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWAL 231
            K+ DFG  C  I       E+N  +  ++   T  + +PE++      P   K DIW+L
Sbjct: 462 IKLTDFG-FCAQIN------EVNLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSL 509

Query: 232 GVFLYKLCYYTTPFEKAGEVAILH-------SKFQFPAYPQYSDQLKNLISALLRENPMQ 284
           G+ + ++     P+     +  L+        K + P     SD LK  +   L+ +P  
Sbjct: 510 GIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKDPE--NLSDTLKEFLGWCLKVDPED 567

Query: 285 RPNICQLLA 293
           R N  +LL+
Sbjct: 568 RANAAELLS 576

>Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL101W
           (REAL)
          Length = 1518

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 65/234 (27%), Positives = 112/234 (47%), Gaps = 39/234 (16%)

Query: 68  LRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNR 127
           +  E+  MKL+ +H  V++  +    KS       E++L++EY   G L D++ ++   +
Sbjct: 161 IEREIVIMKLI-SHANVMALFEVWENKS-------ELYLVLEYVDGGELFDYLVSK--GK 210

Query: 128 LKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDG-NFKVCDFGSVCGVIRP 186
           L E E +    Q+ +GV+  H+    + HRD+K EN+L+ +     K+ DFG +  +  P
Sbjct: 211 LPEREAIHYFKQIVEGVSFCHSFN--ICHRDLKPENLLLDKKNRKIKIADFG-MAALELP 267

Query: 187 PKNPQELNYVQHDILKNTTA--QYRSPEMI--DLYRGLPVDEKSDIWALGVFLYKLCYYT 242
            K           +LK +     Y SPE++    Y G P    SD+W+ G+ L+ L    
Sbjct: 268 NK-----------LLKTSCGSPHYASPEIVMGRPYHGGP----SDVWSCGIVLFALLTGH 312

Query: 243 TPFE----KAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLL 292
            PF     K   + +   K+Q P     S + ++LIS +L  NP +R    ++L
Sbjct: 313 LPFNDDNIKKLLLKVQSGKYQMPM--NLSAEARDLISKILVINPEKRITTQEIL 364

>Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {ON}
           YDR466W - Hypothetical ORF [contig 196] FULL
          Length = 621

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 78/275 (28%), Positives = 131/275 (47%), Gaps = 37/275 (13%)

Query: 28  LTSGGFAHIYSA-EISPPDPNSSSIACLKRVLVPDKPSLNSLRAEVDAMKLLK--AHKFV 84
           L  G ++ +Y A E S    N +   C K+ ++ +K  +  +  E D + +L    H  +
Sbjct: 16  LGQGSYSTVYRAVERSNSGRNYAIKVCSKKHIIREK-KVKYVTIEKDLLNMLAKGGHLGI 74

Query: 85  VSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGV 144
           V    +     +L       + ++EY + G L+  +  RL  RL E     I +Q+   V
Sbjct: 75  VKLFCTFHDIENL-------YFVLEYVSGGELLALIQ-RL-GRLTEDLSRHITAQLVDTV 125

Query: 145 AAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSVC-GVIRPPKNPQE-LNYVQHDILK 202
             MH+    +IHRD+K ENVL+S++G   + DFG+ C    R  +N +   ++V      
Sbjct: 126 DYMHS--KGVIHRDLKPENVLLSQEGRVVITDFGAACTAADRKFENTKRTASFVG----- 178

Query: 203 NTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGE------VAILHS 256
             TA+Y SPE++ L+        SDIWALG  +Y+L     PF    E      +  L  
Sbjct: 179 --TAEYVSPELL-LHSQCGFS--SDIWALGCIIYQLNQGKPPFRGENELQTFEKIVALDY 233

Query: 257 KFQFPAYPQYSDQLKNLISALLRENPMQRPNICQL 291
           K+ F   P    Q+ +++ ++L  +P++RP+  QL
Sbjct: 234 KWLFSNSP----QVVSIVQSILVTDPLKRPSAAQL 264

>SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar to
           uniprot|Q751V1 Ashbya gossypii AFR724C AFR724Cp and some
           similarites with YDR523C uniprot|P08458 Saccharomyces
           cerevisiae YDR523C SPS1 dispensable for mitosis involved
           in middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 564

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 69/268 (25%), Positives = 124/268 (46%), Gaps = 33/268 (12%)

Query: 31  GGFAHIYSAEISPPDPNSSSIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDS 90
           G F  +Y A I     N+ +I  +      D+  L  L  E+  +  L +  ++ +Y  +
Sbjct: 43  GNFGDVYKA-IDKSTGNTVAIKVVNLEETDDEIDL--LAQEIYFLAELHS-PYITNYFST 98

Query: 91  HAAKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHAL 150
                S+       +++MEYC  G   D +    +  L E +V  I  ++ +G+  +H+ 
Sbjct: 99  FVEDVSM-------WIVMEYCGGGSCSDLLKCLPRGTLTEEKVAFITREILRGLEYLHSQ 151

Query: 151 QPPLIHRDIKIENVLISEDGNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRS 210
           +   IHRDIK  N+L+++DG  K+ DFG V G        Q +   + D    T   + +
Sbjct: 152 RK--IHRDIKAANILLTDDGKVKLGDFG-VSG--------QMMATRRRDTFVGTPF-WMA 199

Query: 211 PEMIDLYRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHSKFQFPAY------P 264
           PE+I        +EK+DIW+LG+ +++L     P  +   + +L S    P+        
Sbjct: 200 PEVIARSE-QGYNEKADIWSLGITVFELLKGQPPLSQHDPMKVLMS---IPSRRPPKLED 255

Query: 265 QYSDQLKNLISALLRENPMQRPNICQLL 292
           +YS  ++  +S  L ++P +RP   +LL
Sbjct: 256 RYSHAIREFVSLCLNKDPAKRPTASELL 283

>NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {ON}
            Anc_7.86
          Length = 1382

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/183 (29%), Positives = 83/183 (45%), Gaps = 22/183 (12%)

Query: 115  GLIDFMN-TRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFK 173
            G ID  +    +  + EFE   I  Q+  G+  +H     ++HRDIK ENV++   G  K
Sbjct: 1214 GCIDLFDLIEFKTNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGCVK 1271

Query: 174  VCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMI--DLYRGLPVDEKSDIWAL 231
            + DFGS   V   P           D+   T   Y +PE++  + Y G P     DIWA+
Sbjct: 1272 IIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLSGEPYEGKP----QDIWAI 1316

Query: 232  GVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQL 291
            G+ LY + +   PF    E  IL  + +F      S+    LI  +L  +  +RP I ++
Sbjct: 1317 GILLYTIVFKENPFYNIDE--ILEGELKFNNSNDISEDCIELIKKILIRSVPKRPLIEEI 1374

Query: 292  LAE 294
              +
Sbjct: 1375 FND 1377

>Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {ON}
           YDR490C (REAL)
          Length = 764

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 93/201 (46%), Gaps = 19/201 (9%)

Query: 104 VFLLMEYCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIEN 163
           ++ L+EY   G  +  +  +    L E       SQ+   V ++H +   +IHRDIK EN
Sbjct: 198 LYFLLEYAPHGDFLALI--KKYGSLNEQCARYYASQIIDAVDSLHTIG--IIHRDIKPEN 253

Query: 164 VLISEDGNFKVCDFGSVCGVIRPPKNPQ------ELNYVQHDILKNTTAQYRSPEMI-DL 216
           +L+ +D   K+ DFG+   +   P N        +LN      +   TA+Y SPE++ D 
Sbjct: 254 ILLDKDMKVKLTDFGTAKILPEEPSNDADGKPCFDLNARSKSFV--GTAEYVSPELLNDS 311

Query: 217 YRGLPVDEKSDIWALGVFLYKLCYYTTPFEKAGEVAILHS--KFQFPAYPQYSDQLKNLI 274
           Y     D + DIWA G  L+++     PF+ + E        K Q+     +   +K+L+
Sbjct: 312 Y----TDSRCDIWAFGCILFQMVAGKPPFKASNEYLTFQKVMKIQYAFTAGFPQIIKDLV 367

Query: 275 SALLRENPMQRPNICQLLAEV 295
             LL + P  R  I Q+ A +
Sbjct: 368 KKLLVKEPNDRLTIEQIKAHI 388

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.129    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 87,160,995
Number of extensions: 4099848
Number of successful extensions: 41172
Number of sequences better than 10.0: 2756
Number of HSP's gapped: 36907
Number of HSP's successfully gapped: 3109
Length of query: 791
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 673
Effective length of database: 39,950,811
Effective search space: 26886895803
Effective search space used: 26886895803
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)