Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E07700g2.285ON71271237730.0
KLTH0G10340g2.285ON70870730180.0
Kwal_27.115372.285ON70870630090.0
Ecym_33242.285ON70668629750.0
NCAS0G038002.285ON72671429160.0
ADL216C2.285ON70568029130.0
ZYRO0A01870g2.285ON70770529090.0
Smik_14.3102.285ON70669228870.0
CAGL0J03454g2.285ON69369928860.0
TDEL0G021602.285ON71470428820.0
YNL021W (HDA1)2.285ON70666728790.0
Suva_14.3262.285ON70669428730.0
NDAI0G006502.285ON68968128700.0
Skud_14.3082.285ON70669128670.0
KLLA0E08383g2.285ON70466828390.0
KNAG0H020102.285ON69369328110.0
KAFR0H033202.285ON70270127000.0
Kpol_1039.322.285ON65965626330.0
TPHA0C033902.285ON70166825500.0
TBLA0B069502.285ON79544319500.0
Kpol_1003.372.285ON57829512951e-171
TPHA0H003208.153ON4503633642e-36
KAFR0C029208.153ON4533563623e-36
Kpol_246.58.153ON4533563581e-35
TDEL0B045808.153ON4463563543e-35
NCAS0B054808.153ON4513563526e-35
TBLA0D021408.153ON4563433527e-35
NDAI0B027108.153ON4533513464e-34
KLTH0E06446g8.153ON4493553455e-34
SAKL0H25124g8.153ON4483613446e-34
KLLA0F09119g8.153ON4523323447e-34
AFR172C8.153ON4493333438e-34
YGL194C (HOS2)8.153ON4523303431e-33
CAGL0A03322g8.153ON4503563421e-33
KNAG0G013508.153ON4513373412e-33
Kpol_1038.113.8ON4333263402e-33
Smik_7.798.153ON4523303402e-33
Kwal_55.221423.8ON4323443374e-33
Skud_7.798.153ON4523293384e-33
TBLA0I005603.8ON4333263365e-33
Suva_14.113.8ON4333263366e-33
NCAS0C043203.8ON4343263366e-33
Skud_14.113.8ON4333263359e-33
KLLA0E01981g3.8ON4323263349e-33
AGR395W3.8ON4333263341e-32
NDAI0G037403.8ON4333263341e-32
Ecym_20103.8ON4333263341e-32
ZYRO0C03498g3.8ON4333263331e-32
SAKL0C13706g3.8ON4333263331e-32
KLTH0F19668g3.8ON4323263331e-32
TPHA0A003003.8ON4333263332e-32
KNAG0A011603.8ON4333263322e-32
Suva_7.718.153ON4523293313e-32
CAGL0B01441g3.8ON4333263303e-32
Kwal_55.207908.153ON4493513314e-32
Ecym_23468.153ON4853333324e-32
ZYRO0G19316g8.153ON4483363295e-32
KAFR0A086303.8ON4333263295e-32
Smik_14.23.8ON4333263271e-31
YNL330C (RPD3)3.8ON4333263261e-31
TDEL0A002703.8ON4333263224e-31
TDEL0C050403.362ON4541822062e-16
CAGL0D01430g3.362ON4452672053e-16
Suva_16.3963.362ON4771772028e-16
KLTH0F10582g3.362ON4741761992e-15
Skud_16.3533.362ON4711761956e-15
TBLA0B023903.362ON5791771922e-14
SAKL0B07854g3.362ON4892291912e-14
ZYRO0C16390g3.362ON4361781902e-14
ADL265W8.607ON6943061923e-14
Kpol_376.153.362ON5181761903e-14
YPR068C (HOS1)3.362ON4701771893e-14
TDEL0A055208.607ON6743731904e-14
KNAG0H006303.362ON4562321875e-14
Kwal_23.37243.362ON4732021876e-14
KLLA0B09394g3.362ON4411761866e-14
NCAS0A111803.362ON4902031877e-14
NDAI0A051203.362ON5082361877e-14
Smik_16.3093.362ON4701761867e-14
Ecym_82908.607ON7093811807e-13
KAFR0H008903.362ON4742091788e-13
ADL339W3.362ON4372841724e-12
KLTH0D09592g8.607ON7053761718e-12
Kpol_479.68.607ON6883391718e-12
SAKL0H08338g8.607ON6903741672e-11
Ecym_34653.362ON4451781652e-11
Suva_16.1948.607ON6993321673e-11
YPL116W (HOS3)8.607ON6973331673e-11
ZYRO0F10780g8.607ON6683321654e-11
Smik_6.3158.607ON6971371646e-11
TBLA0E040808.607ON6942981637e-11
Kwal_26.85058.607ON7083801621e-10
KAFR0H027908.607ON7171021611e-10
TPHA0M015903.362ON4942721564e-10
KLLA0F00858g8.607ON7151381566e-10
Skud_16.1648.607ON6973331549e-10
NDAI0E024808.607ON6842961512e-09
KNAG0J013008.607ON6773381503e-09
CAGL0J06974g8.607ON6783301493e-09
NCAS0C017608.607ON7001341476e-09
TPHA0A011208.607ON698991451e-08
Smik_16.2238.78ON1226116790.74
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E07700g
         (712 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly...  1457   0.0  
KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {...  1167   0.0  
Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021...  1163   0.0  
Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}...  1150   0.0  
NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON}             1127   0.0  
ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON} S...  1126   0.0  
ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {...  1125   0.0  
Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021...  1116   0.0  
CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa] ...  1116   0.0  
TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {O...  1114   0.0  
YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putat...  1113   0.0  
Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021...  1111   0.0  
NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {O...  1110   0.0  
Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021...  1108   0.0  
KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly...  1098   0.0  
KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.2...  1087   0.0  
KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.2...  1044   0.0  
Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON} (99859...  1018   0.0  
TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {O...   986   0.0  
TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa] ...   755   0.0  
Kpol_1003.37 s1003 complement(91621..92301,92861..92869,92912..9...   503   e-171
TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}...   144   2e-36
KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {O...   144   3e-36
Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON} (11759..13...   142   1e-35
TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {O...   140   3e-35
NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa] ...   140   6e-35
TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {O...   140   7e-35
NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153    137   4e-34
KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {...   137   5e-34
SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} high...   137   6e-34
KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly...   137   7e-34
AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON} S...   136   8e-34
YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}  ...   136   1e-33
CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly...   136   1e-33
KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.1...   135   2e-33
Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {O...   135   2e-33
Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}...   135   2e-33
Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL3...   134   4e-33
Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}...   134   4e-33
TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8...   134   5e-33
Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}...   134   6e-33
NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8      134   6e-33
Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}...   133   9e-33
KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {...   133   9e-33
AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic ...   133   1e-32
NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {O...   133   1e-32
Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON} s...   133   1e-32
ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly...   132   1e-32
SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} high...   132   1e-32
KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} high...   132   1e-32
TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}...   132   2e-32
KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON} A...   132   2e-32
Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}...   132   3e-32
CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {...   131   3e-32
Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {...   132   4e-32
Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}...   132   4e-32
ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} high...   131   5e-32
KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3...   131   5e-32
Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON} YN...   130   1e-31
YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}  R...   130   1e-31
TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}...   128   4e-31
TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {O...    84   2e-16
CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} simila...    84   3e-16
Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {...    82   8e-16
KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} simila...    81   2e-15
Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {...    80   6e-15
TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.3...    79   2e-14
SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {...    78   2e-14
ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]...    78   2e-14
ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic ho...    79   3e-14
Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}...    78   3e-14
YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON} ...    77   3e-14
TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {O...    78   4e-14
KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.3...    77   5e-14
Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C...    77   6e-14
KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} simila...    76   6e-14
NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa] ...    77   7e-14
NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON} Anc_3...    77   7e-14
Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {...    76   7e-14
Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}...    74   7e-13
KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.3...    73   8e-13
ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic ho...    71   4e-12
KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {...    70   8e-12
Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON} ...    70   8e-12
SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} simila...    69   2e-11
Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar t...    68   2e-11
Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116...    69   3e-11
YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}  HOS3Trich...    69   3e-11
ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {...    68   4e-11
Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON...    68   6e-11
TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa] ...    67   7e-11
Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {O...    67   1e-10
KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {O...    67   1e-10
TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {...    65   4e-10
KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON...    65   6e-10
Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116...    64   9e-10
NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.6...    63   2e-09
KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8....    62   3e-09
CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highl...    62   3e-09
NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.6...    61   6e-09
TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.6...    60   1e-08
Smik_16.223 Chr16 (406804..410484) [3681 bp, 1226 aa] {ON} YPL01...    35   0.74 

>SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 712

 Score = 1457 bits (3773), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 699/712 (98%), Positives = 699/712 (98%)

Query: 1   MTESTATVTGNDSAVEVKMEDSLKRKVDTMEDEVESRKRSTGTLPVIVPEVPPRIHYTQL 60
           MTESTATVTGNDSAVEVKMEDSLKRKVDTMEDEVESRKRSTGTLPVIVPEVPPRIHYTQL
Sbjct: 1   MTESTATVTGNDSAVEVKMEDSLKRKVDTMEDEVESRKRSTGTLPVIVPEVPPRIHYTQL 60

Query: 61  KTGLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGE 120
           KTGLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGE
Sbjct: 61  KTGLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGE 120

Query: 121 LMLKIPVREATAEEILQVHTKEHLAFLEKTPKMTREQLLKETETGDSVYFNNDSLLSAKL 180
           LMLKIPVREATAEEILQVHTKEHLAFLEKTPKMTREQLLKETETGDSVYFNNDSLLSAKL
Sbjct: 121 LMLKIPVREATAEEILQVHTKEHLAFLEKTPKMTREQLLKETETGDSVYFNNDSLLSAKL 180

Query: 181 SCGGAIEACKAVVEGRVKNALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESV 240
           SCGGAIEACKAVVEGRVKNALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESV
Sbjct: 181 SCGGAIEACKAVVEGRVKNALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESV 240

Query: 241 RRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFN 300
           RRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFN
Sbjct: 241 RRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFN 300

Query: 301 CNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYG 360
           CNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYG
Sbjct: 301 CNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYG 360

Query: 361 HMTHMLKSLARGNLCVVLEGGYNLDSIAKSALGVAKILIGEPPDELPHPTQQPKPEAIET 420
           HMTHMLKSLARGNLCVVLEGGYNLDSIAKSALGVAKILIGEPPDELPHPTQQPKPEAIET
Sbjct: 361 HMTHMLKSLARGNLCVVLEGGYNLDSIAKSALGVAKILIGEPPDELPHPTQQPKPEAIET 420

Query: 421 IETVIRTQSKYWNCFKSTHSNDGCNFKEEVTESTISKNFPXXXXXXXXXXXXXSEKFGFV 480
           IETVIRTQSKYWNCFKSTHSNDGCNFKEEVTESTISKNFP             SEKFGFV
Sbjct: 421 IETVIRTQSKYWNCFKSTHSNDGCNFKEEVTESTISKNFPLQQAIRQEQLQQLSEKFGFV 480

Query: 481 TLPLLNMEVPQDTVICSPNIYDAETVVVCVHDTPEIWAQRNPITGTIDPSTSIIVDTTLD 540
           TLPLLNMEVPQDTVICSPNIYDAETVVVCVHDTPEIWAQRNPITGTIDPSTSIIVDTTLD
Sbjct: 481 TLPLLNMEVPQDTVICSPNIYDAETVVVCVHDTPEIWAQRNPITGTIDPSTSIIVDTTLD 540

Query: 541 IIKWSLQRKYSVIDVNIPQSLFEQDNYSAMITSQEVLVYIWDNYLKYFPSLAKVAFIGVG 600
           IIKWSLQRKYSVIDVNIPQSLFEQDNYSAMITSQEVLVYIWDNYLKYFPSLAKVAFIGVG
Sbjct: 541 IIKWSLQRKYSVIDVNIPQSLFEQDNYSAMITSQEVLVYIWDNYLKYFPSLAKVAFIGVG 600

Query: 601 DAYSGIVHLLGHRDTRSVVKAAVSFVDTKPLKSLVPLVDESLGNWYFKNSLVFTSKNHSC 660
           DAYSGIVHLLGHRDTRSVVKAAVSFVDTKPLKSLVPLVDESLGNWYFKNSLVFTSKNHSC
Sbjct: 601 DAYSGIVHLLGHRDTRSVVKAAVSFVDTKPLKSLVPLVDESLGNWYFKNSLVFTSKNHSC 660

Query: 661 WGTDGNENKKPRKRFGRVLKCDTTGMNNIVEERFQEATDFILDSFEEWSDSE 712
           WGTDGNENKKPRKRFGRVLKCDTTGMNNIVEERFQEATDFILDSFEEWSDSE
Sbjct: 661 WGTDGNENKKPRKRFGRVLKCDTTGMNNIVEERFQEATDFILDSFEEWSDSE 712

>KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 708

 Score = 1167 bits (3018), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/707 (76%), Positives = 616/707 (87%), Gaps = 10/707 (1%)

Query: 14  AVEVKMEDSLKRKVDTMEDEVESRKRSTGT--------LPVIVPEVPPRIHYTQLKTGLC 65
           + EVK E+    +++ ++ + ES   + GT         P IVP   P++HYT LKTGLC
Sbjct: 4   SAEVKQEEP-SEQINGLKRDHESATLNDGTGNQASVAKRPTIVPACRPKLHYTPLKTGLC 62

Query: 66  YDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKI 125
           YDVRMRYHAKI+TSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSGVD IG+LMLKI
Sbjct: 63  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKI 122

Query: 126 PVREATAEEILQVHTKEHLAFLEKTPKMTREQLLKETETGDSVYFNNDSLLSAKLSCGGA 185
           PVREAT EEILQVHTKEHL F+ KT  MTR+QLLKETE GDSVYFNNDS LSAKLSCGGA
Sbjct: 123 PVREATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDSYLSAKLSCGGA 182

Query: 186 IEACKAVVEGRVKNALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMI 245
           IEACKAVVEGRVKNALAV+RPPGHHAEPE+AGGFCLFSNVAVAAQNILKNYPESVR+IM+
Sbjct: 183 IEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMV 242

Query: 246 LDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIPW 305
           LDWD+HHGNGTQKAFY D+RVLY+SLHR+ELGKYYPGT+HGN ++ GEGKGEGFNCNIPW
Sbjct: 243 LDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPW 302

Query: 306 PYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHM 365
           P+ G+GD+EY+WAF+QV+MPMGREF+PDLVIISSGFDAADGDT+GQCHV+PSCYGHMTHM
Sbjct: 303 PWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHM 362

Query: 366 LKSLARGNLCVVLEGGYNLDSIAKSALGVAKILIGEPPDELPHPTQQPKPEAIETIETVI 425
           LKSLARGNLC VLEGGY+LDSIAKSAL VAK+LIGEPPDELP   +QPK EA+E I++VI
Sbjct: 363 LKSLARGNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDELP-VVKQPKLEAVEVIDSVI 421

Query: 426 RTQSKYWNCFKSTHSNDGCNFKEEVTESTISKNFPXXXXXXXXXXXXXSEKFGFVTLPLL 485
           +TQSKYW CFKSTH NDGC+FKE+ T++ I+KNFP             + +F FVTLPL 
Sbjct: 422 KTQSKYWKCFKSTHGNDGCSFKEQATDTAINKNFPLQNAIRQQQMRLLANEFRFVTLPLF 481

Query: 486 NMEVPQDTVICSPNIYDAETVVVCVHDTPEIWAQRNPITGTIDPSTSIIVDTTLDIIKWS 545
             E+P DT ICSPNIYDA  ++VCVHDTP IWAQR+  TGTIDPSTSIIVDTTLD+IKW+
Sbjct: 482 KKELPDDTAICSPNIYDASAIIVCVHDTPSIWAQRSRATGTIDPSTSIIVDTTLDVIKWA 541

Query: 546 LQRKYSVIDVNIPQSLFEQDNYSAMITSQEVLVYIWDNYLKYFPSLAKVAFIGVGDAYSG 605
             R Y VID+NIPQSL EQDNYSA+IT+QEVLV+IWDNYLKYFPSL +VAF+ +GDA+SG
Sbjct: 542 SSRNYGVIDINIPQSLHEQDNYSAVITAQEVLVHIWDNYLKYFPSLNRVAFVAIGDAHSG 601

Query: 606 IVHLLGHRDTRSVVKAAVSFVDTKPLKSLVPLVDESLGNWYFKNSLVFTSKNHSCWGTDG 665
           +VHLLGHRDTRSVVK+AVSFVD +PL+ L+PLVDE+L +WYFKNSLVF S  H+CWG DG
Sbjct: 602 VVHLLGHRDTRSVVKSAVSFVDQRPLRPLIPLVDETLADWYFKNSLVFASAEHTCWGNDG 661

Query: 666 NENKKPRKRFGRVLKCDTTGMNNIVEERFQEATDFILDSFEEWSDSE 712
           NENKKPRK+FGRVLKCD+ G+NNI+EERF+EATDFILD+FEEWSDSE
Sbjct: 662 NENKKPRKKFGRVLKCDSDGINNILEERFEEATDFILDTFEEWSDSE 708

>Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021W
           (HDA1) - histone deacetylase, shares sequence similarity
           with Rpd3p, Hos1p, Hos2p, and Hos3p [contig 27] FULL
          Length = 708

 Score = 1163 bits (3009), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/706 (76%), Positives = 620/706 (87%), Gaps = 8/706 (1%)

Query: 14  AVEVKMEDSLKR----KVDTMEDEVESRKRSTGT---LPVIVPEVPPRIHYTQLKTGLCY 66
           AV +K EDSLK+    K D     +E     + T    PVIVP    ++HYT LKTGLCY
Sbjct: 4   AVGIKQEDSLKQENGFKRDAENALLEEENGGSETKVKRPVIVPACRAKLHYTPLKTGLCY 63

Query: 67  DVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIP 126
           DVRMRYHAKI+TSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSGVD+IG+LMLKIP
Sbjct: 64  DVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKIP 123

Query: 127 VREATAEEILQVHTKEHLAFLEKTPKMTREQLLKETETGDSVYFNNDSLLSAKLSCGGAI 186
            REAT EEILQVHT EHL FL KT  MTREQLLKETE GDSVYFNNDS LSAKLSCGGAI
Sbjct: 124 AREATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEKGDSVYFNNDSYLSAKLSCGGAI 183

Query: 187 EACKAVVEGRVKNALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMIL 246
           EAC+AVVEGRVKNALAV+RPPGHHAEP++AGGFCLFSNVAVAAQNILKNYPESV++IMIL
Sbjct: 184 EACRAVVEGRVKNALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMIL 243

Query: 247 DWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIPWP 306
           DWD+HHGNGTQKAFY+D+RVLYVSLHR+ELGKYYPGT+HGN ++ GEGKGEGFNCNIPWP
Sbjct: 244 DWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIPWP 303

Query: 307 YGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHML 366
           + G+GDAEY+WAF+QVV+PMGREFQPDLVIISSGFDAADGDT+GQCHV+PSCYGHMTHML
Sbjct: 304 WKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHML 363

Query: 367 KSLARGNLCVVLEGGYNLDSIAKSALGVAKILIGEPPDELPHPTQQPKPEAIETIETVIR 426
           KSLARGN+C VLEGGY+LDSIAKSALGVAK+LIGEPPDELP   +QPKPEA+E I+ VI+
Sbjct: 364 KSLARGNICAVLEGGYSLDSIAKSALGVAKVLIGEPPDELP-VVKQPKPEAVEVIDAVIK 422

Query: 427 TQSKYWNCFKSTHSNDGCNFKEEVTESTISKNFPXXXXXXXXXXXXXSEKFGFVTLPLLN 486
            QS+YW CFKSTH+NDGC+FKE VTE+ +++NFP             + ++ FVTLPL+ 
Sbjct: 423 MQSRYWQCFKSTHANDGCSFKEPVTETLLNRNFPLQTAIRQQQVRLLTTEYNFVTLPLIK 482

Query: 487 MEVPQDTVICSPNIYDAETVVVCVHDTPEIWAQRNPITGTIDPSTSIIVDTTLDIIKWSL 546
            E+P DT +CSPNIYD+++++VCVHDTPEIWAQR+  TGTIDPSTSIIVDTTLD+IKW+ 
Sbjct: 483 KELPDDTALCSPNIYDSQSIIVCVHDTPEIWAQRSRATGTIDPSTSIIVDTTLDVIKWAS 542

Query: 547 QRKYSVIDVNIPQSLFEQDNYSAMITSQEVLVYIWDNYLKYFPSLAKVAFIGVGDAYSGI 606
           +R Y VID+NIPQSL EQDNYSA++T+QEVLVYIWD+YLKYF SL+KVAF+ +GDAYSG+
Sbjct: 543 KRNYGVIDINIPQSLHEQDNYSAVLTAQEVLVYIWDSYLKYFTSLSKVAFVSIGDAYSGV 602

Query: 607 VHLLGHRDTRSVVKAAVSFVDTKPLKSLVPLVDESLGNWYFKNSLVFTSKNHSCWGTDGN 666
           VHLLGHRDTR+VVKAA+SF+D +PL+ LVPLVDESL +WYFKNSLVF S  H+CWG DG 
Sbjct: 603 VHLLGHRDTRNVVKAAISFIDQRPLRPLVPLVDESLADWYFKNSLVFASAGHTCWGNDGA 662

Query: 667 ENKKPRKRFGRVLKCDTTGMNNIVEERFQEATDFILDSFEEWSDSE 712
           ENKKPRK+FGRVLKC++ G+NNI+EERF+EATDFILD+FEEWSDSE
Sbjct: 663 ENKKPRKKFGRVLKCNSDGLNNILEERFEEATDFILDTFEEWSDSE 708

>Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}
           similar to Ashbya gossypii ADL216C
          Length = 706

 Score = 1150 bits (2975), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 528/686 (76%), Positives = 605/686 (88%)

Query: 27  VDTMEDEVESRKRSTGTLPVIVPEVPPRIHYTQLKTGLCYDVRMRYHAKIYTSYFEYIDP 86
           V+ M+  V     +    P+IVP V P+IHY  LKTGLCYDVRMRYHAKI+TSYFEYIDP
Sbjct: 21  VENMKTAVSKLTVAQQKRPIIVPVVKPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDP 80

Query: 87  HPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPVREATAEEILQVHTKEHLAF 146
           HPEDPRRIYRIYKILAENGLI DPTLSGVD+IG LMLKIP+REAT +EIL VH+KEH+ F
Sbjct: 81  HPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPIREATEDEILLVHSKEHVEF 140

Query: 147 LEKTPKMTREQLLKETETGDSVYFNNDSLLSAKLSCGGAIEACKAVVEGRVKNALAVIRP 206
           L+ T  M+REQLLKETE GDSVY+NNDSL+SAKLSCGGAIEACKAVVEGRVKNALAV+RP
Sbjct: 141 LKTTNTMSREQLLKETEAGDSVYYNNDSLVSAKLSCGGAIEACKAVVEGRVKNALAVVRP 200

Query: 207 PGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMILDWDIHHGNGTQKAFYSDNRV 266
           PGHHAEPE+AGGFCLFSNVAVAA+NILKNYPESVR++MILDWDIHHGNGTQ+AFY+DNRV
Sbjct: 201 PGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRV 260

Query: 267 LYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPM 326
           LYVSLHRYELG+YYPGT +GNY Q+GEGKGEGFNCNIPW  GG+GDAEYMWAF+Q+V+PM
Sbjct: 261 LYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPM 320

Query: 327 GREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDS 386
           GREFQPDLVIISSGFDAADGDTIGQCHVSP+CYGHMTHMLKSLA+GN+CVVLEGGYNLDS
Sbjct: 321 GREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTHMLKSLAKGNMCVVLEGGYNLDS 380

Query: 387 IAKSALGVAKILIGEPPDELPHPTQQPKPEAIETIETVIRTQSKYWNCFKSTHSNDGCNF 446
           IAKSALGV K+LIGEPPDELP P +QPKPEAI TIETVIR Q+KYW+CFKS H N G N+
Sbjct: 381 IAKSALGVVKVLIGEPPDELPDPFKQPKPEAIATIETVIREQAKYWDCFKSKHGNCGVNW 440

Query: 447 KEEVTESTISKNFPXXXXXXXXXXXXXSEKFGFVTLPLLNMEVPQDTVICSPNIYDAETV 506
           KE V ES   KNFP             S+++ FVTLPLL+ME+  DT+ICSPNI++ +T+
Sbjct: 441 KEPVDESLTFKNFPLQSAVRQEQFRRLSKEYKFVTLPLLDMELSGDTIICSPNIHETDTL 500

Query: 507 VVCVHDTPEIWAQRNPITGTIDPSTSIIVDTTLDIIKWSLQRKYSVIDVNIPQSLFEQDN 566
           ++CVHDTPE+WA+RNP+TG IDPSTSIIVDTTL I  W+L R Y +ID+NIPQSLFE DN
Sbjct: 501 IICVHDTPEVWAKRNPLTGYIDPSTSIIVDTTLSITNWALGRSYGIIDINIPQSLFELDN 560

Query: 567 YSAMITSQEVLVYIWDNYLKYFPSLAKVAFIGVGDAYSGIVHLLGHRDTRSVVKAAVSFV 626
           YSA++TSQEVL Y+WD+YLK+F  L +VAF+G+GDAYSG VHLLGHRDTRS+VK A+SF 
Sbjct: 561 YSAVLTSQEVLSYLWDHYLKFFAQLTRVAFVGIGDAYSGFVHLLGHRDTRSIVKCAISFT 620

Query: 627 DTKPLKSLVPLVDESLGNWYFKNSLVFTSKNHSCWGTDGNENKKPRKRFGRVLKCDTTGM 686
           D K L+ LVPLVDES+ +WYFKNSL+FTSK HSCWGT+GN++KKPRK+FGRVLKC++ GM
Sbjct: 621 DKKQLRPLVPLVDESISDWYFKNSLIFTSKYHSCWGTEGNDSKKPRKKFGRVLKCNSDGM 680

Query: 687 NNIVEERFQEATDFILDSFEEWSDSE 712
           NNI+EERF+EATDFILDSFEEWSDSE
Sbjct: 681 NNILEERFEEATDFILDSFEEWSDSE 706

>NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON} 
          Length = 726

 Score = 1127 bits (2916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/714 (72%), Positives = 612/714 (85%), Gaps = 5/714 (0%)

Query: 2   TESTATVTGNDSAVEVKMEDSLKRKVDTMEDEVESRKRSTGTL---PVIVPEVPPRIHYT 58
           T+ +ATV    +    + + + KR +  +++E E +K+    +   PVIVP     + YT
Sbjct: 15  TKESATVLLQTNKQFTQSDTTQKRNMTAVKEEPELKKQKITDVSERPVIVPPRDAELSYT 74

Query: 59  QLKTGLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEI 118
            LKTGLCYDVRMRYHAKI+TSYFEYIDPHPEDPRRIYRIYKILAENGLI+DPTLSG+++I
Sbjct: 75  PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDI 134

Query: 119 GELMLKIPVREATAEEILQVHTKEHLAFLEKTPKMTREQLLKETETGDSVYFNNDSLLSA 178
           G+LMLKIPVR+AT EEIL+VH+KEH  F+EKT  M RE+LLK TE GDSVYFNNDS  SA
Sbjct: 135 GDLMLKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKATEKGDSVYFNNDSFASA 194

Query: 179 KLSCGGAIEACKAVVEGRVKNALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPE 238
           KL  GG+IEACKAVVEGRVKN+LAV+RPPGHHAEP+ AGGFCLFSNVA+AA+NILKNYPE
Sbjct: 195 KLPVGGSIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAIAAKNILKNYPE 254

Query: 239 SVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEG 298
           SVRRIMILDWDIHHGNGTQKAFY D+RVLY+SLHR+ELGKYYPGT++G Y+QTGEGKGEG
Sbjct: 255 SVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEG 314

Query: 299 FNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSC 358
           FNCNI WP GG+GDAEY+WAF+QVVMPM REFQPDLVIISSGFDAADGD+IGQCHV+PSC
Sbjct: 315 FNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSC 374

Query: 359 YGHMTHMLKSLARGNLCVVLEGGYNLDSIAKSALGVAKILIGEPPDELPHPTQQPKPEAI 418
           YGHMTHMLKSLA+GNLCVVLEGGYNLD+IA+SAL VAKILIGEPPDELP P + PKPEAI
Sbjct: 375 YGHMTHMLKSLAKGNLCVVLEGGYNLDAIARSALSVAKILIGEPPDELPDPLRDPKPEAI 434

Query: 419 ETIETVIRTQSKYWNCFKSTHSNDGCNFKEEVTESTISKNFPXXXXXXXXXXXXXSEKFG 478
           E I+ VIR QSKYW CFK  + N GCNFK+E+ ES ISKNFP             S+ F 
Sbjct: 435 EIIDKVIRLQSKYWKCFKRRYGNAGCNFKDEINESLISKNFPLQQAIREQQLNTLSQDFK 494

Query: 479 FVTLPLLNMEVPQDTVICSPNIYDAETVVVCVHDTPEIWAQRNPITGTIDPSTSIIVDTT 538
           F TLPLL  E+P+DTV+CSPN+Y ++TV++C HDTPEIWA+R+ I GTIDPS+SIIVD+T
Sbjct: 495 FATLPLLKPELPKDTVLCSPNVYQSKTVIICAHDTPEIWAKRDVIQGTIDPSSSIIVDST 554

Query: 539 LDIIKWSLQRKYSVIDVNIPQSLFEQDNYSAMITSQEVLVYIWDNYLKYFPSLAKVAFIG 598
           LD IKW+ ++KY VID+NIPQ+LFEQ+NYSA++TSQEVL YIWDNYLKYFP++ KVAFIG
Sbjct: 555 LDFIKWANEKKYGVIDINIPQNLFEQENYSAIVTSQEVLTYIWDNYLKYFPNVEKVAFIG 614

Query: 599 VGDAYSGIVHLLGHRDTRSVVKAAVSFVDTKPLKSLVPLVDESLGNWYFKNSLVFTSKNH 658
           +GDAYSGIVHLLGHRDTRSVVK+ ++F+  K L++LVPLVDESL +WYFKNSLVF+ K+H
Sbjct: 615 IGDAYSGIVHLLGHRDTRSVVKSVINFIAQKQLRALVPLVDESLSDWYFKNSLVFSDKSH 674

Query: 659 SCWGTDGNENKKPRKRFGRVLKCDTTGMNNIVEERFQEATDFILDSFEEWSDSE 712
           + WG    ENKKPRK++GR+L+C+T G+NNIVEERF+EATDFILDSFEEWSDSE
Sbjct: 675 TYWG--DKENKKPRKKYGRLLRCETDGINNIVEERFEEATDFILDSFEEWSDSE 726

>ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL021W
           (HDA1)
          Length = 705

 Score = 1126 bits (2913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/680 (77%), Positives = 594/680 (87%), Gaps = 3/680 (0%)

Query: 36  SRKRSTGTLPVIVPEVPPRIHYTQLKTGLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIY 95
           SRK      PVIVP V P+I Y  LKTGLCYDVRMRYHAKI+TSYFEYIDPHPEDPRRIY
Sbjct: 26  SRKAIVQKRPVIVPPVRPKISYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIY 85

Query: 96  RIYKILAENGLIRDPTLSGVDEIGELMLKIPVREATAEEILQVHTKEHLAFLEKTPKMTR 155
           RIYKILAENGLI DPTLSG+DEIGELM KIPVREAT EEIL VH+KEH+ FL+ T  M R
Sbjct: 86  RIYKILAENGLIEDPTLSGIDEIGELMQKIPVREATEEEILTVHSKEHVEFLKTTNTMDR 145

Query: 156 EQLLKETETGDSVYFNNDSLLSAKLSCGGAIEACKAVVEGRVKNALAVIRPPGHHAEPEI 215
           EQLLKETE GDSVY+NNDSL+SA+LSCGGAIEACKAVVEGRVKNA+AV+RPPGHHAEP +
Sbjct: 146 EQLLKETEAGDSVYYNNDSLISARLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHAEPGV 205

Query: 216 AGGFCLFSNVAVAAQNILKNYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYE 275
           AGGFCLFSNVAVAAQNILKNYPESVRR+MILDWDIHHGNGTQKAFY DNRVLYVSLHRYE
Sbjct: 206 AGGFCLFSNVAVAAQNILKNYPESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYE 265

Query: 276 LGKYYPGTVHGNYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLV 335
           LGKYYPGT +GNY+Q G+GKGEGFNCNIPW   G+GDAEYMWAF+QVV+PMGREFQPDLV
Sbjct: 266 LGKYYPGTSYGNYDQCGDGKGEGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLV 325

Query: 336 IISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDSIAKSALGVA 395
           IISSGFDAADGDTIGQCHVSP+CYGH+THMLKSLARGN+CVVLEGGYNLDSIAKSALGVA
Sbjct: 326 IISSGFDAADGDTIGQCHVSPACYGHLTHMLKSLARGNMCVVLEGGYNLDSIAKSALGVA 385

Query: 396 KILIGEPPDELPHPTQQPKPEAIETIET-VIRTQSKYWNCFKSTHSNDGCNFKE-EVTES 453
           K+LIGEPPDELP P +QPKPEAI TI+  +++ QSKYWNCFK  H NDG N++E  V +S
Sbjct: 386 KVLIGEPPDELPQPLKQPKPEAIVTIDMGLVKEQSKYWNCFKGRHGNDGINWREGAVNDS 445

Query: 454 TISKNFPXXXXXX-XXXXXXXSEKFGFVTLPLLNMEVPQDTVICSPNIYDAETVVVCVHD 512
             SKNFP              ++++ FVTLPLLNME+P DT+ICSPNI+  + +++CVHD
Sbjct: 446 LTSKNFPLQKCCSPTTQFRRLAKEYKFVTLPLLNMELPSDTIICSPNIHTTDAIIICVHD 505

Query: 513 TPEIWAQRNPITGTIDPSTSIIVDTTLDIIKWSLQRKYSVIDVNIPQSLFEQDNYSAMIT 572
           TPEIWAQR+ +TG IDPSTSIIVDTT+ +I W+L R Y VID+NIPQSLFEQDNYSA+++
Sbjct: 506 TPEIWAQRDSLTGHIDPSTSIIVDTTVSVINWALGRNYGVIDINIPQSLFEQDNYSAVLS 565

Query: 573 SQEVLVYIWDNYLKYFPSLAKVAFIGVGDAYSGIVHLLGHRDTRSVVKAAVSFVDTKPLK 632
           SQEV+ Y+WD+YLK FP LA+VAF+G+GDAYSG VHLLGHRDTRSVVK A++F D K L+
Sbjct: 566 SQEVVTYLWDSYLKTFPHLARVAFVGIGDAYSGFVHLLGHRDTRSVVKCAIAFADKKQLR 625

Query: 633 SLVPLVDESLGNWYFKNSLVFTSKNHSCWGTDGNENKKPRKRFGRVLKCDTTGMNNIVEE 692
            LVPLVDESLG+WYFKNSLVFTS  H CWGTDGN++KKPRK+FGRVL+    GMNNIVEE
Sbjct: 626 PLVPLVDESLGDWYFKNSLVFTSTYHPCWGTDGNDSKKPRKKFGRVLRWTCDGMNNIVEE 685

Query: 693 RFQEATDFILDSFEEWSDSE 712
           R +EATDFILDSFEEWS+SE
Sbjct: 686 RLEEATDFILDSFEEWSESE 705

>ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 707

 Score = 1125 bits (2909), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/705 (75%), Positives = 603/705 (85%), Gaps = 4/705 (0%)

Query: 8   VTGNDSAVEVKMEDSLKRKVDTMEDEVESRKRSTGTLPVIVPEVPPRIHYTQLKTGLCYD 67
           V   D   + K+E+S    V+   + V S         +IVP   P+IHYT LKTGLCYD
Sbjct: 7   VKQEDEGSKRKLEESPNGPVEKKPN-VASVSNGRQKRQIIVPACEPKIHYTPLKTGLCYD 65

Query: 68  VRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPV 127
           VRMRYHAKI+TSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSG D+IGELMLKIPV
Sbjct: 66  VRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGEDDIGELMLKIPV 125

Query: 128 REATAEEILQVHTKEHLAFLEKTPKMTREQLLKETETGDSVYFNNDSLLSAKLSCGGAIE 187
           REAT EE+LQVHTKEHL F+EKT +M RE+LLKETETGDSVYFN+DS  +AKL CGGAIE
Sbjct: 126 REATVEELLQVHTKEHLEFIEKTSQMNREELLKETETGDSVYFNSDSYSAAKLPCGGAIE 185

Query: 188 ACKAVVEGRVKNALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMILD 247
           ACKAVVEGRVKNALAVIRPPGHHAEPE+AGGFCLFSNVAVAAQNILKNYPESVRRI+ILD
Sbjct: 186 ACKAVVEGRVKNALAVIRPPGHHAEPEMAGGFCLFSNVAVAAQNILKNYPESVRRILILD 245

Query: 248 WDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIPWPY 307
           WDIHHGNGTQKAFY+D+RVLY+SLHR+ELGKYYPGT+HG Y+QTGEGKGEGFNCNI WP 
Sbjct: 246 WDIHHGNGTQKAFYNDDRVLYISLHRFELGKYYPGTIHGQYDQTGEGKGEGFNCNITWPV 305

Query: 308 GGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLK 367
           GG+GDAEYM AF+Q+VMPM RE++PDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLK
Sbjct: 306 GGVGDAEYMLAFEQIVMPMAREYRPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLK 365

Query: 368 SLARGNLCVVLEGGYNLDSIAKSALGVAKILIGEPPDELPHPTQQPKPEAIETIETVIRT 427
           SLARGNLCV LEGGYNLD+IA SAL VAKILIGEPP+ELP P++ PK EAIE I+ VI  
Sbjct: 366 SLARGNLCVALEGGYNLDAIATSALSVAKILIGEPPEELPDPSKNPKLEAIEMIDKVIHV 425

Query: 428 QSKYWNCFKSTHSNDGCNFKEEVTESTISKNFPXXXXXXXXXXXXXSEKFGFVTLPLLNM 487
           QSKYW CF+    N GCNFKE VTES I+KNFP              +++GFVTLP+  +
Sbjct: 426 QSKYWKCFRRL-GNSGCNFKEPVTESLITKNFPLQKAIRQEQFHQLEKEYGFVTLPVPKL 484

Query: 488 EVPQDTVICSPNIYDAETVVVCVHDTPEIWAQRNPITGTIDPSTSIIVDTTLDIIKWSLQ 547
           E+P+DTV+CSP+++   TV++ VHDTPEIWA+R+ ITG IDPSTSI VD+ LD IKWSL 
Sbjct: 485 ELPEDTVLCSPDVFQESTVIIFVHDTPEIWAKRDVITGMIDPSTSITVDSPLDFIKWSLA 544

Query: 548 RKYSVIDVNIPQSLFEQDNYSAMITSQEVLVYIWDNYLKYFPSLAKVAFIGVGDAYSGIV 607
           RKY VIDVNIPQSLFEQDNYSAMITSQEVL+Y+WDN++KYFPSL+KVAF+GVGDAYSGIV
Sbjct: 545 RKYGVIDVNIPQSLFEQDNYSAMITSQEVLIYLWDNFVKYFPSLSKVAFVGVGDAYSGIV 604

Query: 608 HLLGHRDTRSVVKAAVSFVDTKPLKSLVPLVDESLGNWYFKNSLVFTSKNHSCWGTDGNE 667
           HLLGHRDTRSVVKA ++FV  K LK LVPLVDESLG+WYFKNSLVF+ +N+ CW    NE
Sbjct: 605 HLLGHRDTRSVVKAVINFVGRKQLKPLVPLVDESLGDWYFKNSLVFSDRNNPCWVD--NE 662

Query: 668 NKKPRKRFGRVLKCDTTGMNNIVEERFQEATDFILDSFEEWSDSE 712
           NKKPR++FGRVL+C++ G+NN +EERF EATDFILDSFEEWSDSE
Sbjct: 663 NKKPRRKFGRVLRCESDGINNNMEERFDEATDFILDSFEEWSDSE 707

>Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1116 bits (2887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/692 (73%), Positives = 595/692 (85%), Gaps = 3/692 (0%)

Query: 22  SLKRKVD-TMEDEVESRKRSTGTLPVIVPEVPPRIHYTQLKTGLCYDVRMRYHAKIYTSY 80
           +LKR+++ T ED+      S     VIVP   P+IHY+ LKTGLCYDVRMRYHAKI+TSY
Sbjct: 17  NLKRRLEETKEDQNSLSTTSNNKRQVIVPACTPKIHYSPLKTGLCYDVRMRYHAKIFTSY 76

Query: 81  FEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPVREATAEEILQVHT 140
           FEYIDPHPEDPRRIYRIYKILAENGLI DPTLSGVD++G+LMLKIPVR AT+EEIL+VHT
Sbjct: 77  FEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHT 136

Query: 141 KEHLAFLEKTPKMTREQLLKETETGDSVYFNNDSLLSAKLSCGGAIEACKAVVEGRVKNA 200
           KEHL F+E T KM+REQLLKETE GDSVYFNNDS  SA+L CGGAIEACKAVVEGRVKN+
Sbjct: 137 KEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNS 196

Query: 201 LAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMILDWDIHHGNGTQKAF 260
           LAV+RPPGHHAEP+ AGGFCLFSNVAVAA+NILKNYPESVRRIMILDWDIHHGNGTQK+F
Sbjct: 197 LAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSF 256

Query: 261 YSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWAFQ 320
           Y D++VLYVSLHR+E+GKYYPGT+ G Y+Q GEGKGEGFNCNI WP GG+GDAEYMWAF+
Sbjct: 257 YQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNITWPVGGVGDAEYMWAFE 316

Query: 321 QVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEG 380
           QVVMPMGREF+PDLVIISSGFDAADGDTIGQCHV+PSCYGHMTHMLKSLARGNLCVVLEG
Sbjct: 317 QVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEG 376

Query: 381 GYNLDSIAKSALGVAKILIGEPPDELPHPTQQPKPEAIETIETVIRTQSKYWNCFKSTHS 440
           GYNLD+IA+SAL VAK+LIGEPPDELP  +  PKPE IE I+ VIR QSKYWNCF+  H+
Sbjct: 377 GYNLDAIARSALSVAKVLIGEPPDELPDSSSDPKPEVIEMIDKVIRLQSKYWNCFRRRHA 436

Query: 441 NDGCNFKEEVTESTISKNFPXXXXXXXXXXXXXSEKFGFVTLPLLNMEVPQDTVICSPNI 500
           N GCNF E + +S +SKNFP             S++F  VTLPL+NM++P +TV+C+PN+
Sbjct: 437 NSGCNFNEPINDSIVSKNFPLQKAIRQQQQHYLSDEFNLVTLPLINMDLPDNTVLCTPNV 496

Query: 501 YDAETVVVCVHDTPEIWAQRNPITGTIDPSTSIIVDTTLDIIKWSLQRKYSVIDVNIPQS 560
           Y++ T++V VHDT +IWA+RN I+GTID S+S+I+D  LD IKW L RKY +IDVNIP S
Sbjct: 497 YESTTLLVVVHDTSDIWAKRNVISGTIDLSSSVIIDNCLDFIKWGLDRKYGIIDVNIPLS 556

Query: 561 LFEQDNYSAMITSQEVLVYIWDNYLKYFPSLAKVAFIGVGDAYSGIVHLLGHRDTRSVVK 620
           LFE DNYS MITSQEVL+Y+WDNY+KYFP++AK+AF+G+GD+YSGIVHLLGHRDTR+V K
Sbjct: 557 LFEPDNYSGMITSQEVLIYLWDNYIKYFPAVAKIAFVGIGDSYSGIVHLLGHRDTRAVTK 616

Query: 621 AAVSFVDTKPLKSLVPLVDESLGNWYFKNSLVFTSKNHSCWGTDGNENKKPRKRFGRVLK 680
             ++F+  K LK LVPLVDE+L  WYFKNSL+F++ +H CW    NE++KPRK+FGRVL+
Sbjct: 617 TVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKE--NESRKPRKKFGRVLR 674

Query: 681 CDTTGMNNIVEERFQEATDFILDSFEEWSDSE 712
           CDT G+NN +EERF+EATDFILDSFEEWSD E
Sbjct: 675 CDTDGLNNTIEERFEEATDFILDSFEEWSDEE 706

>CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa]
           {ON} highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021w HDA1 histone deacetylase A
          Length = 693

 Score = 1116 bits (2886), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/699 (74%), Positives = 599/699 (85%), Gaps = 7/699 (1%)

Query: 14  AVEVKMEDSLKRKVDTMEDEVESRKRSTGTLPVIVPEVPPRIHYTQLKTGLCYDVRMRYH 73
            VE+K E    ++   +ED+V S+       PVIVP    +IHYT LKTG+CYDVRMRYH
Sbjct: 2   GVELKQEPGESKR--KLEDDVASQDVKR---PVIVPTRKAQIHYTPLKTGICYDVRMRYH 56

Query: 74  AKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPVREATAE 133
           AKI+TSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSGV++IG+LMLKIP+R ATAE
Sbjct: 57  AKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIRAATAE 116

Query: 134 EILQVHTKEHLAFLEKTPKMTREQLLKETETGDSVYFNNDSLLSAKLSCGGAIEACKAVV 193
           EIL+VH+KEHL F+EKT KM RE+LLKETE GDSVYFNNDS  +++L CGGAIEACKAVV
Sbjct: 117 EILEVHSKEHLEFIEKTEKMNREELLKETEKGDSVYFNNDSYATSRLPCGGAIEACKAVV 176

Query: 194 EGRVKNALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMILDWDIHHG 253
           EGRVKN+LAV+RPPGHHAEPE AGGFCLFSNVAVAA+NILKNYPESVRRI+ILDWD+HHG
Sbjct: 177 EGRVKNSLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHG 236

Query: 254 NGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIPWPYGGLGDA 313
           NGTQKAFY D+RVLY+SLHR+ELGKYYPGT+ G Y+Q GEGKG+GFNCNI WP GG+GDA
Sbjct: 237 NGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDA 296

Query: 314 EYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGN 373
           EYMWAF+QVVMPMGREFQPDLVIISSGFDAADGDTIGQCHV+PSCYGHMTHMLKSLARGN
Sbjct: 297 EYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGN 356

Query: 374 LCVVLEGGYNLDSIAKSALGVAKILIGEPPDELPHPTQQPKPEAIETIETVIRTQSKYWN 433
           LCVVLEGGYNLD+IA SAL VAKILIGEPPDELP P ++PK EA+E I+ VI  QSKYW 
Sbjct: 357 LCVVLEGGYNLDAIAISALSVAKILIGEPPDELPDPLREPKAEALEIIDKVISLQSKYWK 416

Query: 434 CFKSTHSNDGCNFKEEVTESTISKNFPXXXXXXXXXXXXXSEKFGFVTLPLLNMEVPQDT 493
           CF   + N G   +  V    +SK+FP             SE FGFVTLPLLNMEVPQD+
Sbjct: 417 CFGKRYGNLGLPSENVVKALMMSKSFPLQTAIRQEQFHQLSEDFGFVTLPLLNMEVPQDS 476

Query: 494 VICSPNIYDAETVVVCVHDTPEIWAQRNPITGTIDPSTSIIVDTTLDIIKWSLQRKYSVI 553
           VICSPN+++  T++V VHDTPEIWA+RN ITGTIDPSTS++VD+  + IKW L+RKY ++
Sbjct: 477 VICSPNLFNETTILVVVHDTPEIWAKRNVITGTIDPSTSLVVDSGAEFIKWGLERKYGIM 536

Query: 554 DVNIPQSLFEQDNYSAMITSQEVLVYIWDNYLKYFPSLAKVAFIGVGDAYSGIVHLLGHR 613
           D+NIPQSLFEQ+NY+A++TSQE+L+YIWDNYLK+FPSL KVAFIG+GDA +GIVHLLGHR
Sbjct: 537 DINIPQSLFEQENYTAVLTSQEILIYIWDNYLKFFPSLTKVAFIGIGDASAGIVHLLGHR 596

Query: 614 DTRSVVKAAVSFVDTKPLKSLVPLVDESLGNWYFKNSLVFTSKNHSCWGTDGNENKKPRK 673
           DTRSVVK+ VSF+  K LK LVPLV+ESLG+WYFKNSLVFT  +HSCWG   NEN+KPRK
Sbjct: 597 DTRSVVKSVVSFIGKKSLKPLVPLVNESLGDWYFKNSLVFTDHSHSCWGD--NENRKPRK 654

Query: 674 RFGRVLKCDTTGMNNIVEERFQEATDFILDSFEEWSDSE 712
           +FGRVL+CD  GMNNI+EER +E+TDFILDSFEEWSDSE
Sbjct: 655 KFGRVLRCDAEGMNNIIEERLEESTDFILDSFEEWSDSE 693

>TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {ON}
           Anc_2.285 YNL021W
          Length = 714

 Score = 1114 bits (2882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/704 (74%), Positives = 596/704 (84%), Gaps = 5/704 (0%)

Query: 11  NDSAVEVK--MEDSLKRKVDTMEDEVESRKRSTGTLPVIVPEVPPRIHYTQLKTGLCYDV 68
           ND+ ++VK  ME+     +D  + ++   +       VIVP   P +HYT LKT LCYDV
Sbjct: 14  NDTTLQVKRKMEEQ-NDGLDPKKSQLARTQNGAAGKRVIVPACAPNLHYTPLKTALCYDV 72

Query: 69  RMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPVR 128
           RMRYHAKI+TSYFEYIDPHPEDPRRIYR+YKILAENGLI DPTLSG+DEIG+LMLKIPVR
Sbjct: 73  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVR 132

Query: 129 EATAEEILQVHTKEHLAFLEKTPKMTREQLLKETETGDSVYFNNDSLLSAKLSCGGAIEA 188
           EAT EEIL+VH+KE+L F+E++ +M RE+LLKETE GDSVYFNNDS +SAKLSCGG I+A
Sbjct: 133 EATDEEILEVHSKENLEFVERSSRMKREELLKETEKGDSVYFNNDSYVSAKLSCGGVIDA 192

Query: 189 CKAVVEGRVKNALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMILDW 248
           CKAVVEGRVKNALAV+RPPGHHAEPE  GGFCLFSNVAVAAQNILK YPESVRRI+ILDW
Sbjct: 193 CKAVVEGRVKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDW 252

Query: 249 DIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIPWPYG 308
           DIHHGNGTQKAFY+D RVLY+SLHR+E+GKYYPGT++G Y+QTGEGKGEGFNCNI WP G
Sbjct: 253 DIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVG 312

Query: 309 GLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKS 368
           G+GDAEYM AF+Q+VMPM REFQPDLVIISSGFDAADGDTIGQCHV+PSCYG MTHMLKS
Sbjct: 313 GVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTHMLKS 372

Query: 369 LARGNLCVVLEGGYNLDSIAKSALGVAKILIGEPPDELPHPTQQPKPEAIETIETVIRTQ 428
           LARGNLCV LEGGYNLD+IA SAL VAK+LIGEPPDELP PT+ PK EAIE I+TVI TQ
Sbjct: 373 LARGNLCVALEGGYNLDAIAISALSVAKVLIGEPPDELPDPTKDPKLEAIEMIDTVIHTQ 432

Query: 429 SKYWNCFKSTHSNDGCNFKEEVTESTISKNFPXXXXXXXXXXXXXSEKFGFVTLPLLNME 488
           SKYW CF+    N GCNF E VTE+ ISK+FP             S+++GFVTLP+  +E
Sbjct: 433 SKYWKCFQRKFGNAGCNFSEPVTETVISKSFPLQTAIRQEQFRQLSKEYGFVTLPISKLE 492

Query: 489 VPQDTVICSPNIYDAETVVVCVHDTPEIWAQRNPITGTIDPSTSIIVDTTLDIIKWSLQR 548
           +P D+V+CSP ++   T+V+ VHDTPEIWA+R+ ITG IDPSTSIIVD+ LD  KW + R
Sbjct: 493 IPDDSVLCSPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSIIVDSPLDFTKWCMNR 552

Query: 549 KYSVIDVNIPQSLFEQDNYSAMITSQEVLVYIWDNYLKYFPSLAKVAFIGVGDAYSGIVH 608
           KY VIDVNIPQSLFEQDNYSAMITSQEVL+YIWDNY+KYFPSLAKVAF+G GDAY+GIVH
Sbjct: 553 KYGVIDVNIPQSLFEQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAFVGFGDAYAGIVH 612

Query: 609 LLGHRDTRSVVKAAVSFVDTKPLKSLVPLVDESLGNWYFKNSLVFTSKNHSCWGTDGNEN 668
           LLGHRDTR+ VKA VSF+  K LK LVPLVDESL +WYFKNSL+FT KNH CW    NE+
Sbjct: 613 LLGHRDTRATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDKNHPCWAD--NES 670

Query: 669 KKPRKRFGRVLKCDTTGMNNIVEERFQEATDFILDSFEEWSDSE 712
           KKPRK+FGRVL+CDT G+N+ +EERF+EATDFILD FEEWSDSE
Sbjct: 671 KKPRKKFGRVLRCDTDGLNSNMEERFEEATDFILDLFEEWSDSE 714

>YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putative
           catalytic subunit of a class II histone deacetylase
           complex that also contains Hda2p and Hda3p; Hda1p
           interacts with the Hda2p-Hda3p subcomplex to form an
           active tetramer; deletion increases histone H2B, H3 and
           H4 acetylation
          Length = 706

 Score = 1113 bits (2879), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/667 (75%), Positives = 586/667 (87%), Gaps = 2/667 (0%)

Query: 46  VIVPEVPPRIHYTQLKTGLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENG 105
           VIVP   P+IHY+ LKTGLCYDVRMRYHAKI+TSYFEYIDPHPEDPRRIYRIYKILAENG
Sbjct: 42  VIVPVCMPKIHYSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENG 101

Query: 106 LIRDPTLSGVDEIGELMLKIPVREATAEEILQVHTKEHLAFLEKTPKMTREQLLKETETG 165
           LI DPTLSGVD++G+LMLKIPVR AT+EEIL+VHTKEHL F+E T KM+RE+LLKETE G
Sbjct: 102 LINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREELLKETEKG 161

Query: 166 DSVYFNNDSLLSAKLSCGGAIEACKAVVEGRVKNALAVIRPPGHHAEPEIAGGFCLFSNV 225
           DSVYFNNDS  SA+L CGGAIEACKAVVEGRVKN+LAV+RPPGHHAEP+ AGGFCLFSNV
Sbjct: 162 DSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNV 221

Query: 226 AVAAQNILKNYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVH 285
           AVAA+NILKNYPESVRRIMILDWDIHHGNGTQK+FY D++VLYVSLHR+E+GKYYPGT+ 
Sbjct: 222 AVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQ 281

Query: 286 GNYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAAD 345
           G Y+QTGEGKGEGFNCNI WP GG+GDAEYMWAF+QVVMPMGREF+PDLVIISSGFDAAD
Sbjct: 282 GQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAAD 341

Query: 346 GDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDSIAKSALGVAKILIGEPPDE 405
           GDTIGQCHV+PSCYGHMTHMLKSLARGNLCVVLEGGYNLD+IA+SAL VAK+LIGEPPDE
Sbjct: 342 GDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPDE 401

Query: 406 LPHPTQQPKPEAIETIETVIRTQSKYWNCFKSTHSNDGCNFKEEVTESTISKNFPXXXXX 465
           LP P   PKPE IE I+ VIR QSKYWNCF+  H+N GCNF E + +S ISKNFP     
Sbjct: 402 LPDPLSDPKPEVIEMIDKVIRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQKAI 461

Query: 466 XXXXXXXXSEKFGFVTLPLLNMEVPQDTVICSPNIYDAETVVVCVHDTPEIWAQRNPITG 525
                   S++F FVTLPL++M++P +TV+C+PNI ++ T+++ VHDT +IWA+RN I+G
Sbjct: 462 RQQQQHYLSDEFNFVTLPLVSMDLPDNTVLCTPNISESNTIIIVVHDTSDIWAKRNVISG 521

Query: 526 TIDPSTSIIVDTTLDIIKWSLQRKYSVIDVNIPQSLFEQDNYSAMITSQEVLVYIWDNYL 585
           TID S+S+I+D +LD IKW L RKY +IDVNIP +LFE DNYS MITSQEVL+Y+WDNY+
Sbjct: 522 TIDLSSSVIIDNSLDFIKWGLDRKYGIIDVNIPLTLFEPDNYSGMITSQEVLIYLWDNYI 581

Query: 586 KYFPSLAKVAFIGVGDAYSGIVHLLGHRDTRSVVKAAVSFVDTKPLKSLVPLVDESLGNW 645
           KYFPS+AK+AFIG+GD+YSGIVHLLGHRDTR+V K  ++F+  K LK LVPLVDE+L  W
Sbjct: 582 KYFPSVAKIAFIGIGDSYSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEW 641

Query: 646 YFKNSLVFTSKNHSCWGTDGNENKKPRKRFGRVLKCDTTGMNNIVEERFQEATDFILDSF 705
           YFKNSL+F++ +H CW    NE++KPRK+FGRVL+CDT G+NNI+EERF+EATDFILDSF
Sbjct: 642 YFKNSLIFSNNSHQCWKE--NESRKPRKKFGRVLRCDTDGLNNIIEERFEEATDFILDSF 699

Query: 706 EEWSDSE 712
           EEWSD E
Sbjct: 700 EEWSDEE 706

>Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1111 bits (2873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/694 (73%), Positives = 594/694 (85%), Gaps = 3/694 (0%)

Query: 20  EDSLKRKVDTMEDEVES-RKRSTGTLPVIVPEVPPRIHYTQLKTGLCYDVRMRYHAKIYT 78
           +  LK K++ M++E  S    S     VIVP   P++HYT L+TGLCYDVRMRYHAKI+T
Sbjct: 15  DQDLKHKLEGMKEEQNSLSTTSKNKRQVIVPACTPKLHYTPLRTGLCYDVRMRYHAKIFT 74

Query: 79  SYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPVREATAEEILQV 138
           SYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSGVD++G+LMLKIPVR AT+EEIL+V
Sbjct: 75  SYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEV 134

Query: 139 HTKEHLAFLEKTPKMTREQLLKETETGDSVYFNNDSLLSAKLSCGGAIEACKAVVEGRVK 198
           HTKEHL F+E T KM+REQLLKETE GDSVYFNNDS  SA+L CGGAIEACKAVVEGRVK
Sbjct: 135 HTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVK 194

Query: 199 NALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMILDWDIHHGNGTQK 258
           N+LAV+RPPGHHAEP+ AGGFCLFSNVAVAA+NILKNYPESVRRIMILDWDIHHGNGTQK
Sbjct: 195 NSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQK 254

Query: 259 AFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWA 318
           +FY D++VLY+SLHR+E+GKYYPGT+ G Y+QTGEGKGEGFNCNI WP GG+GDAEYMWA
Sbjct: 255 SFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWA 314

Query: 319 FQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVL 378
           F+QVVMPMGREF+PDLVIISSGFDAADGDTIGQCHV+PSCYGHMTHMLKSLARGNLCVVL
Sbjct: 315 FEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVL 374

Query: 379 EGGYNLDSIAKSALGVAKILIGEPPDELPHPTQQPKPEAIETIETVIRTQSKYWNCFKST 438
           EGGYNLD+IA SAL VAK+LIGEPPDELP P   PKPE IE I+ V+R QSKYWNCF+  
Sbjct: 375 EGGYNLDAIAISALSVAKVLIGEPPDELPDPLSDPKPEVIEMIDKVVRLQSKYWNCFRRR 434

Query: 439 HSNDGCNFKEEVTESTISKNFPXXXXXXXXXXXXXSEKFGFVTLPLLNMEVPQDTVICSP 498
           H+N GCNF E + +S ISKNFP             S++F FVTLPL+NME+P + V+C+P
Sbjct: 435 HANSGCNFNEPINDSIISKNFPLQKAIRQQQLHYLSDEFNFVTLPLINMELPDNIVLCTP 494

Query: 499 NIYDAETVVVCVHDTPEIWAQRNPITGTIDPSTSIIVDTTLDIIKWSLQRKYSVIDVNIP 558
           N+ ++ T++V VHDT ++WA+RN I+GTID S+S+++D  LD IKW L RKY +IDVNIP
Sbjct: 495 NVSESSTLLVVVHDTSDVWAKRNVISGTIDLSSSVVIDNCLDFIKWGLDRKYGIIDVNIP 554

Query: 559 QSLFEQDNYSAMITSQEVLVYIWDNYLKYFPSLAKVAFIGVGDAYSGIVHLLGHRDTRSV 618
            +LFE DNYS MITSQEVL+Y+WDNY+KYFP++AK+A+IG+GD+YSGIVHLLGHRDTR+V
Sbjct: 555 LTLFEADNYSGMITSQEVLIYLWDNYIKYFPAVAKIAYIGIGDSYSGIVHLLGHRDTRAV 614

Query: 619 VKAAVSFVDTKPLKSLVPLVDESLGNWYFKNSLVFTSKNHSCWGTDGNENKKPRKRFGRV 678
            K  ++F+  K LK LVPLVDE+L  WYFKNSLVFT+ +H CW    NE++KPRK+FGRV
Sbjct: 615 TKTVINFLGDKQLKPLVPLVDETLTEWYFKNSLVFTNNSHQCWKE--NESRKPRKKFGRV 672

Query: 679 LKCDTTGMNNIVEERFQEATDFILDSFEEWSDSE 712
           L+CDT G++N VEERF+EATDFILDSFEEWSD E
Sbjct: 673 LRCDTDGLSNTVEERFEEATDFILDSFEEWSDEE 706

>NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {ON}
           Anc_2.285 YNL021W
          Length = 689

 Score = 1110 bits (2870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/681 (74%), Positives = 594/681 (87%), Gaps = 2/681 (0%)

Query: 32  DEVESRKRSTGTLPVIVPEVPPRIHYTQLKTGLCYDVRMRYHAKIYTSYFEYIDPHPEDP 91
           D ++ RK    +  +IVP    +IHYT LKTGLCYDVRMRYHAKI+TSYFEYIDPHPEDP
Sbjct: 11  DTIKKRKIDPESRQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDP 70

Query: 92  RRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPVREATAEEILQVHTKEHLAFLEKTP 151
           RRIYRIYKILAENGLI+DPTLSG+D+IG+LMLKIPVREAT+EEIL+VH+KEHL F+E T 
Sbjct: 71  RRIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSKEHLDFIESTS 130

Query: 152 KMTREQLLKETETGDSVYFNNDSLLSAKLSCGGAIEACKAVVEGRVKNALAVIRPPGHHA 211
           KM REQLLK TE+GDSVYFN+DS  SAKL  GGAIEACKAVVEGRVKNALAV+RPPGHHA
Sbjct: 131 KMNREQLLKATESGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNALAVVRPPGHHA 190

Query: 212 EPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSL 271
           EPE AGGFCLFSNVA+AA+NILKNYPESVR+I+ILDWDIHHGNGTQKAFY D+R+LYVSL
Sbjct: 191 EPEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSL 250

Query: 272 HRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQ 331
           HR+++GKYYPGT+HG Y+QTGEGKGEGFNCNI WP GG+GDAEYMWAF+Q+VMPMGREFQ
Sbjct: 251 HRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQ 310

Query: 332 PDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDSIAKSA 391
           PDLVIIS+GFDAADGDTIGQCHV+PSCYGHMTHMLKSLARGN+ VVLEGGYNLDSIA SA
Sbjct: 311 PDLVIISAGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIAISA 370

Query: 392 LGVAKILIGEPPDELPHPTQQPKPEAIETIETVIRTQSKYWNCFKSTHSNDGCNFKEEVT 451
           L VAKILIGEPPDELP  T+ PKPE IE I+ V+R QSKYW CFKS   N GC+F+E++ 
Sbjct: 371 LSVAKILIGEPPDELPDVTRDPKPEVIEMIDKVLRIQSKYWKCFKSKFGNAGCDFQEQIN 430

Query: 452 ESTISKNFPXXXXXXXXXXXXXSEKFGFVTLPLLNMEVPQDTVICSPNIYDAETVVVCVH 511
            S  +KNFP             S++F F  LP+   E+P+DT++CS NIY++ T+++CVH
Sbjct: 431 NSIATKNFPLQSAIRQQQVRNLSKEFNFSELPIYKSELPEDTILCSSNIYESNTIIICVH 490

Query: 512 DTPEIWAQRNPITGTIDPSTSIIVDTTLDIIKWSLQRKYSVIDVNIPQSLFEQDNYSAMI 571
           DTPEIWA+R+ I GTIDPS+SIIVD++LD+IKW+++RKY VID+NIPQ+L EQ+NY ++I
Sbjct: 491 DTPEIWAKRDAIQGTIDPSSSIIVDSSLDMIKWAIERKYGVIDINIPQNLLEQENYYSII 550

Query: 572 TSQEVLVYIWDNYLKYFPSLAKVAFIGVGDAYSGIVHLLGHRDTRSVVKAAVSFVDTKPL 631
           T+QEVL+ +WDNYLKYFP++ K+AF+G+GDAYSGIVHLLGHRDTRSVVKA ++FV  K L
Sbjct: 551 TAQEVLINLWDNYLKYFPNVNKIAFVGIGDAYSGIVHLLGHRDTRSVVKAVINFVGQKQL 610

Query: 632 KSLVPLVDESLGNWYFKNSLVFTSKNHSCWGTDGNENKKPRKRFGRVLKCDTTGMNNIVE 691
           K LVPLVDESLG WYFKNSLVF++KNH  WG    ENKKPRK++GRVL+CDT G++NI+E
Sbjct: 611 KPLVPLVDESLGEWYFKNSLVFSNKNHIYWGD--KENKKPRKKYGRVLRCDTDGISNIME 668

Query: 692 ERFQEATDFILDSFEEWSDSE 712
           ERF+EATDFILDSFEEWSDSE
Sbjct: 669 ERFEEATDFILDSFEEWSDSE 689

>Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1108 bits (2867), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/691 (73%), Positives = 590/691 (85%), Gaps = 3/691 (0%)

Query: 23  LKRKVD-TMEDEVESRKRSTGTLPVIVPEVPPRIHYTQLKTGLCYDVRMRYHAKIYTSYF 81
           LKR ++ T ED+      S     VIVP   P+IHY+ LKTGLCYDVRMRYHAKI+TSYF
Sbjct: 18  LKRTLENTKEDQNSLSTTSRNKRQVIVPACTPKIHYSPLKTGLCYDVRMRYHAKIFTSYF 77

Query: 82  EYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPVREATAEEILQVHTK 141
           EYIDPHPEDPRRIYRIYKILAENGLI DPTLSGVD+IG+LMLKIPVR AT+EEIL+VHTK
Sbjct: 78  EYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDIGDLMLKIPVRAATSEEILEVHTK 137

Query: 142 EHLAFLEKTPKMTREQLLKETETGDSVYFNNDSLLSAKLSCGGAIEACKAVVEGRVKNAL 201
           EHL F+E T KM+REQLLKETE GDSVYFNNDS  SA+L CGGAIEACKAVVEGRVKN+L
Sbjct: 138 EHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSL 197

Query: 202 AVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMILDWDIHHGNGTQKAFY 261
           AV+RPPGHHAEP+ AGGFCLFSNVAVAA+NILKNYPESVRRIMILDWDIHHGNGTQK+FY
Sbjct: 198 AVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFY 257

Query: 262 SDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWAFQQ 321
            D++VLYVSLHR+E+GKYYPGT+ G Y+QTGEGKGEGFNCNI WP GG+GDAEYMWAF+Q
Sbjct: 258 QDDQVLYVSLHRFEMGKYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQ 317

Query: 322 VVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGG 381
           VVMPMGREF+PDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGG
Sbjct: 318 VVMPMGREFKPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGG 377

Query: 382 YNLDSIAKSALGVAKILIGEPPDELPHPTQQPKPEAIETIETVIRTQSKYWNCFKSTHSN 441
           YNLD+IA+SAL VAK+LIGEPPDELP     PKPE IE I+ VIR QSKYWNCF+  H+N
Sbjct: 378 YNLDAIARSALSVAKVLIGEPPDELPDSLSDPKPEVIEMIDKVIRLQSKYWNCFRRRHAN 437

Query: 442 DGCNFKEEVTESTISKNFPXXXXXXXXXXXXXSEKFGFVTLPLLNMEVPQDTVICSPNIY 501
            GCNF E + +S ISKNFP             S +F FVTLPL+NM +P +T +C+PN++
Sbjct: 438 SGCNFNEPINDSIISKNFPLQKAIRQQQLQYLSNEFSFVTLPLINMGLPDNTALCTPNVF 497

Query: 502 DAETVVVCVHDTPEIWAQRNPITGTIDPSTSIIVDTTLDIIKWSLQRKYSVIDVNIPQSL 561
           ++  ++V VHDT ++WA+RN I+GTID S+S+I+D  +D IKW L RKY +IDVNIP +L
Sbjct: 498 ESNALLVVVHDTSDVWAKRNVISGTIDLSSSVIIDNCIDFIKWGLDRKYGIIDVNIPLTL 557

Query: 562 FEQDNYSAMITSQEVLVYIWDNYLKYFPSLAKVAFIGVGDAYSGIVHLLGHRDTRSVVKA 621
           FE DNYS MITSQEVL+Y+WDNY+KYFP++AK+AFIG+GD++SGIVHLLGHRDTR+V K 
Sbjct: 558 FEADNYSGMITSQEVLIYLWDNYIKYFPNVAKIAFIGIGDSHSGIVHLLGHRDTRAVTKT 617

Query: 622 AVSFVDTKPLKSLVPLVDESLGNWYFKNSLVFTSKNHSCWGTDGNENKKPRKRFGRVLKC 681
            ++F+  K LK LVPLVDE+L  WYFKNSL+F++ +H CW    NE++KPRK+FGRVL+C
Sbjct: 618 VINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKE--NESRKPRKKFGRVLRC 675

Query: 682 DTTGMNNIVEERFQEATDFILDSFEEWSDSE 712
           DT G++N +EERF+EATDFILDSFEEWSD E
Sbjct: 676 DTDGLSNTIEERFEEATDFILDSFEEWSDDE 706

>KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 704

 Score = 1098 bits (2839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/668 (73%), Positives = 582/668 (87%)

Query: 45  PVIVPEVPPRIHYTQLKTGLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAEN 104
           PVIVP   P+I Y+ LKTG+CYDVRMRYHAKI+TSYFEYIDPHPEDPRRIYR+YKILAEN
Sbjct: 37  PVIVPPTKPKIRYSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAEN 96

Query: 105 GLIRDPTLSGVDEIGELMLKIPVREATAEEILQVHTKEHLAFLEKTPKMTREQLLKETET 164
           GLI+DPTLSG D IG+LM+K+PVREA  EEILQVH+++HL F+ +T ++ RE LLKETE 
Sbjct: 97  GLIQDPTLSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQTEQLERESLLKETEG 156

Query: 165 GDSVYFNNDSLLSAKLSCGGAIEACKAVVEGRVKNALAVIRPPGHHAEPEIAGGFCLFSN 224
           GDSVYFNNDS LSAKLSCGGAIEACKAVVEGRVKN++AV+RPPGHHAEPEIAGGFCLFSN
Sbjct: 157 GDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPGHHAEPEIAGGFCLFSN 216

Query: 225 VAVAAQNILKNYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTV 284
           VAVAA N+LK+YPESVR+IMI+DWDIHHGNGTQKAFY D+RVLYVSLHRY+LGKYYPGT+
Sbjct: 217 VAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTI 276

Query: 285 HGNYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAA 344
           HGNY+QTGEGKGEGFNCNI WP GG+GDAEYMWAF+QV+MPMGREF+PDLV+ISSGFDAA
Sbjct: 277 HGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAA 336

Query: 345 DGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDSIAKSALGVAKILIGEPPD 404
           DGDTIGQCHV+P+CYGHMTHML SLA+GNLCVVLEGGYNLDSIAKSALGV K+L+GEPPD
Sbjct: 337 DGDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVLEGGYNLDSIAKSALGVCKVLVGEPPD 396

Query: 405 ELPHPTQQPKPEAIETIETVIRTQSKYWNCFKSTHSNDGCNFKEEVTESTISKNFPXXXX 464
           ELP P +QP PEA + IETVIRTQSKYW+CFK+ H NDG NFK+ +T +  ++NFP    
Sbjct: 397 ELPAPKKQPTPEAKKMIETVIRTQSKYWSCFKNRHGNDGINFKDAITSTLDTRNFPLQNA 456

Query: 465 XXXXXXXXXSEKFGFVTLPLLNMEVPQDTVICSPNIYDAETVVVCVHDTPEIWAQRNPIT 524
                    S +F FV LP+L++ +P +T++C+  I D+ET+VV VHDTPEIW++R+  T
Sbjct: 457 IREYQVSQLSSQFNFVQLPILDLNLPANTMLCTSGIQDSETLVVIVHDTPEIWSERDTQT 516

Query: 525 GTIDPSTSIIVDTTLDIIKWSLQRKYSVIDVNIPQSLFEQDNYSAMITSQEVLVYIWDNY 584
           G IDPS+SIIVD  L +I W++ R+Y +ID+NIPQ+LFE  NY  + +SQE+L+Y+WDNY
Sbjct: 517 GIIDPSSSIIVDNALKMINWAMDRRYGIIDINIPQTLFEHANYPGVASSQEILIYLWDNY 576

Query: 585 LKYFPSLAKVAFIGVGDAYSGIVHLLGHRDTRSVVKAAVSFVDTKPLKSLVPLVDESLGN 644
           LK+F +L KVAFIG+GDAY GIVHLLGHRDTRSVVK A+SF+D KPLK +VPL+DE+LG+
Sbjct: 577 LKFFQNLQKVAFIGIGDAYGGIVHLLGHRDTRSVVKCAISFLDKKPLKVMVPLIDETLGD 636

Query: 645 WYFKNSLVFTSKNHSCWGTDGNENKKPRKRFGRVLKCDTTGMNNIVEERFQEATDFILDS 704
           WYFKNSLVFTS  HSCWG+  NENKK RK++GRVLK D  GM NI +ERF+EATDFILDS
Sbjct: 637 WYFKNSLVFTSSTHSCWGSTANENKKLRKKYGRVLKADCDGMTNIFDERFEEATDFILDS 696

Query: 705 FEEWSDSE 712
           FEEWS+SE
Sbjct: 697 FEEWSESE 704

>KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.285
           YNL021W
          Length = 693

 Score = 1087 bits (2811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/693 (71%), Positives = 585/693 (84%), Gaps = 2/693 (0%)

Query: 20  EDSLKRKVDTMEDEVESRKRSTGTLPVIVPEVPPRIHYTQLKTGLCYDVRMRYHAKIYTS 79
           E S+KR+    +   ES   S   +  IV    P++ YT LKTGLCYDVRMRYHAKI+TS
Sbjct: 3   EPSVKRENPDSQKPAESSTHSKRQM--IVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFTS 60

Query: 80  YFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPVREATAEEILQVH 139
           YFEYIDPHPEDPRRIYRIYKILAENGLI DP LSG+D+IG+LMLKIPVREAT++E+L+VH
Sbjct: 61  YFEYIDPHPEDPRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEVH 120

Query: 140 TKEHLAFLEKTPKMTREQLLKETETGDSVYFNNDSLLSAKLSCGGAIEACKAVVEGRVKN 199
           +KEHL F+E   KM+ ++LLK TETGDSVYFNNDS  SAKLSCGGAIEACKAVVEGRVKN
Sbjct: 121 SKEHLEFIESVTKMSHDELLKSTETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKN 180

Query: 200 ALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMILDWDIHHGNGTQKA 259
           A AV+RPPGHH+EPE AGGFCLFSNVAVA++NIL+NYPESVRRIMILDWDIHHGNGTQKA
Sbjct: 181 AFAVVRPPGHHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKA 240

Query: 260 FYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWAF 319
           FY D+RVLY+SLHR+ELGKYYPGT  G+Y++TGEGKGEGFNCNI WP GG+GDAEYMWAF
Sbjct: 241 FYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAF 300

Query: 320 QQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLE 379
           +QVVMPM REF+PDLVIIS+GFDAADGDTIGQCHVSPSCYGHMTHMLKSLA GNLCVVLE
Sbjct: 301 EQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLE 360

Query: 380 GGYNLDSIAKSALGVAKILIGEPPDELPHPTQQPKPEAIETIETVIRTQSKYWNCFKSTH 439
           GGYNLD+IA+SAL VAK+LIGEPP+EL  P + PKPEAIE I  VIR QSKYW CF+  H
Sbjct: 361 GGYNLDAIARSALSVAKVLIGEPPEELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRRH 420

Query: 440 SNDGCNFKEEVTESTISKNFPXXXXXXXXXXXXXSEKFGFVTLPLLNMEVPQDTVICSPN 499
            N GC F++ +TES  + NFP             S++FGFV  PL  M++  DTVICSP 
Sbjct: 421 GNSGCTFEKHMTESISTDNFPLQSAIRQQQFSALSKEFGFVKFPLFEMKLSDDTVICSPE 480

Query: 500 IYDAETVVVCVHDTPEIWAQRNPITGTIDPSTSIIVDTTLDIIKWSLQRKYSVIDVNIPQ 559
           +Y+ +T+++ V DTPEIWA+R+ I GTIDPS SII D  L  IKW+++R Y VIDVNIPQ
Sbjct: 481 VYNKDTIIILVRDTPEIWAKRDVIQGTIDPSASIITDAALAFIKWAMERNYGVIDVNIPQ 540

Query: 560 SLFEQDNYSAMITSQEVLVYIWDNYLKYFPSLAKVAFIGVGDAYSGIVHLLGHRDTRSVV 619
           SLFEQDNYSAMIT+QEV+ ++WDNY+++F S +K+AF+GVGDA SGIVHLLGHRDTRS V
Sbjct: 541 SLFEQDNYSAMITAQEVMSFMWDNYIRFFGSASKIAFVGVGDACSGIVHLLGHRDTRSKV 600

Query: 620 KAAVSFVDTKPLKSLVPLVDESLGNWYFKNSLVFTSKNHSCWGTDGNENKKPRKRFGRVL 679
           K+ ++F+  K LK L+PLVDE+LG+WYFKNSLVF+ KNH+CWG + NENKKPRK+FGRVL
Sbjct: 601 KSVINFIAQKTLKPLIPLVDETLGDWYFKNSLVFSDKNHACWGDNENENKKPRKKFGRVL 660

Query: 680 KCDTTGMNNIVEERFQEATDFILDSFEEWSDSE 712
           +C++ G+ NI+EERF+EATDF+LDSFEEWS+S+
Sbjct: 661 RCNSDGLTNIIEERFEEATDFMLDSFEEWSESD 693

>KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.285
           YNL021W
          Length = 702

 Score = 1044 bits (2700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/701 (69%), Positives = 571/701 (81%), Gaps = 15/701 (2%)

Query: 19  MEDSLKRKVDTMEDEVESRKRSTGTLP---VIVPEVPPRIHYTQLKTGLCYDVRMRYHAK 75
           ME S KRK      + E    S   +P   VIVP   P++HY  LKTGLCYDVRMRYHAK
Sbjct: 10  MEGSTKRK------QEEENLESLNVVPKRQVIVPTKKPQVHYIPLKTGLCYDVRMRYHAK 63

Query: 76  IYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPVREATAEEI 135
           I+TSYFEYIDPHPEDPRRIYRIYKILAENGLI D  LSGVD+IG++MLKIPVREATA+EI
Sbjct: 64  IFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVREATADEI 123

Query: 136 LQVHTKEHLAFLEKTPKMTREQLLKETETGDSVYFNNDSLLSAKLSCGGAIEACKAVVEG 195
           L+VH++EHL FLE T  M RE LLKETE GDSVYFNNDS +SAKLSCGGAIEACKAVVEG
Sbjct: 124 LEVHSREHLEFLESTTTMNREVLLKETEKGDSVYFNNDSYMSAKLSCGGAIEACKAVVEG 183

Query: 196 RVKNALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMILDWDIHHGNG 255
           +VKNALAV+RPPGHH+EPE +GGFCLFSNVAVAA+NILKNYPESVR+IMILDWDIHHGNG
Sbjct: 184 KVKNALAVVRPPGHHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNG 243

Query: 256 TQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIPWPYGGLGDAEY 315
           TQKAFY D RVLYVSLHR+E GKYYPGTV G Y+Q GEGKGEGFNCNI WP GG+GDAEY
Sbjct: 244 TQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEY 303

Query: 316 MWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLC 375
           MWAF+Q+VMPMGREFQPDLVIISSGFDAADGD IGQCHV+PSCYGHMTHMLKSLARGNL 
Sbjct: 304 MWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTHMLKSLARGNLV 363

Query: 376 VVLEGGYNLDSIAKSALGVAKILIGEPPDELPHPTQQPKPEAIETIETVIRTQSKYWNCF 435
           VVLEGGYNLDSIA SAL VAK LIGEPPDELP P + PKPEA+E I  VI+ QSKYW CF
Sbjct: 364 VVLEGGYNLDSIAISALSVAKTLIGEPPDELPDPLKDPKPEALEMIYKVIKIQSKYWKCF 423

Query: 436 KSTHSNDGCNFKEEVTESTISKNFPXXXXXXXXXXXXXSEKFGFVTLPLLNMEVPQDTVI 495
           K  H N   NF E  +++  +K FP              +++ FV  P  N+++P D ++
Sbjct: 424 KRRHGNYNINFSEVASDTLATKTFPLQTAIRQQQYYNLFKEYDFVKFPTANLKLPDDLIL 483

Query: 496 CSPNIYDAETVVVCVHDTPEIWAQRNPITGTIDPSTSIIVDTTLDIIKWSLQRKYSVIDV 555
           CSPNI+ AETV++ VHDTP+IW +++ I+ T+DP +SII+D+TLD +KW+  RKY +IDV
Sbjct: 484 CSPNIHTAETVIIIVHDTPQIWLEKDIISNTVDPCSSIIIDSTLDFLKWAHNRKYGIIDV 543

Query: 556 NIPQSLF----EQDNYSAMITSQEVLVYIWDNYLKYFPSLAKVAFIGVGDAYSGIVHLLG 611
           NIPQSL       DNYS++I +QE+L+++WDN++K+   + K+AFIGVGD+ SG+VHLLG
Sbjct: 544 NIPQSLIYGDENPDNYSSLINAQEILLFLWDNHIKFLNEVNKIAFIGVGDSVSGVVHLLG 603

Query: 612 HRDTRSVVKAAVSFVDTKPLKSLVPLVDESLGNWYFKNSLVFTSKNHSCWGTDGNENKKP 671
           HRDT+  VKA ++F+  K LK LVPLVDESL +WYFKNSLVF+++ H CWG    ENKKP
Sbjct: 604 HRDTKERVKAVINFMADKQLKPLVPLVDESLSDWYFKNSLVFSNRTHPCWGD--KENKKP 661

Query: 672 RKRFGRVLKCDTTGMNNIVEERFQEATDFILDSFEEWSDSE 712
           RK++GRVL+CDT G+N+ +EERF EATDFILDSFEEWSDSE
Sbjct: 662 RKKYGRVLRCDTDGLNSTIEERFDEATDFILDSFEEWSDSE 702

>Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON}
           (99859..101838) [1980 nt, 660 aa]
          Length = 659

 Score = 1018 bits (2633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/656 (69%), Positives = 555/656 (84%), Gaps = 2/656 (0%)

Query: 55  IHYTQLKTGLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSG 114
           + YT LKTGLCYDVRMRYHAKIYTSY+EYIDPHPEDPRRIYRIYKILAENGLIRDP LSG
Sbjct: 5   LSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSG 64

Query: 115 VDEIGELMLKIPVREATAEEILQVHTKEHLAFLEKTPKMTREQLLKETETGDSVYFNNDS 174
           +D+IG+LM KIPVREAT+EEIL+VH KE L +LEKT  + R++LL +TE GDSVYFNNDS
Sbjct: 65  IDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNNDS 124

Query: 175 LLSAKLSCGGAIEACKAVVEGRVKNALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILK 234
             SAKLSCGGAIEACKA+V+G+VKN+LA++RPPGHH+EPE+AGGFCLFSNVAVA +NILK
Sbjct: 125 YFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNILK 184

Query: 235 NYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEG 294
           NYP+ V+++MI+DWDIHHGNGTQKAFY+D+RVLYVSLHR+ELGKYYPGT+HG Y+Q GEG
Sbjct: 185 NYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEG 244

Query: 295 KGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHV 354
           KGEGFNCNIPW  GG+GDAEY+WAF+Q+VMPMGREF+PDLVI+SSGFDAADGDTIG+CHV
Sbjct: 245 KGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHV 304

Query: 355 SPSCYGHMTHMLKSLARGNLCVVLEGGYNLDSIAKSALGVAKILIGEPPDELPHPTQQPK 414
           +PSCYGHMTHMLKSLA G LCVVLEGGYNLD+IA+SAL VAK+LIGEPPDELP P + PK
Sbjct: 305 TPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDKDPK 364

Query: 415 PEAIETIETVIRTQSKYWNCFKSTHSNDGCNFKEEVTESTISKNFPXXXXXXXXXXXXXS 474
           PEAIE I+ VI  +SKYW CFK   +N  C +K  ++ES  +K FP             +
Sbjct: 365 PEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQIQYLT 424

Query: 475 EKFGFVTLPLLNMEVPQDTVICSPNIYDAETVVVCVHDTPEIWAQRNPITGTIDPSTSII 534
             +  V LPL+N  +P+DTV+CS +I  +   ++ VHDTPEIW++R+ I G ID S S+ 
Sbjct: 425 NDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSASLY 484

Query: 535 VDTTLDIIKWSLQRKYSVIDVNIPQSLFEQDNYSAMITSQEVLVYIWDNYLKYFPSLAKV 594
           +D +L    W+L R Y +IDVNIPQ+L+EQDNYSA +T+QEVL+ +WDN LKYFP++ K+
Sbjct: 485 MDASLQFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNVNKI 544

Query: 595 AFIGVGDAYSGIVHLLGHRDTRSVVKAAVSFVDTKPLKSLVPLVDESLGNWYFKNSLVFT 654
           A+IGVG+AYSG+VHLLGHRDTRSVVK+ + FV  KPLK+LVPLV+ESL +WYFK SL+F 
Sbjct: 545 AYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSLLFA 604

Query: 655 SKNHSCWGTDGNENKKPRKRFGRVLKCDTTGMNNIVEERFQEATDFILDSFEEWSD 710
            KNHSCWG   N++KKPRKR+GRVL+CD+ G+ +++EERF+EATDFI+DS +EW++
Sbjct: 605 DKNHSCWGE--NDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTE 658

>TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {ON}
           Anc_2.285 YNL021W
          Length = 701

 Score =  986 bits (2550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/668 (67%), Positives = 550/668 (82%), Gaps = 4/668 (0%)

Query: 45  PVIVPEVPPRIHYTQLKTGLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAEN 104
           PVIVP   P +HYT LKTG+CYDVRMRYHAKI+TSYFEYIDPHPEDPRRIYRIYKILAEN
Sbjct: 36  PVIVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAEN 95

Query: 105 GLIRDPTLSGVDEIGELMLKIPVREATAEEILQVHTKEHLAFLEKTPKMTREQLLKETET 164
           GLI DP+L+GV +IG+LMLKIPVREAT EEIL VHT+EH+ FLE T KMTRE+LL +TE 
Sbjct: 96  GLINDPSLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREELLSKTEK 155

Query: 165 GDSVYFNNDSLLSAKLSCGGAIEACKAVVEGRVKNALAVIRPPGHHAEPEIAGGFCLFSN 224
           GDSVY NNDS +SA+LSCGGAIEACKAVVEGRVKNALA++RPPGHHAEP+ AGGFCLFSN
Sbjct: 156 GDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLFSN 215

Query: 225 VAVAAQNILKNYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTV 284
           V+VAA++ILK YPESVR+I+I+DWDIHHGNGTQKAFY D+ VLY+SLHR+ELGK+YPG  
Sbjct: 216 VSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFP 275

Query: 285 HGNYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAA 344
            GNY++ G+GKG+GFNCNI WP  G+GD EY+WAF+Q+V+PM REF+PDLVI+SSGFDAA
Sbjct: 276 EGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAA 335

Query: 345 DGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDSIAKSALGVAKILIGEPPD 404
            GDTIGQCHV+P+CYG+MTHMLKSLARGNLCVVLEGGYNLDSI+ SAL VAKILIGEPPD
Sbjct: 336 HGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGEPPD 395

Query: 405 ELPHPTQQPKPEAIETIETVIRTQSKYWNCFKSTHSNDGCNFKEEVTESTISKNFPXXXX 464
           E+P   + PKP  +E I  VIR QSKYW CF+    N G  + E   ES I K FP    
Sbjct: 396 EIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRKFGNFGGEY-ENAIESQIPKMFPLQDA 454

Query: 465 XXXXXXXXXSEKFGFVTLPLLNMEVPQDTVICSPNIYDAETVVVCVHDTPEIWAQRNPIT 524
                     + FG ++L L N+ +P++++ICS N + A+++ V +HDTPE+W  R+ IT
Sbjct: 455 IRNAQLSHYYDDFGMISLSLPNLNLPKNSIICSSNFFKAKSLCVLLHDTPEVWGNRDIIT 514

Query: 525 GTIDPSTSIIVDTTLDIIKWSLQRKYSVIDVNIPQSLFEQDNYSAMITSQEVLVYIWDNY 584
           G IDPSTSII D++L  I W+++R+ +VID+NIP+S FE DNYS+ + SQ+V++ +WDN+
Sbjct: 515 GIIDPSTSIIFDSSLKFINWAIERETAVIDINIPRSAFEADNYSSNLLSQDVMISLWDNH 574

Query: 585 LKYFPSLAKVAFIGVGDAYSGIVHLLGHRDTRSVVKAAVSFVDTKPLKSLVPLVDESLGN 644
            KY  SL K+ FIG+G+A SGIVHLLG RDTR+V KAA++FV +  LK +VP +DESLG+
Sbjct: 575 FKYIESLEKLCFIGIGEATSGIVHLLGKRDTRTVTKAAINFVGSSSLKPIVPSLDESLGD 634

Query: 645 WYFKNSLVFTSKNHSCWGTDGNENKKPRKRFGRVLKCDTTGMNNIVEERFQEATDFILDS 704
           WYFKNSLVFT   H CW  +   +KKPRK++GRVL+CDT G++NI+EERF+EATDFILD+
Sbjct: 635 WYFKNSLVFTDHFHGCWSEN---DKKPRKKYGRVLRCDTDGIHNIIEERFEEATDFILDA 691

Query: 705 FEEWSDSE 712
           F+EWSD+E
Sbjct: 692 FDEWSDTE 699

>TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa]
           {ON} Anc_2.285 YNL021W
          Length = 795

 Score =  755 bits (1950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/443 (77%), Positives = 381/443 (86%)

Query: 46  VIVPEVPPRIHYTQLKTGLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENG 105
           +IVP   P+IHY  LKTGLCYDVRMRYHAKI+TSYFEYIDPHPEDPRRIYRIYKILAENG
Sbjct: 43  IIVPVQAPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENG 102

Query: 106 LIRDPTLSGVDEIGELMLKIPVREATAEEILQVHTKEHLAFLEKTPKMTREQLLKETETG 165
           LI DPTLSGVD IG+LMLK+P+REAT  EIL+VH+ EH  +LEKT    REQLLKETE G
Sbjct: 103 LINDPTLSGVDNIGDLMLKLPIREATMNEILEVHSIEHFKYLEKTSNDNREQLLKETENG 162

Query: 166 DSVYFNNDSLLSAKLSCGGAIEACKAVVEGRVKNALAVIRPPGHHAEPEIAGGFCLFSNV 225
           DSVYFNNDS  SAKLSCGGAIEACKAVVEGRVKNA+AV+RPPGHH+EPE AGGFCLFSNV
Sbjct: 163 DSVYFNNDSFQSAKLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHSEPESAGGFCLFSNV 222

Query: 226 AVAAQNILKNYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVH 285
           AVA +NILKNYPESVR+++ILDWDIHHGNGTQKAFY+D+ VLY+SLHR+ELGKYYPGT+ 
Sbjct: 223 AVATKNILKNYPESVRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQ 282

Query: 286 GNYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAAD 345
           G Y+QTGEGKGEGFNCNI WP G +GDAEYMWAF+QVVMPM REFQPDLVIISSGFDAAD
Sbjct: 283 GQYDQTGEGKGEGFNCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAAD 342

Query: 346 GDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDSIAKSALGVAKILIGEPPDE 405
           GDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLD+IA+SAL V+KILIGEPPDE
Sbjct: 343 GDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVSKILIGEPPDE 402

Query: 406 LPHPTQQPKPEAIETIETVIRTQSKYWNCFKSTHSNDGCNFKEEVTESTISKNFPXXXXX 465
           LP P + PKPE IE I+ +IR QSKYW CF+  H N GCNFKE + +S ISKNFP     
Sbjct: 403 LPDPLKDPKPEVIEMIDKIIRLQSKYWKCFRRRHGNLGCNFKESINDSLISKNFPLQTAI 462

Query: 466 XXXXXXXXSEKFGFVTLPLLNME 488
                    ++  F+TLP+ N +
Sbjct: 463 RNFQSKKLFDELNFLTLPIKNFQ 485

 Score =  320 bits (821), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 143/222 (64%), Positives = 183/222 (82%), Gaps = 2/222 (0%)

Query: 491 QDTVICSPNIYDAETVVVCVHDTPEIWAQRNPITGTIDPSTSIIVDTTLDIIKWSLQRKY 550
           ++T++CSP I  ++T+VV VHD+P++W +R+  TG +D S++II+D+TLD IKWSL R Y
Sbjct: 576 ENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSLDRNY 635

Query: 551 SVIDVNIPQSLFEQDNYSAMITSQEVLVYIWDNYLKYFPSLAKVAFIGVGDAYSGIVHLL 610
            VID+NIPQ+LFEQDNYS+++ +QE L+  WDNYLKYFP + K+ FIG GDA++GIVHLL
Sbjct: 636 GVIDINIPQTLFEQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDAHAGIVHLL 695

Query: 611 GHRDTRSVVKAAVSFVDTKPLKSLVPLVDESLGNWYFKNSLVFTSKNHSCWGTDGNENKK 670
           GHRDTRSVVK+ ++F+  KPLK+LVPLVDE+L +WYFKNSLVFT KNH  W    NENKK
Sbjct: 696 GHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWA--DNENKK 753

Query: 671 PRKRFGRVLKCDTTGMNNIVEERFQEATDFILDSFEEWSDSE 712
           PRK+FGRVL+    G+ N++EERF EATDFILDSFEEWSD E
Sbjct: 754 PRKKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE 795

>Kpol_1003.37 s1003
           complement(91621..92301,92861..92869,92912..93958) [1737
           bp, 578 aa] {ON}
           complement(91621..92301,92861..92869,92912..93958) [1737
           nt, 579 aa]
          Length = 578

 Score =  503 bits (1295), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 225/295 (76%), Positives = 260/295 (88%)

Query: 46  VIVPEVPPRIHYTQLKTGLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENG 105
           VIVP   P++HYT LKTGLCYDVRMRYHAKI+TS FEYIDPHPEDPRR+YRIYKILAENG
Sbjct: 55  VIVPIRQPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENG 114

Query: 106 LIRDPTLSGVDEIGELMLKIPVREATAEEILQVHTKEHLAFLEKTPKMTREQLLKETETG 165
           LI+D  LSG+D+IG++MLKIPVR AT EEIL VHT+EHL F+E     +RE+L+K TE  
Sbjct: 115 LIKDENLSGLDDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLTEKA 174

Query: 166 DSVYFNNDSLLSAKLSCGGAIEACKAVVEGRVKNALAVIRPPGHHAEPEIAGGFCLFSNV 225
           DSVY+NNDS  SAKLSCGG IEAC+AVVEGRVKN+LA++RPPGHHAEP+ AGGFCLFSNV
Sbjct: 175 DSVYYNNDSYYSAKLSCGGVIEACRAVVEGRVKNSLAIVRPPGHHAEPQAAGGFCLFSNV 234

Query: 226 AVAAQNILKNYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVH 285
           +VAA++IL+ YPESVR+I+ILDWDIHHGNGTQKAFY D  VLY+SLHRYE   +YPGT+H
Sbjct: 235 SVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIH 294

Query: 286 GNYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSG 340
           G Y+Q GEGKGEGFNCNI WP GG+GDAEYMWAF+ VVMP+GREF+PDLVI+SSG
Sbjct: 295 GRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349

 Score =  267 bits (682), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 117/226 (51%), Positives = 170/226 (75%), Gaps = 2/226 (0%)

Query: 487 MEVPQDTVICSPNIYDAETVVVCVHDTPEIWAQRNPITGTIDPSTSIIVDTTLDIIKWSL 546
           M+  +  V+ S  I+ AET+V+ VHDTPE+W  R+ ITG +DPSTS+++DT++  IKW+ 
Sbjct: 353 MKPHEKLVLASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAA 412

Query: 547 QRKYSVIDVNIPQSLFEQDNYSAMITSQEVLVYIWDNYLKYFPSLAKVAFIGVGDAYSGI 606
            R YS++D+NIP+S  E++ +S+   + E+++ +WDN+L+Y  +L K+ FIG+G++Y GI
Sbjct: 413 DRNYSILDINIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGESYQGI 472

Query: 607 VHLLGHRDTRSVVKAAVSFVDTKPLKSLVPLVDESLGNWYFKNSLVFTSKNHSCWGTDGN 666
           VHL+G RD R + KA ++FV   PLKSL    DE++ +WYFKNSLVFT+ +H+CW    +
Sbjct: 473 VHLIGERDLRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCWKE--S 530

Query: 667 ENKKPRKRFGRVLKCDTTGMNNIVEERFQEATDFILDSFEEWSDSE 712
           E K+PRK+FGRVLK D+ G+ +I+ ERF EATDFILD+FEEWSD E
Sbjct: 531 EEKRPRKKFGRVLKSDSDGIISIINERFDEATDFILDAFEEWSDEE 576

>TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}
           Anc_8.153 YGL194C
          Length = 450

 Score =  144 bits (364), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 105/363 (28%), Positives = 176/363 (48%), Gaps = 35/363 (9%)

Query: 60  LKTGLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIG 119
            + G  Y  R+ YH     S + Y   HP  P R      +++  GL             
Sbjct: 19  FEFGSTYSPRVSYHYNPKVSNYHYGVKHPMKPFRFMLTDHLVSSYGL------------H 66

Query: 120 ELMLKIPVREATAEEILQVHTKEHLAFLEKTP-----KMTREQLLKETETGDSVYFNNDS 174
            +M     REAT EE+LQ H+++++ FL K       KM R    K     D   F N  
Sbjct: 67  NIMDLYETREATKEELLQFHSEDYVEFLSKVSPDNISKMPRGTFDKYNIGDDCPIFQN-I 125

Query: 175 LLSAKLSCGGAIEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNIL 233
               KL  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N+L
Sbjct: 126 YEYCKLYAGASLDASRKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLATLNLL 183

Query: 234 KNYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGE 293
           + +P    R++ +D D+HHG+G Q+AFY+ +RV  VS H+Y  G+++PGT  GNY++ G 
Sbjct: 184 RYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNYDEIGC 236

Query: 294 GKGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCH 353
            +G+ F  N+P    G+ D  Y+  F+ V+ P+   F+P  +I   G D+   D +G  +
Sbjct: 237 AEGKHFAMNVPLN-DGIDDDSYINLFKSVMEPIITSFKPTAIIQQCGADSLGHDRLGCFN 295

Query: 354 VSPSCYGHMTHMLKSLARGNLCVVLEGGY---NLDSIAKSALGVAK--ILIGEPPDELPH 408
           ++   +G     ++S     + VV  GGY   N+  +     G+    +L  E P+++P 
Sbjct: 296 LNIKAHGECVKFIRSFGIP-MVVVGGGGYTPRNVSRLYAYETGILNNVLLQSELPEDMPF 354

Query: 409 PTQ 411
             Q
Sbjct: 355 RNQ 357

>KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {ON}
           Anc_8.153 YGL194C
          Length = 453

 Score =  144 bits (362), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 105/356 (29%), Positives = 176/356 (49%), Gaps = 35/356 (9%)

Query: 63  GLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELM 122
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL +            +M
Sbjct: 23  GSSYTPRVSYHFNPKVSNYHYGVNHPMKPFRLMLTDHLVSSYGLHK------------IM 70

Query: 123 LKIPVREATAEEILQVHTKEHLAFLEKTP-----KMTREQLLKETETGDSVYFNNDSLLS 177
                REAT EE+ Q H+ ++L FLEK       K+ R  L K     D   F N    S
Sbjct: 71  DLYETREATKEEMSQFHSSDYLDFLEKISPDTLNKIPRGTLEKFNIGSDCPIFENIYDYS 130

Query: 178 AKLSCGGAIEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNY 236
             L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ ++  N+L+ +
Sbjct: 131 T-LYTGASLDASRKLING--QSEIAINWSGGLHHAKKNNPSGFCYINDIVLSILNLLRYH 187

Query: 237 PESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKG 296
           P    R++ +D D+HHG+G Q+AFY+ +RV  +S H+Y  G+++PGT  GNY++ G   G
Sbjct: 188 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYN-GEFFPGT--GNYDEIGCSGG 240

Query: 297 EGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSP 356
           + F  N+P    G+ D  Y+  F+ ++ P+   +QP ++I   G D+   D +G  +++ 
Sbjct: 241 KHFAMNVPLN-DGIDDDSYIKLFKSIIDPLITSYQPTVIIQQCGADSLGHDRLGCFNLNI 299

Query: 357 SCYGHMTHMLKSLARGNLCVVLEGGY---NLDSIAKSALGVAK--ILIGEPPDELP 407
             +G     + S     + VV  GGY   N+  +     G+    +L  E P+ELP
Sbjct: 300 KAHGECVKFVSSFGIP-MLVVGGGGYTPRNVSRLWAYETGILNNVLLPKELPEELP 354

>Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON}
           (11759..13120) [1362 nt, 454 aa]
          Length = 453

 Score =  142 bits (358), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 104/356 (29%), Positives = 180/356 (50%), Gaps = 35/356 (9%)

Query: 63  GLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELM 122
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL +            +M
Sbjct: 25  GSAYCPRVSYHFNPKVSNYHYGVKHPMKPFRLMLTDHLVSSYGLHK------------IM 72

Query: 123 LKIPVREATAEEILQVHTKEHLAFLEK-TP----KMTREQLLKETETGDSVYFNNDSLLS 177
                R AT +E+L  H+ ++++FL+K TP    KM R  L K     D   F N    S
Sbjct: 73  DLYETRSATKDELLDFHSDDYVSFLQKVTPENLSKMPRGTLEKYNIGDDCPIFQNLYDYS 132

Query: 178 AKLSCGGAIEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNY 236
           A L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N+L+ +
Sbjct: 133 A-LYAGASLDASRKLINN--QSDIAINWSGGLHHAKKTNPSGFCYVNDIVLAILNLLRYH 189

Query: 237 PESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKG 296
           P    R++ +D D+HHG+G Q+AFY+ +RV  +S H+Y  G+++PGT  GNY++ G  +G
Sbjct: 190 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYN-GEFFPGT--GNYDEIGCAQG 242

Query: 297 EGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSP 356
           + F  N+P    G+ D  Y+  F+ ++ P+   ++P ++I   G D+   D +G  +++ 
Sbjct: 243 KHFAMNVPLE-DGIDDDSYINLFKSIIDPLITSYKPTVIIQQCGADSLGHDRLGCFNLNI 301

Query: 357 SCYGHMTHMLKSLARGNLCVVLEGGY---NLDSIAKSALGVAK--ILIGEPPDELP 407
             +G     ++S     L VV  GGY   N+  +     GV    +L  E P+++P
Sbjct: 302 KAHGECVKFIRSFGIPML-VVGGGGYTPRNVSRLWTYETGVLNNVLLPAELPEDIP 356

>TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {ON}
           Anc_8.153 YGL194C
          Length = 446

 Score =  140 bits (354), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 107/356 (30%), Positives = 178/356 (50%), Gaps = 35/356 (9%)

Query: 63  GLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELM 122
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL +            +M
Sbjct: 21  GSAYCPRVSYHFNPKVSNYHYGVRHPMKPFRLLLTDHLVSSYGLHK------------IM 68

Query: 123 LKIPVREATAEEILQVHTKEHLAFLEK-TP----KMTREQLLKETETGDSVYFNNDSLLS 177
                R AT+EEI + HT++++ FL K TP    KM R  L K     D   F N     
Sbjct: 69  DLYETRVATSEEIAEFHTQDYIDFLHKVTPENLSKMPRGTLEKFNIGDDCPIFQN-LFNY 127

Query: 178 AKLSCGGAIEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNY 236
            KL  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N+L+ +
Sbjct: 128 CKLYAGASLDAARKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLAILNLLRYH 185

Query: 237 PESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKG 296
           P    R++ +D D+HHG+G Q+AFY+ +RV  VS H+Y  G+++PGT  GN+++ G   G
Sbjct: 186 P----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--GNHDEVGCANG 238

Query: 297 EGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSP 356
           + F  N+P    G+ D  Y+  F+ ++ P+   ++P ++I   G D+   D IG  +++ 
Sbjct: 239 KHFAMNVPLE-DGIDDDSYINLFKSIMDPLITSYKPTVIIQQCGADSLGHDRIGCFNLTI 297

Query: 357 SCYGHMTHMLKSLARGNLCVVLEGGY---NLDSIAKSALGVAK--ILIGEPPDELP 407
             +G     ++S     L VV  GGY   N+  +     GV    +L  E P+E+P
Sbjct: 298 KGHGECVKFIRSFGIPML-VVGGGGYTPRNVSRLWAYETGVLNNVLLSKELPEEIP 352

>NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa]
           {ON} Anc_8.153
          Length = 451

 Score =  140 bits (352), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 103/356 (28%), Positives = 179/356 (50%), Gaps = 35/356 (9%)

Query: 63  GLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELM 122
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL +            +M
Sbjct: 23  GSSYTPRVSYHFNPKVSNYHYGVRHPMKPFRLMLTDHLVSSYGLHK------------IM 70

Query: 123 LKIPVREATAEEILQVHTKEHLAFLEK-TP----KMTREQLLKETETGDSVYFNNDSLLS 177
                REAT EE+ Q H+++++ FL K TP    KM R  L K     D   F N    S
Sbjct: 71  DLYETREATREEMSQFHSQDYIEFLSKVTPENLSKMPRGTLEKFNIGDDCPIFQNIYDYS 130

Query: 178 AKLSCGGAIEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNY 236
             L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ ++  N+L+ +
Sbjct: 131 T-LYTGASLDASRKLIND--QSDIAINWSGGLHHAKKNNPSGFCYVNDIVLSILNLLRYH 187

Query: 237 PESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKG 296
           P    R++ +D D+HHG+G Q+AFY+ +RV  +S H++  G+++PGT  G++++ G  KG
Sbjct: 188 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKFN-GEFFPGT--GDFDEIGCAKG 240

Query: 297 EGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSP 356
           + F  N+P    G+ D  Y+  F+ ++ P+   ++P ++I   G D+   D +G  +++ 
Sbjct: 241 KHFAMNVPLE-DGIDDDSYINLFKSIIDPLITAYKPTVIIQQCGADSLGHDRLGCFNLNI 299

Query: 357 SCYGHMTHMLKSLARGNLCVVLEGGY---NLDSIAKSALGVAK--ILIGEPPDELP 407
             +G     +KS     + VV  GGY   N+  +     GV    +L  E P+E+P
Sbjct: 300 KAHGECVKFVKSFGIP-MLVVGGGGYTPRNVSRLWTYETGVLNNVLLPSEIPEEIP 354

>TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {ON}
           Anc_8.153 YGL194C
          Length = 456

 Score =  140 bits (352), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 99/343 (28%), Positives = 178/343 (51%), Gaps = 33/343 (9%)

Query: 53  PRIHYTQLKTGLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTL 112
           P+ +Y   + G  Y  R+ YH     S + +   HP  P R+           ++ D  +
Sbjct: 16  PQFNY---EFGSTYAPRVSYHFNPKVSSYHFGVRHPMKPFRL-----------MLTDHLV 61

Query: 113 SGVDEIGELMLKIPVREATAEEILQVHTKEHLAFLEKTP-----KMTREQLLKETETGDS 167
           SG   + ++M     R+A+ +E+L+ HT +++ FL+K       KM R  L K     D 
Sbjct: 62  SGYG-LHKIMDLYETRKASDDELLEFHTDDYINFLKKVNPDNVNKMPRGTLDKFNIGDDC 120

Query: 168 VYFNNDSLLSAKLSCGGAIEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVA 226
             F+N    S+ L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ 
Sbjct: 121 PIFHNLYEYSS-LYTGASLDASRKLLNG--QSDIAINWSGGLHHAKKTSPSGFCYINDIV 177

Query: 227 VAAQNILKNYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHG 286
           ++  N+L+ +P    R++ +D D+HHG+G Q+AFY+ +RV  VS H+Y  G+++PGT  G
Sbjct: 178 LSILNLLRFHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--G 230

Query: 287 NYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADG 346
           NY++TG   G+ F  N+P    G+ D  Y+  F+ ++ P+   + P ++I   G D+   
Sbjct: 231 NYDETGCSNGKHFALNVPLK-DGIDDDSYINLFKSIIDPLITSYNPTVIIQQCGADSLGH 289

Query: 347 DTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDSIAK 389
           D +G  +++   +G     +KS     L VV  GGY   ++++
Sbjct: 290 DRLGCFNLNIKAHGECVKFVKSFGIPML-VVGGGGYTPKNVSR 331

>NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153
          Length = 453

 Score =  137 bits (346), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 101/351 (28%), Positives = 178/351 (50%), Gaps = 35/351 (9%)

Query: 66  YDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKI 125
           Y  R+ YH     S + Y   HP  P R+     +++  GL +            +M   
Sbjct: 28  YTPRVSYHFNPKVSNYHYGVKHPMKPFRLMLTDHLVSSYGLHK------------IMDLY 75

Query: 126 PVREATAEEILQVHTKEHLAFLEK-TP----KMTREQLLKETETGDSVYFNNDSLLSAKL 180
             R AT EE++Q H++++L FL K TP    KM R  L K     D   F N    S  L
Sbjct: 76  ETRPATNEEMVQFHSEDYLDFLSKVTPENLSKMPRGTLEKFNIGDDCPIFQNLYDYST-L 134

Query: 181 SCGGAIEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNYPES 239
             G +++A + ++    ++ +A+    G HHA+     GFC  +++ ++  N+L+ +P  
Sbjct: 135 YTGASLDATRKLIND--QSDIAINWSGGLHHAKKNNPSGFCYINDIVLSIVNLLRYHP-- 190

Query: 240 VRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGF 299
             R++ +D D+HHG+G Q+AFY+ +RV  +S H++  G+++PGT  G+Y++TG  KG+ F
Sbjct: 191 --RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKFN-GEFFPGT--GDYDETGCAKGKHF 245

Query: 300 NCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCY 359
             N+P    G+ D  Y+  F+ ++ P+   ++P +++   G D+   D +G  +++   +
Sbjct: 246 AMNVPLE-DGIDDDSYINLFKSIMDPLITSYKPTVIVQQCGADSLGHDRLGCFNLNIKGH 304

Query: 360 GHMTHMLKSLARGNLCVVLEGGY---NLDSIAKSALGVAKILIGEPPDELP 407
           G     +KS     + VV  GGY   N+  +     G+   ++   P+ELP
Sbjct: 305 GECVKFIKSFGIP-MLVVGGGGYTPRNVSRLWTYETGILNNVL--LPNELP 352

>KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {ON}
           highly similar to uniprot|P53096 Saccharomyces
           cerevisiae YGL194C HOS2 Histone deacetylase required for
           gene activation via specific deacetylation of lysines in
           H3 and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 449

 Score =  137 bits (345), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 96/355 (27%), Positives = 174/355 (49%), Gaps = 29/355 (8%)

Query: 59  QLKTGLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEI 118
           + + G  Y+  + YH     S F Y   HP  P R+     +++  GL +          
Sbjct: 17  RFEFGAPYEPNVSYHFNSDVSQFHYGVRHPMKPFRLMLTDHLVSSYGLHK---------- 66

Query: 119 GELMLKIPVREATAEEILQVHTKEHLAFLEKTPKMTREQL----LKETETGDSVYFNNDS 174
             +M     R AT EE+ + H  +++ FL K       +L    L++   GD        
Sbjct: 67  --IMDLYETRPATREELCEFHADDYVEFLAKVSPDNLSKLPRGTLEKFNIGDDCPIFQGL 124

Query: 175 LLSAKLSCGGAIEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNIL 233
              + L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ ++  N+L
Sbjct: 125 YQYSTLYAGASLDATRKLING--QSEIAINWSGGLHHAKKSSPSGFCYVNDIVLSVLNLL 182

Query: 234 KNYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGE 293
           + +P    R++ +D D+HHG+G Q+AFY+ +RV  VS H+Y  G+++PGT  GN ++TG 
Sbjct: 183 RYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNLDETGC 235

Query: 294 GKGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCH 353
            +G+ F  N+P    G+ D  Y+  F+ ++ P+   F+P ++I   G D+   D +G  +
Sbjct: 236 SRGKHFALNVPLE-DGIDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLGHDRLGCFN 294

Query: 354 VSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDSIAKSALGVAKILIG-EPPDELP 407
           ++   +G     +KS     L V+  GGY   ++++       +L G   P E+P
Sbjct: 295 LNVKAHGECVRFVKSFGIPML-VLGGGGYTPRNVSRLWTYETALLNGVSVPQEIP 348

>SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 448

 Score =  137 bits (344), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 96/361 (26%), Positives = 179/361 (49%), Gaps = 33/361 (9%)

Query: 57  YTQLKTGLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVD 116
           Y   + G  Y   + YH     S + Y   HP  P R+     +++  GL +        
Sbjct: 14  YLPYEFGSTYSPHVSYHFNSDVSQYHYGVRHPMKPFRLMLTDHLVSSYGLHK-------- 65

Query: 117 EIGELMLKIPVREATAEEILQVHTKEHLAFLEKTPKMTREQL----LKETETGDSVYFNN 172
               +M     REAT +E+L+ H+ +++ FL K    T  ++    L++   GD      
Sbjct: 66  ----IMDLYETREATRDELLEFHSADYIEFLSKVSPDTLSKMPRGSLEKFNIGDDCPIFQ 121

Query: 173 DSLLSAKLSCGGAIEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQN 231
                + L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ +A  N
Sbjct: 122 GIFEYSSLYAGASLDASRKLIAG--QSEIAINWSGGLHHAKKAKPSGFCYVNDIVLAILN 179

Query: 232 ILKNYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQT 291
           +L+ +P    R++ +D D+HHG+G Q+AFY+ +RV  VS H+Y  G+++PGT  G++++ 
Sbjct: 180 LLRFHP----RVLYVDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDFDEI 232

Query: 292 GEGKGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQ 351
           G  +G+ F  N+P    G+ D  Y+  F+ ++ P+   ++P ++I   G D+   D +G 
Sbjct: 233 GCSRGKHFALNVPLD-DGIDDDSYINLFKSIMDPLITSYKPTVIIQQCGADSLGHDRLGC 291

Query: 352 CHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDSIAK-----SALGVAKILIGEPPDEL 406
            +++   +G     +KS     L VV  GGY   ++++     + L    +L  E P+ +
Sbjct: 292 FNLNIRAHGECVKFVKSFGIPML-VVGGGGYTPRNVSRLWTYETGLLNDVLLPQEIPENI 350

Query: 407 P 407
           P
Sbjct: 351 P 351

>KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 452

 Score =  137 bits (344), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 92/332 (27%), Positives = 167/332 (50%), Gaps = 28/332 (8%)

Query: 63  GLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELM 122
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL +            +M
Sbjct: 24  GTSYSPRVSYHFNSKVSQYHYGVKHPMKPFRLMLTDHLVSAYGLHK------------VM 71

Query: 123 LKIPVREATAEEILQVHTKEHLAFLEKTPKMTREQL----LKETETGDSVYFNNDSLLSA 178
                R AT +E+ + H+++++ FL K    T  +L    L++   GD           A
Sbjct: 72  DLYETRSATKDELTKFHSEDYVNFLAKVTPDTLNKLPRGSLEKFNIGDDCPIFQGMFDYA 131

Query: 179 KLSCGGAIEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNYP 237
            L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ +A  N+L+ +P
Sbjct: 132 ALYAGASLDASRKLLNG--QSEIAINWSGGLHHAKKNNPSGFCYVNDIVLAIVNLLRYHP 189

Query: 238 ESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGE 297
               R++ +D D+HHG+G Q+AFY+ +RV  VS H+Y  G+++PGT  G+ ++ G  +G+
Sbjct: 190 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGCSRGK 242

Query: 298 GFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPS 357
            F  N+P    G+ D  Y+  F+ ++ P+   F+P ++I   G D+   D +G  +++  
Sbjct: 243 HFALNVPLQ-DGIEDDSYINLFKSIIDPVITSFRPSVIIQQCGADSLGHDRLGCFNLNIK 301

Query: 358 CYGHMTHMLKSLARGNLCVVLEGGYNLDSIAK 389
            +G     +KS     L VV  GGY   ++++
Sbjct: 302 AHGECVRFVKSFGVPML-VVGGGGYTPRNVSR 332

>AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL194C
           (HOS2)
          Length = 449

 Score =  136 bits (343), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 93/333 (27%), Positives = 166/333 (49%), Gaps = 30/333 (9%)

Query: 63  GLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELM 122
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL +            +M
Sbjct: 21  GASYTPRVSYHYNSRVSQYHYGVRHPMKPFRLMLTDHLVSRYGLHK------------VM 68

Query: 123 LKIPVREATAEEILQVHTKEHLAFL-----EKTPKMTREQLLKETETGDSVYFNNDSLLS 177
                R AT EE+L  H ++++ FL     E   K+ R  L K    GD           
Sbjct: 69  DLYETRAATKEEVLAFHAQDYVDFLSHVAPENLNKLPRGSLEK-FNIGDDCPIFQGLFEY 127

Query: 178 AKLSCGGAIEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNY 236
           + L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ +A  N+L+ +
Sbjct: 128 SMLYAGASLDASRKLING--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLAILNLLRYH 185

Query: 237 PESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKG 296
           P    R++ +D D+HHG+G Q+AFY+ +RV  VS H+Y  G+++PGT  G+ ++ G  +G
Sbjct: 186 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGCSRG 238

Query: 297 EGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSP 356
           + F+ N+P    G+ D  Y+  F+ ++ P+   ++P ++I   G D+   D +G  +++ 
Sbjct: 239 KHFSLNVPLN-DGIDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSLGHDRLGCFNLNI 297

Query: 357 SCYGHMTHMLKSLARGNLCVVLEGGYNLDSIAK 389
             +G     +KS     LCV   GGY   ++++
Sbjct: 298 RAHGECVKFVKSFGIPMLCVG-GGGYTPRNVSR 329

>YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}
           HOS2Histone deacetylase required for gene activation via
           specific deacetylation of lysines in H3 and H4 histone
           tails; subunit of the Set3 complex, a meiotic-specific
           repressor of sporulation specific genes that contains
           deacetylase activity
          Length = 452

 Score =  136 bits (343), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 91/330 (27%), Positives = 164/330 (49%), Gaps = 28/330 (8%)

Query: 65  CYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLK 124
            Y  R+ YH     S++ Y   HP  P R+     +++  GL +            +M  
Sbjct: 23  AYSPRVSYHFNSKVSHYHYGVKHPMKPFRLMLTDHLVSSYGLHK------------IMDL 70

Query: 125 IPVREATAEEILQVHTKEHLAFLEKTPKMTREQL----LKETETGDSVYFNNDSLLSAKL 180
              R AT +E+LQ H+++++ FL K       +L    L+    GD      +      L
Sbjct: 71  YETRSATRDELLQFHSEDYVNFLSKVSPENANKLPRGTLENFNIGDDCPIFQNLYDYTTL 130

Query: 181 SCGGAIEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNYPES 239
             G +++A + ++    ++ +A+    G HHA+     GFC  +++ ++  N+L+ +P  
Sbjct: 131 YTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP-- 186

Query: 240 VRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGF 299
             RI+ +D D+HHG+G Q+AFY+ +RV  +S H+Y  G+++PGT  G+  + G  KG+ F
Sbjct: 187 --RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHF 241

Query: 300 NCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCY 359
             N+P    G+ D  Y+  F+ +V P+   F+P L++   G D+   D +G  +++   +
Sbjct: 242 ALNVPLE-DGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIKAH 300

Query: 360 GHMTHMLKSLARGNLCVVLEGGYNLDSIAK 389
           G     +KS     L VV  GGY   ++++
Sbjct: 301 GECVKFVKSFGLPML-VVGGGGYTPRNVSR 329

>CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194c HOS2 or uniprot|P32561 Saccharomyces cerevisiae
           YNL330c RPD3
          Length = 450

 Score =  136 bits (342), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 103/356 (28%), Positives = 181/356 (50%), Gaps = 35/356 (9%)

Query: 63  GLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELM 122
           G  Y  R+ YH     S++ Y   HP  P R+           ++ D  +SG   + ++M
Sbjct: 21  GSNYAPRVSYHINPEVSHYHYGVRHPMKPFRL-----------MLTDHLVSGYG-LHKIM 68

Query: 123 LKIPVREATAEEILQVHTKEHLAFLEK-TP----KMTREQLLKETETGDSVYFNNDSLLS 177
                R+ATAEE+ + H+++++ FL K TP    K+ R  L K     D   F N    S
Sbjct: 69  DLYKTRKATAEEMEEFHSEDYVNFLSKVTPENLSKLPRGTLEKFNIGDDCPIFPNIFQYS 128

Query: 178 AKLSCGGAIEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNY 236
           + L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N+L+ +
Sbjct: 129 S-LYTGASLDASRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYINDIVLAILNLLRYH 185

Query: 237 PESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKG 296
           P    R++ +D D+HHG+G Q+AFY+ +RV  +S H+Y  G+++PGT  G  ++TG   G
Sbjct: 186 P----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYN-GEFFPGT--GKNDETGCADG 238

Query: 297 EGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSP 356
           + F  N+P    G+ D  Y+  F+ ++ P+   F+P +++   G D+   D +G  +++ 
Sbjct: 239 KHFAMNVPLE-DGIDDDSYINLFKSIIDPLITTFKPTVILQQCGADSLGHDRLGCFNLNI 297

Query: 357 SCYGHMTHMLKSLARGNLCVVLEGGY---NLDSIAKSALGVAK--ILIGEPPDELP 407
             +G     ++S     + VV  GGY   N+  +     G+    +L  E PD LP
Sbjct: 298 KAHGECVKFVRSFGIP-MLVVGGGGYTPRNVSRLWTYETGILNNVLLPEELPDNLP 352

>KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.153
           YGL194C
          Length = 451

 Score =  135 bits (341), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 96/337 (28%), Positives = 171/337 (50%), Gaps = 30/337 (8%)

Query: 59  QLKTGLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEI 118
           Q + G    +R+ YH     S++ Y   HP  P R+           ++ D  +SG   +
Sbjct: 18  QFELGAARPLRVSYHFNPKVSHYHYGVKHPMKPFRL-----------MLTDHLVSGYG-M 65

Query: 119 GELMLKIPVREATAEEILQVHTKEHLAFLEKTP-----KMTREQLLKETETGDSVYFNND 173
            ++M     R AT +E+ + HT++++ FL+K       K+ R  L K     D   F N 
Sbjct: 66  HKVMDLYETRAATNDELTEFHTEDYVHFLQKVSPDNLGKLPRGTLEKFNIGDDCPIFQN- 124

Query: 174 SLLSAKLSCGGAIEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNI 232
               A L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ ++  N+
Sbjct: 125 LYDYATLYTGASLDATRKLING--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSIVNL 182

Query: 233 LKNYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTG 292
           L+ +P    R++ +D D+HHG+G Q+AFY+ +RV  +S H+Y  G ++PGT  G+ ++TG
Sbjct: 183 LRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYN-GDFFPGT--GDIDETG 235

Query: 293 EGKGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQC 352
              GE F  N+P    G+ D  Y+  F+ V+ P+   + P ++I   G D+   D +G  
Sbjct: 236 CDAGERFALNVPLE-DGIDDDSYINLFKSVIGPLITAYNPTVIIQQCGADSLGHDRLGCF 294

Query: 353 HVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDSIAK 389
           +++   +G     +KS     L VV  GGY   ++++
Sbjct: 295 NLNIKAHGECVKFVKSFGIPML-VVGGGGYTPRNVSR 330

>Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {ON}
           complement(25267..26568) [1302 nt, 434 aa]
          Length = 433

 Score =  135 bits (340), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 91/326 (27%), Positives = 158/326 (48%), Gaps = 28/326 (8%)

Query: 69  RMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPVR 128
           R+ Y        + Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 67

Query: 129 EATAEEILQVHTKEHLAFLEKTPKMTREQLLKET---ETGDSVYFNNDSLLSAKLSCGGA 185
            AT +E+ Q HT E++ FL +      +   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 186 IEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIM 244
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 245 ILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIP 304
            +D D+HHG+G ++AFY+ +RV+  S H+Y  G+++PGT  G    TG GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKNYAVNVP 237

Query: 305 WPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 364
               G+ DA Y   F+ V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYRAVFESVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 365 MLKSLARGNLCVVLEGGYNLDSIAKS 390
            +KS     L VV  GGY + ++A++
Sbjct: 297 FVKSFGI-PLMVVGGGGYTMRNVART 321

>Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  135 bits (340), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 91/330 (27%), Positives = 164/330 (49%), Gaps = 28/330 (8%)

Query: 65  CYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLK 124
            Y  R+ YH     S++ Y   HP  P R+     +++  GL +            +M  
Sbjct: 23  AYSPRVSYHFNSKVSHYHYGVKHPMKPFRLMLTDHLVSSYGLHK------------IMDL 70

Query: 125 IPVREATAEEILQVHTKEHLAFLEKTPKMTREQL----LKETETGDSVYFNNDSLLSAKL 180
              R AT +E+LQ H+++++ FL K       +L    L+    GD      +      L
Sbjct: 71  YETRSATRDELLQFHSEDYVNFLSKVSPDNANKLPRGTLENFNIGDDCPIFQNLYDYTTL 130

Query: 181 SCGGAIEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNYPES 239
             G +++A + ++    ++ +A+    G HHA+     GFC  +++ ++  N+L+ +P  
Sbjct: 131 YTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP-- 186

Query: 240 VRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGF 299
             RI+ +D D+HHG+G Q+AFY+ +RV  +S H+Y  G+++PGT  G+  + G  KG+ F
Sbjct: 187 --RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHF 241

Query: 300 NCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCY 359
             N+P    G+ D  Y+  F+ +V P+   F+P L++   G D+   D +G  +++   +
Sbjct: 242 ALNVPLE-DGIDDDSYINLFKSIVDPLIITFKPTLIVQQCGADSLGHDRLGCFNLNIKAH 300

Query: 360 GHMTHMLKSLARGNLCVVLEGGYNLDSIAK 389
           G     +KS     L VV  GGY   ++++
Sbjct: 301 GECVKFVKSFGLPML-VVGGGGYTPRNVSR 329

>Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL330C
           (RPD3) - histone deacetylase [contig 124] FULL
          Length = 432

 Score =  134 bits (337), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 95/344 (27%), Positives = 166/344 (48%), Gaps = 28/344 (8%)

Query: 51  VPPRIHYTQLKTGLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDP 110
           V  ++ + +LK       R+ Y      S + Y   HP  P RI   + ++   GL +  
Sbjct: 2   VYQQLPFDELKVKSTNKERVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKK- 60

Query: 111 TLSGVDEIGELMLKIPVREATAEEILQVHTKEHLAFLEKTPKMTREQLLKET---ETGDS 167
                      M     + AT +E+ Q HT E++ FL +      E   KE+     GD 
Sbjct: 61  -----------MEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLEMFQKESVKFNVGDD 109

Query: 168 VYFNNDSLLSAKLSCGGAIEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVA 226
               +       +S GG++E    +  G+    +A+    G HHA+   A GFC  +++ 
Sbjct: 110 CPVFDGLYEYCSISGGGSMEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIV 167

Query: 227 VAAQNILKNYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHG 286
           +    +L+ +P    R++ +D D+HHG+G ++AFY+ +RV+  S H+Y  G+++PGT  G
Sbjct: 168 LGIIELLRYHP----RVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--G 219

Query: 287 NYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADG 346
               TG GKG+ +  N+P    G+ D+ Y   F+ V+  +   +QP  V++  G D+  G
Sbjct: 220 ELRDTGVGKGKYYAVNVPLR-DGIDDSTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSG 278

Query: 347 DTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDSIAKS 390
           D +G  ++S   + +  + +KS     L VV  GGY + ++A++
Sbjct: 279 DRLGCFNLSMRGHANCVNYVKSFGIPML-VVGGGGYTMRNVART 321

>Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  134 bits (338), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 90/329 (27%), Positives = 164/329 (49%), Gaps = 28/329 (8%)

Query: 66  YDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKI 125
           Y  R+ YH     S++ Y   HP  P R+     +++  GL +            +M   
Sbjct: 24  YSPRVSYHFNPKVSHYHYGVKHPMKPFRLMLTDHLVSSYGLHK------------IMDLY 71

Query: 126 PVREATAEEILQVHTKEHLAFLEKTPKMTREQL----LKETETGDSVYFNNDSLLSAKLS 181
             R AT +E+L+ H+++++ FL K       +L    L+    GD      +      L 
Sbjct: 72  ETRSATRDELLEFHSEDYINFLSKVSPDNSNKLPRGTLENFNIGDDCPIFQNLYDYTTLY 131

Query: 182 CGGAIEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNYPESV 240
            G +++A + ++    ++ +A+    G HHA+     GFC  +++ ++  N+L+ +P   
Sbjct: 132 TGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP--- 186

Query: 241 RRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFN 300
            RI+ +D D+HHG+G Q+AFY+ +RV  +S H+Y  G+++PGT  G+  + G  KG+ F 
Sbjct: 187 -RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHFA 242

Query: 301 CNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYG 360
            N+P    G+ D  Y+  F+ +V P+   F+P L++   G D+   D +G  +++   +G
Sbjct: 243 LNVPLE-DGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIKAHG 301

Query: 361 HMTHMLKSLARGNLCVVLEGGYNLDSIAK 389
                +KS     L VV  GGY   ++++
Sbjct: 302 ECVKFVKSFGLPML-VVGGGGYTPRNVSR 329

>TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8
           YNL330C
          Length = 433

 Score =  134 bits (336), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 89/326 (27%), Positives = 158/326 (48%), Gaps = 28/326 (8%)

Query: 69  RMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPVR 128
           R+ Y        + Y   HP  P RI   + ++   GL ++            M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKN------------MEIYRAK 67

Query: 129 EATAEEILQVHTKEHLAFLEKTPKMTREQLLKET---ETGDSVYFNNDSLLSAKLSCGGA 185
            AT +E+ Q HT E++ FL +      +   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 186 IEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIM 244
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCFLNDIVLGIIELLRYHP----RVL 181

Query: 245 ILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIP 304
            +D D+HHG+G ++AFY+ +RV+  S H+Y  G+++PGT  G    TG G G+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGNGKNYAVNVP 237

Query: 305 WPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 364
               G+ DA Y   F+ V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYRSVFEPVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 365 MLKSLARGNLCVVLEGGYNLDSIAKS 390
            +KS     + VV  GGY + ++A++
Sbjct: 297 FVKSFNI-PMMVVGGGGYTMRNVART 321

>Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  134 bits (336), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 91/326 (27%), Positives = 159/326 (48%), Gaps = 28/326 (8%)

Query: 69  RMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPVR 128
           R+ Y        + Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 129 EATAEEILQVHTKEHLAFLEKTPKMTREQLLKET---ETGDSVYFNNDSLLSAKLSCGGA 185
            AT +E+ Q HT E++ FL +      E   +E+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 186 IEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIM 244
           +E    +  G+    +AV    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 245 ILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIP 304
            +D D+HHG+G ++AFY+ +RV+  S H+Y  G+++PGT  G     G GKG+ ++ N+P
Sbjct: 182 YVDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDVGVGKGKNYSVNVP 237

Query: 305 WPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 364
               G+ DA Y   F+ VV  +   +QP  V++ +G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYRAVFEPVVKRIMDWYQPSAVVLQTGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 365 MLKSLARGNLCVVLEGGYNLDSIAKS 390
            +KS     + VV  GGY + ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8
          Length = 434

 Score =  134 bits (336), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 91/326 (27%), Positives = 158/326 (48%), Gaps = 28/326 (8%)

Query: 69  RMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPVR 128
           R+ Y        + Y   HP  P RI   + ++   GL +             M     +
Sbjct: 21  RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 68

Query: 129 EATAEEILQVHTKEHLAFLEKTPKMTREQLLKET---ETGDSVYFNNDSLLSAKLSCGGA 185
            AT +E+ Q HT E++ FL +      E   KE+     GD     +       +S GG+
Sbjct: 69  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 128

Query: 186 IEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIM 244
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 129 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRFHP----RVL 182

Query: 245 ILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIP 304
            +D D+HHG+G ++AFY+ +RV+  S H+Y  G+++PGT  G    TG GKG+ +  N+P
Sbjct: 183 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 238

Query: 305 WPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 364
               G+ DA Y   F+ V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 239 LR-DGIDDATYRNVFEPVIKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 297

Query: 365 MLKSLARGNLCVVLEGGYNLDSIAKS 390
            +KS     + VV  GGY + ++A++
Sbjct: 298 YVKSFGI-PMMVVGGGGYTMRNVART 322

>Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  133 bits (335), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 91/326 (27%), Positives = 157/326 (48%), Gaps = 28/326 (8%)

Query: 69  RMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPVR 128
           R+ Y        + Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 129 EATAEEILQVHTKEHLAFLEKTPKMTREQLLKET---ETGDSVYFNNDSLLSAKLSCGGA 185
            AT +E+ Q HT E++ FL +      E   +E+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 186 IEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIM 244
           +E    +  G+    +AV    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 245 ILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIP 304
            +D D+HHG+G ++AFYS +RV+  S H+Y  G+++PGT  G     G G G+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPGT--GELRDIGVGTGKNYAVNVP 237

Query: 305 WPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 364
               G+ DA Y   F+ V+  +   +QP  V++  G D+  GD +G  ++S   +G+  +
Sbjct: 238 LR-DGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHGNCVN 296

Query: 365 MLKSLARGNLCVVLEGGYNLDSIAKS 390
            +KS     + VV  GGY + ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {ON}
           highly similar to uniprot|P32561 Saccharomyces
           cerevisiae YNL330C RPD3 Histone deacetylase regulates
           transcription and silencing
          Length = 432

 Score =  133 bits (334), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 158/326 (48%), Gaps = 28/326 (8%)

Query: 69  RMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPVR 128
           R+ Y        + Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 129 EATAEEILQVHTKEHLAFLEKTPKMTREQLLKET---ETGDSVYFNNDSLLSAKLSCGGA 185
            AT +E+ Q HT E++ FL +      +   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 186 IEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIM 244
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 245 ILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIP 304
            +D D+HHG+G ++AFY+ +RV+  S H+Y  G+++PGT  G    TG GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 237

Query: 305 WPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 364
               G+ DA Y   F+ V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHANCVN 296

Query: 365 MLKSLARGNLCVVLEGGYNLDSIAKS 390
            +KS     L +V  GGY + ++A++
Sbjct: 297 YMKSFGV-PLMIVGGGGYTMRNVART 321

>AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL330C (RPD3)
          Length = 433

 Score =  133 bits (334), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 159/326 (48%), Gaps = 28/326 (8%)

Query: 69  RMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPVR 128
           R+ Y        + Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 129 EATAEEILQVHTKEHLAFLEKTPKMTREQLLKET---ETGDSVYFNNDSLLSAKLSCGGA 185
            AT +E+ Q HT E++ FL +      +   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 186 IEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIM 244
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 245 ILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIP 304
            +D D+HHG+G ++AFY+ +RV+  S H+Y  G+++PGT  G    TG GKG+ ++ N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 305 WPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 364
               G+ DA Y   F+ V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 365 MLKSLARGNLCVVLEGGYNLDSIAKS 390
            +KS     + VV  GGY + ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {ON}
           Anc_3.8
          Length = 433

 Score =  133 bits (334), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 92/326 (28%), Positives = 157/326 (48%), Gaps = 28/326 (8%)

Query: 69  RMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPVR 128
           R+ Y        + Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 129 EATAEEILQVHTKEHLAFLEKTPKMTREQLLKET---ETGDSVYFNNDSLLSAKLSCGGA 185
            AT +E+ Q HT E++ FL +      E   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 186 IEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIM 244
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 245 ILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIP 304
            +D D+HHG+G ++AFYS +RV+  S H+Y  G+++PGT  G     G GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPGT--GELRDVGVGKGKYYAVNVP 237

Query: 305 WPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 364
               G+ DA Y   F+ VV  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYRNVFEPVVKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 365 MLKSLARGNLCVVLEGGYNLDSIAKS 390
            +KS     + VV  GGY + ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON}
           similar to Ashbya gossypii AGR395W
          Length = 433

 Score =  133 bits (334), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 159/326 (48%), Gaps = 28/326 (8%)

Query: 69  RMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPVR 128
           R+ Y        + Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 129 EATAEEILQVHTKEHLAFLEKTPKMTREQLLKET---ETGDSVYFNNDSLLSAKLSCGGA 185
            AT +E+ Q HT E++ FL +      +   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 186 IEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIM 244
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 245 ILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIP 304
            +D D+HHG+G ++AFY+ +RV+  S H+Y  G+++PGT  G    TG GKG+ ++ N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 305 WPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 364
               G+ DA Y   F+ V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 365 MLKSLARGNLCVVLEGGYNLDSIAKS 390
            +KS     + VV  GGY + ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score =  132 bits (333), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 158/326 (48%), Gaps = 28/326 (8%)

Query: 69  RMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPVR 128
           R+ Y        + Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYNYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 129 EATAEEILQVHTKEHLAFLEKTPKMTREQLLKET---ETGDSVYFNNDSLLSAKLSCGGA 185
            AT +E+ Q HT E++ FL +      +   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 186 IEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIM 244
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKTEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 245 ILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIP 304
            +D D+HHG+G ++AFY+ +RV+  S H+Y  G+++PGT  G    TG GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 237

Query: 305 WPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 364
               G+ DA Y   F+ VV  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVVSRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSIRGHANCVN 296

Query: 365 MLKSLARGNLCVVLEGGYNLDSIAKS 390
            +KS     + +V  GGY + ++A++
Sbjct: 297 FVKSFGL-PMMIVGGGGYTMRNVART 321

>SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score =  132 bits (333), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 158/326 (48%), Gaps = 28/326 (8%)

Query: 69  RMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPVR 128
           R+ Y        + Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 129 EATAEEILQVHTKEHLAFLEKTPKMTREQLLKET---ETGDSVYFNNDSLLSAKLSCGGA 185
            AT +E+ Q HT E++ FL +          KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLNMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 186 IEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIM 244
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 245 ILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIP 304
            +D D+HHG+G ++AFY+ +RV+  S H+Y  G+++PGT  G    TG GKG+ ++ N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 305 WPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 364
               G+ DA Y   F+ V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHANCVN 296

Query: 365 MLKSLARGNLCVVLEGGYNLDSIAKS 390
            +KS     + VV  GGY + ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 432

 Score =  132 bits (333), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 91/326 (27%), Positives = 159/326 (48%), Gaps = 28/326 (8%)

Query: 69  RMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPVR 128
           R+ Y      S + Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKK------------MEIYRAK 67

Query: 129 EATAEEILQVHTKEHLAFLEKTPKMTREQLLKET---ETGDSVYFNNDSLLSAKLSCGGA 185
            AT +E+ Q H+ E++ FL +      E   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHSDEYIDFLSRVTPDNLEMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 186 IEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIM 244
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 245 ILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIP 304
            +D D+HHG+G ++AFY+ +RV+  S H+Y  G+++PGT  G    TG GKG+ ++ N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 305 WPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 364
               G+ D  Y   F+ V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDTTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 365 MLKSLARGNLCVVLEGGYNLDSIAKS 390
            +KS     L VV  GGY + ++A++
Sbjct: 297 YVKSFGIPML-VVGGGGYTMRNVART 321

>TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  132 bits (333), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 89/326 (27%), Positives = 157/326 (48%), Gaps = 28/326 (8%)

Query: 69  RMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPVR 128
           R+ Y        + Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 67

Query: 129 EATAEEILQVHTKEHLAFLEKTPKMTREQLLKET---ETGDSVYFNNDSLLSAKLSCGGA 185
            AT +E+ Q HT E++ FL +      +   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLFEYCSISGGGS 127

Query: 186 IEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIM 244
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 245 ILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIP 304
            +D D+HHG+G ++AFY+ +RV+  S H+Y  G+++PGT  G     G GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDVGIGKGKNYAVNVP 237

Query: 305 WPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 364
               G+ DA Y   F+ V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGMDDATYRSVFESVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 365 MLKSLARGNLCVVLEGGYNLDSIAKS 390
            +KS     + VV  GGY + ++A++
Sbjct: 297 FVKSFNI-PMMVVGGGGYTMRNVART 321

>KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  132 bits (332), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 91/326 (27%), Positives = 157/326 (48%), Gaps = 28/326 (8%)

Query: 69  RMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPVR 128
           R+ Y        + Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 129 EATAEEILQVHTKEHLAFLEKTPKMTREQLLKET---ETGDSVYFNNDSLLSAKLSCGGA 185
            AT +E+ Q HT E++ FL +      E   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 186 IEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIM 244
           +E+   +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MESAARLNRGKCD--IAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 245 ILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIP 304
            +D D+HHG+G ++AFY+ +RV+  S H+Y  G+++PGT  G     G GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGQNYAVNVP 237

Query: 305 WPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 364
               G+ DA Y   F+ VV  +   +QP  V++  G D+  GD +G  ++S   +    +
Sbjct: 238 LR-DGIDDATYRSVFEPVVGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHASCVN 296

Query: 365 MLKSLARGNLCVVLEGGYNLDSIAKS 390
            +KS     + VV  GGY + ++A++
Sbjct: 297 YVKSFNI-PMMVVGGGGYTMRNVART 321

>Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  132 bits (331), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 88/329 (26%), Positives = 162/329 (49%), Gaps = 28/329 (8%)

Query: 66  YDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKI 125
           Y  R+ YH     S++ Y   HP  P R+     +++  GL +            +M   
Sbjct: 24  YSPRVSYHFNPKASHYHYGVKHPMKPIRLMLTDHLVSSYGLHK------------IMDLY 71

Query: 126 PVREATAEEILQVHTKEHLAFLEKTPKMTREQL----LKETETGDSVYFNNDSLLSAKLS 181
             R AT +E+ + HT++++ FL K       +L    L+    GD      +      L 
Sbjct: 72  ETRSATKDELFEFHTEDYVNFLSKVSPENVNKLPRGTLENFNIGDDCPIFQNLYDYTTLY 131

Query: 182 CGGAIEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNYPESV 240
            G  ++A + ++    ++ +A+    G HHA+     GFC  +++ ++  N+L+ +P   
Sbjct: 132 TGATLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP--- 186

Query: 241 RRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFN 300
            R++ +D D+HHG+G Q+AFY+ +RV  +S H+Y  G+++PGT  G+  + G  KG+ F 
Sbjct: 187 -RVLYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHFA 242

Query: 301 CNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYG 360
            N+P    G+ D  Y+  F+ +V P+   F+P +++   G D+   D +G  +++   +G
Sbjct: 243 LNVPLE-DGIDDDSYINLFKSIVDPLITTFKPTVIVQQCGADSLGHDRLGCFNLNIKAHG 301

Query: 361 HMTHMLKSLARGNLCVVLEGGYNLDSIAK 389
                +KS     L VV  GGY   ++++
Sbjct: 302 ECVKFVKSFGLPML-VVGGGGYTPKNVSR 329

>CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|P32561 Saccharomyces
           cerevisiae YNL330c RPD3 histone deacetylase B or
           uniprot|P53096 Saccharomyces cerevisiae YGL194c HOS2
          Length = 433

 Score =  131 bits (330), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 157/326 (48%), Gaps = 28/326 (8%)

Query: 69  RMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPVR 128
           R+ Y        + Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 129 EATAEEILQVHTKEHLAFLEKTPKMTREQLLKET---ETGDSVYFNNDSLLSAKLSCGGA 185
            AT +E+ Q HT E++ FL +      E   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 186 IEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIM 244
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 245 ILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIP 304
            +D D+HHG+G ++AFY+ +RV+  S H+Y  G+++PGT  G     G GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGKYYAVNVP 237

Query: 305 WPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 364
               G+ DA Y   F+ V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYRSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 365 MLKSLARGNLCVVLEGGYNLDSIAKS 390
            +KS     + VV  GGY + ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {ON}
           YGL194C (HOS2) - (putative) histone deacetylase [contig
           139] FULL
          Length = 449

 Score =  132 bits (331), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 94/351 (26%), Positives = 173/351 (49%), Gaps = 29/351 (8%)

Query: 63  GLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELM 122
           G  +   + YH     S F Y   HP  P R+     +++  GL +            +M
Sbjct: 21  GASHQPAVSYHFNDDVSQFHYGVKHPMKPFRLMLTDHLVSSYGLHK------------IM 68

Query: 123 LKIPVREATAEEILQVHTKEHLAFLEKTPKMTREQL----LKETETGDSVYFNNDSLLSA 178
                R AT EE+ + H+++++ FL +       +L    L++   GD           +
Sbjct: 69  DLYETRPATREELCEFHSEDYVEFLARVSPDNLAKLPRGSLEKFNIGDDCPIFQGLYQYS 128

Query: 179 KLSCGGAIEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNYP 237
            L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ ++  N+L+ +P
Sbjct: 129 TLYAGASLDATRKLING--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLSVLNLLRYHP 186

Query: 238 ESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGE 297
               R++ +D D+HHG+G Q+AFY+ +RV  VS H+Y  G+++PGT  GN ++ G  +G+
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNLDEIGCSRGK 239

Query: 298 GFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPS 357
            F  N+P    G+ D  Y+  F+ ++ P+   F+P ++I   G D+   D +G  +++  
Sbjct: 240 HFALNVPLD-DGIDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLGHDRLGCFNLNVK 298

Query: 358 CYGHMTHMLKSLARGNLCVVLEGGYNLDSIAKSALGVAKILIGE-PPDELP 407
            +G     +KS     L VV  GGY   ++++       +L G   P+E+P
Sbjct: 299 AHGECVKYVKSFGLPML-VVGGGGYTPRNVSRLWAYETGLLNGVLLPEEIP 348

>Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}
           similar to Ashbya gossypii AFR172C
          Length = 485

 Score =  132 bits (332), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 92/333 (27%), Positives = 166/333 (49%), Gaps = 30/333 (9%)

Query: 63  GLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELM 122
           G  Y  ++ YH     S + Y   HP  P R+     +++  GL +            +M
Sbjct: 57  GSSYSPQVSYHFNPKVSQYHYGVRHPMKPFRLMLTDHLVSCYGLHK------------IM 104

Query: 123 LKIPVREATAEEILQVHTKEHLAFL-----EKTPKMTREQLLKETETGDSVYFNNDSLLS 177
                REAT EE+L+ H  +++ FL     E   K+ R  L K    GD           
Sbjct: 105 DLYETREATKEELLEFHAPDYIEFLSHVTPENLNKLPRGSLEK-FNIGDDCPIFQGMFDY 163

Query: 178 AKLSCGGAIEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNY 236
           + L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  ++L+ +
Sbjct: 164 SILYAGASLDAARKLINN--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLAIISLLRYH 221

Query: 237 PESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKG 296
           P    R++ +D D+HHG+G Q+AFY+ +RV  VS H+Y  G+++PGT  G+ ++ G  KG
Sbjct: 222 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGCSKG 274

Query: 297 EGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSP 356
           + F+ N+P    G+ D  Y+  F+ ++ P+   ++P ++I   G D+   D +G  +++ 
Sbjct: 275 KKFSLNVPLQ-DGIDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSLGHDRLGCFNLNI 333

Query: 357 SCYGHMTHMLKSLARGNLCVVLEGGYNLDSIAK 389
             +G     +KS     LCV   GGY   ++++
Sbjct: 334 KAHGECVKFVKSFGIPILCVG-GGGYTPRNVSR 365

>ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 448

 Score =  131 bits (329), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 93/336 (27%), Positives = 172/336 (51%), Gaps = 30/336 (8%)

Query: 60  LKTGLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIG 119
            + G  Y  R+ YH     S + Y   HP  P R+     +++  GL +           
Sbjct: 17  FQFGSSYCPRVSYHFNPKVSNYHYGTKHPMKPFRLMLTDHLVSSYGLHK----------- 65

Query: 120 ELMLKIPVREATAEEILQVHTKEHLAFLEK-TP----KMTREQLLKETETGDSVYFNNDS 174
            +M     R AT EE+   H++E++ F+++ TP    K+ R  L K     D   F N  
Sbjct: 66  -IMDLYETRVATWEEMTAFHSEEYVDFMKRVTPENLNKLPRGTLEKFNIGDDCPIFPNLY 124

Query: 175 LLSAKLSCGGAIEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNIL 233
             S+ L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N+L
Sbjct: 125 DYSS-LYAGASLDASRKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLATLNLL 181

Query: 234 KNYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGE 293
           + +P    R++ +D D+HHG+G Q+AFY+ +RV  VS H+Y  G+++PGT  GN+++ G 
Sbjct: 182 RYHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--GNHDEVGC 234

Query: 294 GKGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCH 353
            +G+ F  N+P    G+ D  Y+  F+ ++ P+   ++P +++   G D+   D +G  +
Sbjct: 235 ARGKHFALNVPLQ-DGIDDDSYINLFKSIIDPLITSYKPTVIVQQCGADSLGHDRLGCFN 293

Query: 354 VSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDSIAK 389
           ++   +G   + ++S     L VV  GGY   ++++
Sbjct: 294 LNVKAHGECVNFVRSFGLPML-VVGGGGYTPRNVSR 328

>KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3.8
           YNL330C
          Length = 433

 Score =  131 bits (329), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 89/326 (27%), Positives = 157/326 (48%), Gaps = 28/326 (8%)

Query: 69  RMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPVR 128
           R+ Y        + Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 129 EATAEEILQVHTKEHLAFLEKTPKMTREQLLKET---ETGDSVYFNNDSLLSAKLSCGGA 185
            AT +E+ Q HT E++ FL +      +   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 186 IEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIM 244
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRGKCD--IAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 245 ILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIP 304
            +D D+HHG+G ++AFY+ +RV+  S H+Y  G+++PGT  G     G GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGKNYAVNVP 237

Query: 305 WPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 364
               G+ DA Y   F+ V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 365 MLKSLARGNLCVVLEGGYNLDSIAKS 390
            +KS     + VV  GGY + ++A++
Sbjct: 297 YVKSFNI-PMMVVGGGGYTMRNVART 321

>Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  130 bits (327), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 89/326 (27%), Positives = 156/326 (47%), Gaps = 28/326 (8%)

Query: 69  RMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPVR 128
           R+ Y        + Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 129 EATAEEILQVHTKEHLAFLEKTPKMTREQLLKET---ETGDSVYFNNDSLLSAKLSCGGA 185
            AT +E+ Q HT E++ FL +      E   +E+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 186 IEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIM 244
           +E    +  G+    +AV    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 245 ILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIP 304
            +D D+HHG+G ++AFY+ +RV+  S H+Y  G+++PGT  G     G G G+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGTGKNYAVNVP 237

Query: 305 WPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 364
               G+ DA Y   F+ V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 365 MLKSLARGNLCVVLEGGYNLDSIAKS 390
            +KS     + VV  GGY + ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}
           RPD3Histone deacetylase; regulates transcription,
           silencing, and other processes by influencing chromatin
           remodeling; forms at least two different complexes which
           have distinct functions and members
          Length = 433

 Score =  130 bits (326), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 89/326 (27%), Positives = 156/326 (47%), Gaps = 28/326 (8%)

Query: 69  RMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPVR 128
           R+ Y        + Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 129 EATAEEILQVHTKEHLAFLEKTPKMTREQLLKET---ETGDSVYFNNDSLLSAKLSCGGA 185
            AT +E+ Q HT E++ FL +      E   +E+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 186 IEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIM 244
           +E    +  G+    +AV    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 245 ILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIP 304
            +D D+HHG+G ++AFY+ +RV+  S H+Y  G+++PGT  G     G G G+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGAGKNYAVNVP 237

Query: 305 WPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 364
               G+ DA Y   F+ V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 365 MLKSLARGNLCVVLEGGYNLDSIAKS 390
            +KS     + VV  GGY + ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  128 bits (322), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 156/326 (47%), Gaps = 28/326 (8%)

Query: 69  RMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPVR 128
           R+ Y        F Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNFSYGQYHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 129 EATAEEILQVHTKEHLAFLEKTPKMTREQLLKET---ETGDSVYFNNDSLLSAKLSCGGA 185
            AT +E+ Q HT E++ FL +      E   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 186 IEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIM 244
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKAEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 245 ILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIP 304
            +D D+HHG+G ++AFY+ +RV+  S H+Y  G+++PGT  G     G G G+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGSGKYYAVNVP 237

Query: 305 WPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 364
               G+ DA +   F+ VV  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATFRNVFEPVVGKIMEWYQPAAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 365 MLKSLARGNLCVVLEGGYNLDSIAKS 390
            +KS     + VV  GGY + ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {ON}
           Anc_3.362 YPR068C
          Length = 454

 Score = 84.0 bits (206), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 97/182 (53%), Gaps = 11/182 (6%)

Query: 209 HHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLY 268
           HHA  + A GFC  +++ +  Q + +   +  ++I  +D+D+HHG+G +KAF   + V  
Sbjct: 206 HHAFKQKASGFCYVNDIVLLIQKLRR---KGFQKISYIDFDLHHGDGVEKAFQFSSNVQT 262

Query: 269 VSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGR 328
           +SLH +E+G ++PGT  GN  ++ + +      NIP  + GL D       +Q+V P+  
Sbjct: 263 ISLHLFEVG-FFPGT--GNLSESDKRRNV---VNIPLLH-GLDDTSLEQLIEQIVKPVIE 315

Query: 329 EFQPDLVIISSGFDAADGDTIGQCHVSPSCYGH-MTHMLKSLARGNLCVVLEGGYNLDSI 387
             +PD+++I  G D   GD   +  +S       +T ++ +     + ++  GGYN+  +
Sbjct: 316 RHEPDVLVIQCGGDGLMGDGFNEWQLSIRGLAKCITELINNTKDCPVILLGGGGYNVTLM 375

Query: 388 AK 389
           ++
Sbjct: 376 SR 377

>CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068c HOS1
          Length = 445

 Score = 83.6 bits (205), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 73/267 (27%), Positives = 124/267 (46%), Gaps = 29/267 (10%)

Query: 131 TAEEILQVHTKEHLAFLEKTPKMTR-EQLLKETETGDSVY-------FN--NDSL----- 175
           T  E+L  + ++H+   E   K T  E  L + E+GD V        FN  +D       
Sbjct: 110 TYSELLHYY-RDHIEVSEHNKKRTALEAELSDVESGDEVTRRSTLAKFNLLDDCPIFPYL 168

Query: 176 -LSAKLSCGGAIEACKAVVEGRVKNALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILK 234
            L   +S G  +   + ++EG  +          HH+    A GFC  +++A+    + +
Sbjct: 169 PLYCYVSTGATLSLAQYILEGSERTIAINWDGGRHHSMKTKASGFCYINDIALLIMTLRR 228

Query: 235 NYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEG 294
                V RI  +D+D+HHG+G +KAF    +V  +SLH YE G ++P +  G+ E    G
Sbjct: 229 G---GVDRISYVDFDLHHGDGVEKAFKYSKQVQTISLHMYETG-FFPCS--GSLEDNSSG 282

Query: 295 KGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHV 354
           K      NIP  + GL D+      +++++P   + QP++++I  G D   GD   +  +
Sbjct: 283 KSI---VNIPLLH-GLDDSTLQDIAKRIIVPSISKHQPNVIVIQCGGDGLKGDKYSEWQL 338

Query: 355 SPSCYGHMTHMLKSLARGNLCVVLEGG 381
           S    G  + +   + + N  +VL GG
Sbjct: 339 SIK--GLTSTITSLIEQFNCHIVLLGG 363

>Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {ON}
           YPR068C (REAL)
          Length = 477

 Score = 82.4 bits (202), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 92/177 (51%), Gaps = 13/177 (7%)

Query: 209 HHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLY 268
           HHA  + A GFC  ++V +  Q + K     + ++  LD+D+HHG+G +KAF    ++  
Sbjct: 212 HHAFKQKANGFCYINDVVLLIQRLRK---LKLSKVTYLDFDLHHGDGVEKAFQYSRQIQT 268

Query: 269 VSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIPWPYGGLGDAEYM-WAFQQVVMPMG 327
           +S+H YE G ++PGT   N  Q G+        NIP  +G   D  Y+     +++ P+ 
Sbjct: 269 ISVHLYEPG-FFPGTGSLNDSQNGKNI-----VNIPLKHG--CDDNYLNLVASKIIHPLI 320

Query: 328 REFQPDLVIISSGFDAADGDTIGQCHVSPSCYGH-MTHMLKSLARGNLCVVLEGGYN 383
           +   P+++I+  G D   GD   +  ++       + +++KS  + ++ ++  GGYN
Sbjct: 321 KRHDPEVIIMECGGDGLQGDRFNEWQLTIRGLSRTIVNIMKSYPQAHIFLLGGGGYN 377

>KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068C
          Length = 474

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 92/176 (52%), Gaps = 11/176 (6%)

Query: 209 HHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLY 268
           HHA    A GFC  +++A+  Q + +     +RRI  +D+D+HH +G ++AF     V  
Sbjct: 221 HHASRSRASGFCYINDIALLIQKLRR---RGIRRISYIDFDLHHCDGVERAFQHSQSVQT 277

Query: 269 VSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGR 328
           +S+H +E G ++PGT  G+ ++   GK      NIP  + G+ D       Q+V+MP  R
Sbjct: 278 ISVHLHEPG-FFPGT--GSLKEASVGKNV---VNIPVQH-GMDDTFLNQIVQRVIMPCIR 330

Query: 329 EFQPDLVIISSGFDAADGDTIGQCHVS-PSCYGHMTHMLKSLARGNLCVVLEGGYN 383
              P++++I  G D   GD   +  ++      ++ ++++     N+ ++  GGYN
Sbjct: 331 SHNPEVLVIQCGGDGLMGDKYKEWQLTIKGLVNNIMYIVRGFPATNVVMLGGGGYN 386

>Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {ON}
           YPR068C (REAL)
          Length = 471

 Score = 79.7 bits (195), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 91/176 (51%), Gaps = 11/176 (6%)

Query: 209 HHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLY 268
           HHA  + A GFC  ++V +  Q + K     + +I  +D+D+HHG+G ++AF    ++  
Sbjct: 212 HHAFKQKANGFCYINDVVLLIQRLRK---MKLNKITYVDFDLHHGDGVERAFQYSKQIQT 268

Query: 269 VSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGR 328
           +S+H YE G ++PGT  G+     +GK      NIP  + G  D+       +++ P+ +
Sbjct: 269 ISIHLYEPG-FFPGT--GSLNDARKGKSV---VNIPLKH-GCDDSYLDLVASKIISPLIK 321

Query: 329 EFQPDLVIISSGFDAADGDTIGQCHVSPSCYGH-MTHMLKSLARGNLCVVLEGGYN 383
              PD++II  G D   GD   +  ++       + +++K   R ++ ++  GGYN
Sbjct: 322 RHDPDVLIIECGGDGLLGDRFNEWQLTIRGLSRTIVNVMKLYPRAHIFLLGGGGYN 377

>TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.362
           YPR068C
          Length = 579

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 97/177 (54%), Gaps = 13/177 (7%)

Query: 209 HHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLY 268
           HH+  + A GFC  +++ +  Q + +   +  R+I  LD+D+HHG+G +K+F     +  
Sbjct: 299 HHSRKKKASGFCYVNDIVLCIQKLGE---KGFRKITYLDFDLHHGDGVEKSFQYSKHIQT 355

Query: 269 VSLHRYELGKYYPGTVHGNYEQTGEGKGEGFN-CNIPWPYGGLGDAEYMWAFQQVVMPMG 327
           +S+H +E G ++P T  G+ E+T      GFN  NIP  + GL D    +   +V++P+ 
Sbjct: 356 ISVHLFEPG-FFPCT--GSLEET----KHGFNIVNIPTLH-GLDDNYLTYLLNRVIIPLI 407

Query: 328 REFQPDLVIISSGFDAADGDTIGQCHVSPS-CYGHMTHMLKSLARGNLCVVLEGGYN 383
           ++ +P+ +++  G D   GD   +  ++ S    ++  +L++    ++ ++  GGYN
Sbjct: 408 KKHKPECLVVQCGGDGLIGDRYKEWQMTISGLTKNIMLVLQNFPECSVVLLGGGGYN 464

>SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {ON}
           similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 489

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/229 (25%), Positives = 106/229 (46%), Gaps = 16/229 (6%)

Query: 209 HHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLY 268
           HH+    A GFC  +++ +A Q + +N+      I  +D+D+HHG+G ++AF     V  
Sbjct: 242 HHSFKSRASGFCYINDIVLAIQRLRRNFSN----ISYVDFDLHHGDGVERAFQYSKNVQT 297

Query: 269 VSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGR 328
           +SLH +E G ++PGT  G+ E + +G       NIP  +G   D   M   + VV+P  +
Sbjct: 298 ISLHNHEPG-FFPGT--GSMESSQDGHSI---INIPLRHGADDDC-LMKITESVVIPCIQ 350

Query: 329 EFQPDLVIISSGFDAADGDTIGQCHVS-PSCYGHMTHMLKSLARGNLCVVLEGGYNLDSI 387
           +  P +++I  G D   GD   +  ++       +  +L SL   ++ ++  GGYN   +
Sbjct: 351 KHGPQVIVIQCGGDGLIGDKYEEWQLTIRGLTSSILKILSSLPDTHIILLGGGGYNDRVM 410

Query: 388 AKS----ALGVAKILIGEPPDELPHPTQQPKPEAIETIETVIRTQSKYW 432
           ++        V       PP++ P    +      E ++       K+W
Sbjct: 411 SRFYTYLTWKVCDQFSKSPPEDPPFIDDEDLIPDHEFLDLYTDEHYKFW 459

>ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]
           {ON} similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 436

 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 90/178 (50%), Gaps = 15/178 (8%)

Query: 209 HHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLY 268
           HHA  + A GFC  +++ +  Q +     +  +R+  +D+D+HHG+G ++AF   + V  
Sbjct: 195 HHAMKKRASGFCYVNDIVLLIQKLR---SKGFQRLSYIDFDLHHGDGVERAFQFSSNVQT 251

Query: 269 VSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGR 328
           +S+H +E G ++P +  G+ E   +GK      NIP  + GL D        QVV+P+  
Sbjct: 252 ISMHLFECG-FFPTS--GSLEDNKKGKNIA---NIPLAH-GLNDEYLNEIVTQVVIPLTD 304

Query: 329 EFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVL---EGGYN 383
              P ++II  G D   GD   +  ++    G   ++LK + R   C ++    GGYN
Sbjct: 305 RHSPQVIIIQCGGDGLMGDEYNEWQLTIK--GLCENILKIVNRYKNCSIVLLGGGGYN 360

>ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL116W (HOS3)
          Length = 694

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 84/306 (27%), Positives = 118/306 (38%), Gaps = 66/306 (21%)

Query: 200 ALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMILDWDIHHGNGTQ-- 257
           A   +RPPGHH+      GFCL +N  +A +     Y   V    ILD+D+HHG+GTQ  
Sbjct: 184 AFVALRPPGHHSHTSTPSGFCLLNNAHIAVEYAASRY--GVTHAAILDFDLHHGDGTQDI 241

Query: 258 -----------------------KAFYSDNRVLYVSLHRYELGKYYPGTVHG-------- 286
                                  K F    +V Y SLH         G  H         
Sbjct: 242 CWKRAGFKPDDEEDNAAEYDDFGKRFAEFPKVGYFSLHDINSFPTEQGYAHKTSIKDASV 301

Query: 287 -----------NYEQTGEGKGEGFNCNIPWPYGGL--GDAEYMWAFQQVVMPMGREFQPD 333
                      N   T     E FN      Y  +     E++   Q+ +   G+ ++  
Sbjct: 302 CIMDSHDVNIWNIHLTAYETEEEFNKLYQTKYRAIFAKADEFLRVSQKRMASEGKNYK-G 360

Query: 334 LVIISSGFDAADGDTIGQ----CHVSPSCYGHMTHMLKSLA----RGNLCVVLEGGYNLD 385
           L+IIS+GFDA++ + +       HV  S Y   T     LA    +G L  +LEGGY   
Sbjct: 361 LIIISAGFDASEHEQLSMQRHGVHVPTSFYCAFTKDALKLAQMHTQGKLLSLLEGGY--- 417

Query: 386 SIAKSALGVAKILIGEPPDELPHPTQQPKPEAIETIETVIRTQSKYWNCFKSTHSNDGC- 444
           S A    GV   LIG     + +    P+  + + I+ V R     W  +K+  S D   
Sbjct: 418 SDAALVSGVFSHLIG-----MQNQNWIPEWGSAQVIKEVCRGCRPNWKAYKTKRSRDVIR 472

Query: 445 NFKEEV 450
           N+ EEV
Sbjct: 473 NWAEEV 478

>Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}
           complement(25558..27114) [1557 nt, 519 aa]
          Length = 518

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 92/176 (52%), Gaps = 11/176 (6%)

Query: 209 HHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLY 268
           HHA    A GFC  +++ +  Q + K   + + ++  +D+D+HHG+G +KAF   + +  
Sbjct: 223 HHAIKNKASGFCYINDIVILIQKLRK---KGISKVSYIDFDLHHGDGVEKAFRYSSNIQT 279

Query: 269 VSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGR 328
           +S+H YE G ++P T  G+ E T  GK      N+P  Y G+ D        +++ P+  
Sbjct: 280 ISMHMYEPG-FFPCT--GSLEDTLNGKNI---VNVPL-YHGVDDNYMTEIVNELIKPLIE 332

Query: 329 EFQPDLVIISSGFDAADGDTIGQCHVSPS-CYGHMTHMLKSLARGNLCVVLEGGYN 383
              P++++I  G D   GD   +  ++ S    ++ ++++   + ++ ++  GGYN
Sbjct: 333 RHSPEVLVIQCGGDGLIGDKFEEWQLTISGLTRNIQNLIEWFPKSDIILLGGGGYN 388

>YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON}
           HOS1Class I histone deacetylase (HDAC) family member
           that deacetylates Smc3p on lysine residues at anaphase
           onset; has sequence similarity to Hda1p, Rpd3p, Hos2p,
           and Hos3p; interacts with the Tup1p-Ssn6p corepressor
           complex
          Length = 470

 Score = 77.4 bits (189), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 92/177 (51%), Gaps = 13/177 (7%)

Query: 209 HHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLY 268
           HHA  + A GFC  ++V +  Q + K     + +I  +D+D+HHG+G +KAF    ++  
Sbjct: 210 HHAFKQRASGFCYINDVVLLIQRLRK---AKLNKITYVDFDLHHGDGVEKAFQYSKQIQT 266

Query: 269 VSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWAF-QQVVMPMG 327
           +S+H YE G ++PGT  G+   + + K      NIP  +G   D  Y+     ++V P+ 
Sbjct: 267 ISVHLYEPG-FFPGT--GSLSDSRKDKNV---VNIPLKHG--CDDNYLELIASKIVNPLI 318

Query: 328 REFQPDLVIISSGFDAADGDTIGQCHVSPSCYGH-MTHMLKSLARGNLCVVLEGGYN 383
              +P+ +II  G D   GD   +  ++       + +++KS  R ++ ++  GGYN
Sbjct: 319 ERHEPEALIIECGGDGLLGDRFNEWQLTIRGLSRIIINIMKSYPRAHIFLLGGGGYN 375

>TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {ON}
           Anc_8.607 YPL116W
          Length = 674

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 96/373 (25%), Positives = 152/373 (40%), Gaps = 76/373 (20%)

Query: 135 ILQVHTKEHLAFLEKTPKMTREQLLK-ETETGDS-----VYFNNDSLLSAKLSCGGAIEA 188
           +L+VH ++    L +  K   E+L K E E  DS     +Y ++ ++ + + S G     
Sbjct: 108 VLKVHGRDWPPTLLRLCKHADEKLAKGEIEVPDSWNSGDIYLSSKTIEALQGSIGALETG 167

Query: 189 CKAVVEG----RVKN-ALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRI 243
             ++ EG     V N A  VIRPPGHH       GFCL +N  V+ +     Y   +   
Sbjct: 168 VDSIFEGPSPEHVSNRAFVVIRPPGHHCRAGTPSGFCLLNNAHVSIEYAHDTY--GITHA 225

Query: 244 MILDWDIHHGNGTQ-------------------------KAFYSDNRVLYVSLHRYELGK 278
           ++LD+D+HHG+GTQ                         K F    RV Y S+H      
Sbjct: 226 VVLDFDLHHGDGTQDICWKRAGFRPDEQDENTGGYDEFGKKFAEFPRVGYFSMHDINSFP 285

Query: 279 YYPG-TVHGNYEQTGEGKGEGFNCNI------PWP----YGGLGDAEYMWAFQQV----- 322
              G     N +        G + NI       W     +  L  ++Y   F +      
Sbjct: 286 TESGYATKDNIKSASTCIMNGHDLNIWNVHLSAWETEEDFNKLYQSKYRTLFAKADEFFK 345

Query: 323 -----VMPMGREFQPDLVIISSGFDAADGDTIG-QCH---VSPSCYGHMTHMLKSLAR-- 371
                +   G++F+  LV+IS+GFDA++ + +  Q H   V  + Y   T     LA+  
Sbjct: 346 NAKIEMSAKGKKFK-GLVVISAGFDASEFEQVSMQRHGVNVPTNFYTMFTKDALKLAQMH 404

Query: 372 --GNLCVVLEGGYNLDSIAKSALGVAKILIGEPPDELPHPTQQPKPEAIETIETVIRTQS 429
             G +  VLEGGY+  +I     GV   LIG     L +     +  + + ++ ++R   
Sbjct: 405 SEGKVLSVLEGGYSDKAITS---GVFAHLIG-----LQNQNWIKEWGSEQVVKEIVRGCK 456

Query: 430 KYWNCFKSTHSND 442
             W  +KS  + D
Sbjct: 457 PNWKPYKSKKTRD 469

>KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.362
           YPR068C
          Length = 456

 Score = 76.6 bits (187), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 62/232 (26%), Positives = 112/232 (48%), Gaps = 26/232 (11%)

Query: 209 HHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLY 268
           HHA    A GFC  +++ +  Q + K   +   ++  LD+D+HHG+G ++AF    +V  
Sbjct: 206 HHASKGKASGFCYVNDIVLLIQKLRK---QGTGKVTYLDFDLHHGDGVERAFKFTKKVQT 262

Query: 269 VSLHRYELGKYYPGTVHGNYEQTGEGKGEGFN-CNIPWPYGGLGDAEYMWAFQQVVMPMG 327
           +SLH YE G ++P T  G+ E +      GF+  N+P  + GL D+       QVV P+ 
Sbjct: 263 ISLHLYEPG-FFPCT--GSLEGS-----SGFDTVNLPLQH-GLTDSFLQGLVDQVVNPLI 313

Query: 328 REFQPDLVIISSGFDAADGDTIGQCHVS----PSCYGHMTHMLKSLARGNLCVVLEGGYN 383
           +   P++++I  G D   GDT  +  +S      C   +  ++    + ++ ++  GGYN
Sbjct: 314 QRHGPEVIVIQCGGDGLLGDTFHEWQLSIRGLTKC---ILDVMSHSTQAHVILLGGGGYN 370

Query: 384 LDSIAKSALGVAKILIGEPPDELPHPTQQPKPEAIETIETVIRTQSKYWNCF 435
              +++    +   ++ +  +  P P      E     E++IR   KY  C+
Sbjct: 371 PTLMSRFYTYLTGRILHQFKNTDPFPGMNGAQE-----ESLIRDH-KYIECY 416

>Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C
           (HOS1) - Similar to Hda1p, Rpd3p, Hos2p, and Hos3p
           [contig 254] FULL
          Length = 473

 Score = 76.6 bits (187), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 56/202 (27%), Positives = 94/202 (46%), Gaps = 12/202 (5%)

Query: 184 GAIEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRR 242
           GA          R +  ++V    G HHA    A GFC  +++A+  Q + +     + +
Sbjct: 198 GATIKLARYASSRQQRTISVNWDGGRHHAFKSKASGFCYVNDIAILIQKLRR---RGIHK 254

Query: 243 IMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCN 302
           I  LD+D+HHG+G ++AF     V  +S+H YE G ++PGT  G  +    G+      N
Sbjct: 255 ISYLDFDLHHGDGVERAFQHSANVQTISIHMYEEG-FFPGT--GTLKDASSGRNI---VN 308

Query: 303 IPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVS-PSCYGH 361
           IP  + G+ D        +VV+P      P++VII  G D   GD   +  ++       
Sbjct: 309 IPVLH-GMDDTFLNEVVNRVVIPCLHNHNPEVVIIQCGGDGLIGDKYKEWQLTLKGLTDT 367

Query: 362 MTHMLKSLARGNLCVVLEGGYN 383
           +  +++     N+ ++  GGYN
Sbjct: 368 IMKVVEDFPSSNIVLLGGGGYN 389

>KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068C HOS1
           Putative class I histone deacetylase (HDAC) with
           sequence similarity to Hda1p, Rpd3p, Hos2p, and Hos3p;
           deletion results in increased histone acetylation at
           rDNA repeats; interacts with the Tup1p-Ssn6p complex
          Length = 441

 Score = 76.3 bits (186), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 85/176 (48%), Gaps = 11/176 (6%)

Query: 209 HHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLY 268
           HHA    A GFC  +++ +  Q++ +   +  +R+  +D+D+H+G+G  KAF     V  
Sbjct: 193 HHALKHYASGFCYVNDIVLLIQSLRR---KGWKRVTYIDFDLHYGDGVAKAFRFSENVQT 249

Query: 269 VSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGR 328
           +S+H YE G ++PGT  G+ E+T   K      N+P  + G+ D   +     V+ P+  
Sbjct: 250 ISVHLYEPG-FFPGT--GSLEETRNSKQM---VNLPVLH-GMDDKYLLELISSVITPLIE 302

Query: 329 EFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVL-EGGYN 383
            F  + ++I  G D   GD   +  +S     H    +  + R     +L  GGYN
Sbjct: 303 TFNAECIVIQCGSDGLSGDKYNEWQLSIRGLTHAIISIMDMFRDKQVFLLGGGGYN 358

>NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa]
           {ON} Anc_3.362 YPR068C
          Length = 490

 Score = 76.6 bits (187), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 101/203 (49%), Gaps = 14/203 (6%)

Query: 184 GAIEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRR 242
           GA  +    ++   + ++A+    G HHA    A GFC  +++ +  Q I KN     + 
Sbjct: 189 GATLSLSKFLQPNSERSIAINWDGGRHHAFKNKASGFCYVNDIVLLIQKIRKN---GFKN 245

Query: 243 IMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCN 302
           I  +D+D+HHG+G QKAF     V  VSLH +E G ++P T  G+ +   E K      N
Sbjct: 246 ISYVDFDLHHGDGVQKAFQFSKNVQTVSLHMFEPG-FFPCT--GSLQ---EAKAGSSIVN 299

Query: 303 IPWPYGGLGDAEYMWAF-QQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVS-PSCYG 360
           IP  +G   D  ++    + +++P+  + +P++++I  G D   GD   +  ++     G
Sbjct: 300 IPLLHG--LDGTFLKQLTKDIIIPVVEQHEPEVLVIQCGGDGLIGDQYNEWQLTIHDLSG 357

Query: 361 HMTHMLKSLARGNLCVVLEGGYN 383
            +  ++ +    ++ ++  GGYN
Sbjct: 358 AIMKLINTFPSCSVVLLGGGGYN 380

>NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON}
           Anc_3.362 YPR068C
          Length = 508

 Score = 76.6 bits (187), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 64/236 (27%), Positives = 114/236 (48%), Gaps = 17/236 (7%)

Query: 152 KMTREQLLKETETGDSVYFNNDSLLSAKLSCGGAIEACKAVVEGRVKNALAVIRPPG-HH 210
           +M RE+L      GD   F+   +   ++  G  +   K +     +  +AV    G HH
Sbjct: 176 EMIREKLKGYNLEGDCPIFSYLPVY-CQVIVGATLSLAKHITAVANERTIAVNWDGGRHH 234

Query: 211 AEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVS 270
           A    A GFC  +++ +  Q +  N     +RI  +D+D+HHG+G Q++F     V  +S
Sbjct: 235 ALRNKASGFCYINDIVLLIQQLRSN---GYKRITYIDFDLHHGDGVQRSFQYSTSVQTIS 291

Query: 271 LHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREF 330
            H +E G ++P T  G+ +++  GK      NIP  + G+ D       ++V++P  + +
Sbjct: 292 AHMFEPG-FFPCT--GSLKESKMGKNI---VNIPLLH-GVDDMLMNEIVEKVMIPCVKRY 344

Query: 331 QPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVL---EGGYN 383
            P++++I  G D   GD   +  +  + +G + ++LK L     C V+    GGYN
Sbjct: 345 DPEILVIQCGGDGLIGDGYAEWQL--TIHGLVNNILKLLRIFPGCPVVLLGGGGYN 398

>Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {ON}
           YPR068C (REAL)
          Length = 470

 Score = 76.3 bits (186), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 92/176 (52%), Gaps = 11/176 (6%)

Query: 209 HHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLY 268
           HHA  + A GFC  ++V +  Q + K     + +I  LD+D+HHG+G +KAF    ++  
Sbjct: 210 HHAFKQRASGFCYINDVVLLIQRLRK---IKLNKITYLDFDLHHGDGVEKAFQYSKQIQT 266

Query: 269 VSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGR 328
           +S+H YE G ++PGT  G+ + +  GK      NIP  + G  D+       +++ P+  
Sbjct: 267 ISVHIYEPG-FFPGT--GSLDDSRGGKNV---VNIPLKH-GCDDSYLNLIASKIINPLID 319

Query: 329 EFQPDLVIISSGFDAADGDTIGQCHVSPSCYGH-MTHMLKSLARGNLCVVLEGGYN 383
           +  P+++II  G D   GD   +  ++       + + +K  ++ ++ ++  GGYN
Sbjct: 320 KHDPEVLIIECGGDGLLGDRFNEWQLTVRGLSETIINFIKRYSQAHIFLLGGGGYN 375

>Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}
           similar to Ashbya gossypii ADL265W
          Length = 709

 Score = 73.9 bits (180), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 93/381 (24%), Positives = 157/381 (41%), Gaps = 86/381 (22%)

Query: 132 AEEILQVHTKEHLAFLEKTPKMTREQL-LKETETGD-----SVYFNNDSLLSAKLSCGGA 185
           +  +L+VH  +    L +  +  +E++  K+ E  D      +Y   +++ + + S G  
Sbjct: 105 SSHVLKVHGSDWPKELLRLCRGAKEKIGRKQVEVPDEWNVGDIYLCEETVYALRGSIGAV 164

Query: 186 IEACKAVVEGRVKN-----ALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESV 240
                ++ +G V       A   IRPPGHH+      GFCL +N  +A +     Y   V
Sbjct: 165 EYGVDSIFKGEVNKDTANRAFVAIRPPGHHSHAATPSGFCLLNNAHIAVEYAADTY--GV 222

Query: 241 RRIMILDWDIHHGNGTQ-------------------------KAFYSDNRVLYVSLHRYE 275
              +ILD+D+HHG+GTQ                         K F    +V Y S+H   
Sbjct: 223 THAVILDFDLHHGDGTQDICWKRAGFKADDIQDAKGEYNEFDKKFAEFPKVGYFSMHDI- 281

Query: 276 LGKYYPGTVHGNYEQTGEGKG------EGFNCNIPW-----PY------GGLGDAEY--M 316
               +P  +  NY    + K       +  + NI W     PY        L    Y  +
Sbjct: 282 --NSFPTEL--NYASKDKVKDASTCIMDAHDVNI-WNIHLLPYETEEEFNKLYQTRYRTL 336

Query: 317 WA-----FQQVVMPMGREFQP--DLVIISSGFDAADGDTIG-QCH---VSPSCYGHMTHM 365
           +A     F+   + M ++ +P   LV++S+GFDA++ + +  Q H   V  S Y   T  
Sbjct: 337 FAKADEFFKAAKLSMAKDGKPFKGLVVMSAGFDASEYEQVSMQRHGVNVPTSFYSTFTKD 396

Query: 366 LKSLAR----GNLCVVLEGGYNLDSIAKSALGVAKILIGEPPDELPHPTQQPKPEAIETI 421
              LA+    G +  +LEGGY+  +IA    GV   LIG     L +     +  + + +
Sbjct: 397 ALKLAQMHTNGKIISLLEGGYSDAAIAS---GVFSHLIG-----LQNQNWITEWGSAQVV 448

Query: 422 ETVIRTQSKYWNCFKSTHSND 442
           + ++R     W  +K+  + D
Sbjct: 449 KEIVRGCKPRWKPYKTRKAGD 469

>KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.362
           YPR068C
          Length = 474

 Score = 73.2 bits (178), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 97/209 (46%), Gaps = 17/209 (8%)

Query: 179 KLSCGGAIEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNYP 237
           +++ G  +   K +V       + +    G HHA  + A GFC  +++ +  Q + KN  
Sbjct: 188 QVTTGATLSLSKFLVPNSKDRTICINWDGGRHHASKKKASGFCYINDIVLLIQRMRKN-- 245

Query: 238 ESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGE 297
              ++I  LD+D+HHG+G +KAF     +  +SLH +E G ++PGT  G        KG 
Sbjct: 246 -GFKKITYLDFDLHHGDGVEKAFQFSKSIQTISLHLFETG-FFPGT--GGLSN----KGS 297

Query: 298 GFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPS 357
               +IP  + GL D       +Q+++P       + +++  G D   GD   +  ++  
Sbjct: 298 RDLIDIPLSH-GLTDDYLFELVKQIIIPAIDLHAAEAIVLQCGGDGLSGDKFNEWQLTIK 356

Query: 358 CYGHMTHMLKSLARGNLCVVL---EGGYN 383
             G    ++  + + + C ++    GGYN
Sbjct: 357 --GLTQCIIDVIGKFSDCQIVLLGGGGYN 383

>ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR068C (HOS1)
          Length = 437

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 73/284 (25%), Positives = 124/284 (43%), Gaps = 38/284 (13%)

Query: 184 GAIEACKAVVEGRVKNALAVIRPPG-HHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRR 242
           GA  A    +     +ALAV    G HHA    A GFC  +++A+  Q + +   +   R
Sbjct: 167 GATLALAKELSRHRGSALAVNWDGGRHHALKARASGFCYVNDIALLIQTLRR---QGFLR 223

Query: 243 IMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNC- 301
           +  +D+D+HHG+G + AF     V   SLH +E G ++PGT            G   NC 
Sbjct: 224 VSYVDFDLHHGDGVENAFRYSKNVQTCSLHLFEPG-FFPGT------------GACKNCT 270

Query: 302 -----NIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSP 356
                N+P  + G+ D+        +V P  +   P+++II  G D   GD  G+  +  
Sbjct: 271 DNSVLNVPLLH-GVDDSTLDHVVDHIVTPAVQRHDPEVLIIQCGGDGLSGDKYGEWQL-- 327

Query: 357 SCYGHMTHMLKSLAR---GNLCVVLEGGYNLDSIAKSALGVAKILIGEPPDELPHPTQQP 413
           S +G   ++LK +       + ++  GGYN    ++    +  +L+ +    +P      
Sbjct: 328 SIHGLTRNILKLVQAHKFKKIALLGGGGYNGRLQSRFYAYLTSMLLAQCKG-IPTEIGDD 386

Query: 414 KPEAI---ETIETVIRTQSKYWNCFKSTHSNDGCNFKEEVTEST 454
           + E I   E IE   +   K+W      +  +G N K  + ++T
Sbjct: 387 EDELIRDHELIEMYEQEDYKFW-----YYEYEGLNRKNLINDNT 425

>KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 705

 Score = 70.5 bits (171), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 92/376 (24%), Positives = 146/376 (38%), Gaps = 76/376 (20%)

Query: 132 AEEILQVHTKEHLAFLEKTPKMTREQL------LKETETGDSVYFNNDSLLSAKLSCGGA 185
           ++ +L+VH  +    L K  K +++ L      + E+     +Y +  ++ + + S G  
Sbjct: 106 SDHVLKVHGSDWPQELLKLCKNSQKALDQCQVEVPESWNVGDIYLSRQTISALEGSIGAL 165

Query: 186 IEACKAV-----VEGRVKNALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESV 240
                ++     VE     A   +RPPGHH+      GFCL +N  +A +     Y   V
Sbjct: 166 ETGVDSIFHGPSVEQTSNRAFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTY--GV 223

Query: 241 RRIMILDWDIHHGNGTQ-------------------------KAFYSDNRVLYVSLHRY- 274
              ++LD+D+HHG+GTQ                         K F    +V Y SLH   
Sbjct: 224 THAVVLDFDLHHGDGTQDICWKRAGFKPDGCDDGGSEYNEFGKKFAEFPKVGYFSLHDIN 283

Query: 275 ----ELGKYYPGTVHG--------------NYEQTGEGKGEGFNCNIPWPYGGL--GDAE 314
               ELG      V                N         E F       Y  L     E
Sbjct: 284 SFPTELGYATKENVRNAATCIMDAHDVNIWNVHLQSYDSDEAFTKLYQTKYRTLFAKADE 343

Query: 315 YMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIG-QCH---VSPSCYGHMTHMLKSLA 370
           Y    +Q +  +G+ F+  LV+IS+GFDA++ +    Q H   V    Y   T     LA
Sbjct: 344 YFRTAKQNMRALGKPFK-GLVVISAGFDASEYEQPSMQRHAVNVPTFFYNLFTKDALKLA 402

Query: 371 R----GNLCVVLEGGYNLDSIAKSALGVAKILIGEPPDELPHPTQQPKPEAIETIETVIR 426
           +    G L  VLEGGY+  +I+    GV   LIG     L +     +  + + ++ ++R
Sbjct: 403 QMHSHGKLLSVLEGGYSDGAISS---GVFAHLIG-----LQNQNWINEWGSAQVVKEIVR 454

Query: 427 TQSKYWNCFKSTHSND 442
                W  +K+  + D
Sbjct: 455 GCKPQWKPYKTKRARD 470

>Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON}
           complement(10892..12958) [2067 nt, 689 aa]
          Length = 688

 Score = 70.5 bits (171), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 79/339 (23%), Positives = 134/339 (39%), Gaps = 75/339 (22%)

Query: 165 GDSVYFNNDSLLSAKLSCGGAIEACKAVVEG----RVKN-ALAVIRPPGHHAEPEIAGGF 219
           GD +Y ++ ++ + + S G       ++  G     + N A   IRPPGHH   +   GF
Sbjct: 146 GD-IYLSSRTIEALQGSIGALETGVDSIFSGPSPDHISNRAFVAIRPPGHHCHVDTPSGF 204

Query: 220 CLFSNVAVAAQNILKNYPESVRRIMILDWDIHHGNGTQ---------------------- 257
           CL +N  +A +     Y   +   +ILD+D+HHG+GTQ                      
Sbjct: 205 CLLNNAHIAIEYASDTY--GITHAVILDFDLHHGDGTQDICWKRAGFRTEAEPETTEGYD 262

Query: 258 ---KAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKG---EGFNCNI------PW 305
              K F    +V Y S+H  ++  +   + +   E             + NI      PW
Sbjct: 263 EFGKKFAEFPKVGYFSMH--DINSFPTESQYATKENIRNASTCVMNAHDVNIWNIHLSPW 320

Query: 306 P----YGGLGDAEYMWAFQQV----------VMPMGREFQPDLVIISSGFDAADGDTIGQ 351
                +  L   +Y   F +           +  +G+ FQ  LV+IS+GFDA++ +    
Sbjct: 321 ETEQDFDKLYQTKYRTLFAKADEFFRNAKEEMDALGKPFQ-GLVVISAGFDASEFEQTSM 379

Query: 352 CHVSPSCYGHMTHMLKSLA--------RGNLCVVLEGGYNLDSIAKSALGVAKILIGEPP 403
              S +   H   M    A         G +  ++EGGY+  +IA    GV   LIG   
Sbjct: 380 QRHSVNVPTHFYTMFTKDALKLSQIHCHGKVLSIMEGGYSDKAIAS---GVFSHLIG--- 433

Query: 404 DELPHPTQQPKPEAIETIETVIRTQSKYWNCFKSTHSND 442
             L +     +  + + ++ ++R    +W  +K+  S D
Sbjct: 434 --LQNQNWIKEWGSEQVVKEIVRGCKPHWKPYKTKKSRD 470

>SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} similar
           to uniprot|Q02959 Saccharomyces cerevisiae YPL116W HOS3
           Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC)
          Length = 690

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 86/374 (22%), Positives = 157/374 (41%), Gaps = 79/374 (21%)

Query: 135 ILQVHTKEHLAFLEKTPKMTREQLL-KETETGDS-----VYFNNDSLLSAKLSCGGAIEA 188
           +L+VH  +    L +  K + E+L  K+ E  D      +Y +  ++ + + S G     
Sbjct: 109 VLKVHGTDWPKELLQLCKQSSEKLAHKQVEVPDDWNVGDIYLSQQTIAALEGSIGALETG 168

Query: 189 CKAVVEGR-----VKNALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRI 243
             ++ +G         A   +RPPGHH+      GFCL +N  +A +     +  +V   
Sbjct: 169 IDSIFQGSSQEDIANRAFVAVRPPGHHSHTATPSGFCLLNNAHIAIEYAADTF--NVTHA 226

Query: 244 MILDWDIHHGNGTQ------------------------KAFYSDNRVLYVSLHRY----- 274
           ++LD+D+HHG+GTQ                        K F    +V Y S+H       
Sbjct: 227 VVLDFDLHHGDGTQDICWKRAGFNPDEQDDDPAYDEFGKKFAEFPKVGYFSMHDINSFPT 286

Query: 275 ELGKYYPG------------------TVHGNYEQTGEGKGEGFNCNIPWPYGGLGDAEYM 316
           ELG                        VH ++ +T E   + +       +      E+ 
Sbjct: 287 ELGYATKENIKNASTCIMNAHDLNIWNVHLSHYETEEDFVKLYQSKYRSLFAKAD--EFF 344

Query: 317 WAFQQVVMPMGREFQPDLVIISSGFDAADGD--TIGQCHVS-PSCYGHM-THMLKSLAR- 371
              ++ +   G++F+  LV+IS+GFDA++ +  ++ +  V+ P+C+ +M T     LA+ 
Sbjct: 345 KNAKKEMASQGKKFK-GLVVISAGFDASEYEQPSMQRHGVNVPTCFYNMFTKDALKLAQM 403

Query: 372 ---GNLCVVLEGGYNLDSIAKSALGVAKILIGEPPDELPHPTQQPKPEAIETIETVIRTQ 428
              G +  V+EGGY+  +I+    GV   LIG     L +     +  + + ++ +IR  
Sbjct: 404 HTSGKVLSVMEGGYSDGAISS---GVFSHLIG-----LQNQNWINEWGSAQVVKEIIRGC 455

Query: 429 SKYWNCFKSTHSND 442
              W  +K+  + D
Sbjct: 456 KPQWKPYKTKKARD 469

>Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL339W
          Length = 445

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 86/178 (48%), Gaps = 16/178 (8%)

Query: 209 HHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLY 268
           HHA    A GFC  +++ +  Q + KN      R+  +D+D+HHG+  + AF     V  
Sbjct: 195 HHAFKSRASGFCYINDIVLLIQELRKN---GYSRVSYVDFDLHHGDAVESAFQYSRNVQT 251

Query: 269 VSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGR 328
            SLH +E G ++PGT  G+++   E        NIP  + GL D         +++P   
Sbjct: 252 CSLHLFEAG-FFPGT--GSFKNCRETNV----VNIPL-FHGLDDESLDEIVDNILIPCVN 303

Query: 329 EFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSL---ARGNLCVVLEGGYN 383
           +  P++++I  G D   GD   +  +  + +G   ++LK +   +   + ++  GGYN
Sbjct: 304 KHDPEVLVIQCGADGLSGDKYKEWQL--TIHGLTRNILKLVDIHSYKKVVLLGGGGYN 359

>Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116W
           (REAL)
          Length = 699

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 86/332 (25%), Positives = 132/332 (39%), Gaps = 68/332 (20%)

Query: 132 AEEILQVHTKEHLAFLEKTPKMTREQLLK-ETETGDS-----VYFNNDSLLSAKLSCGGA 185
           A  +L+VH       L +  +M   +LLK E E  D+     +Y ++ ++ + + + G  
Sbjct: 107 APHVLKVHGSHWPTELIELCQMADAKLLKGEIEVPDTWNSGDIYLSSKTIQALQGTIGAI 166

Query: 186 IEACKAVVEG----RVKN-ALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESV 240
                ++ +G     + N A   IRPPGHH       GFCL +N  VA +     Y   V
Sbjct: 167 ETGVDSIFKGPSPEHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAFDTY--DV 224

Query: 241 RRIMILDWDIHHGNGTQ------------------------KAFYSDNRVLYVSLHRY-- 274
             +++LD+D+HHG+GTQ                        K F    +V Y S+H    
Sbjct: 225 THVVVLDFDLHHGDGTQDICWKRAGFKPEEESENSSYDNFGKKFAEFPKVGYFSMHDINS 284

Query: 275 ---ELGKYYPGTVHG--------------NYEQTGEGKGEGFNCNIPWPYGGL-GDAEYM 316
              E G      +                N   +     E FN      Y  L   A+  
Sbjct: 285 FPTESGFATKENIKNASTCIMNSHDLNIWNVHLSKWTTEEDFNILYRTKYRTLFAKADEF 344

Query: 317 WAFQQVVMPMGREFQPDLVIISSGFDAADGD-TIGQCH---VSPSCYGHMTHMLKSLAR- 371
           +   ++ M    +    LV+IS+GFDA++ + T  Q H   V  S Y   T     LA+ 
Sbjct: 345 FKTAKLEMNQQEKTFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQM 404

Query: 372 ---GNLCVVLEGGYNLDSIAKSALGVAKILIG 400
              G +  ++EGGY+  +I     GV   LIG
Sbjct: 405 HCHGKVLSLMEGGYSDKAICS---GVFAHLIG 433

>YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}
           HOS3Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC) with specificity in vitro for
           histones H3, H4, H2A, and H2B; similar to Hda1p, Rpd3p,
           Hos1p, and Hos2p; deletion results in increased histone
           acetylation at rDNA repeats
          Length = 697

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 89/333 (26%), Positives = 136/333 (40%), Gaps = 70/333 (21%)

Query: 132 AEEILQVHTKEHLAFLEKTPKMTREQLLK-ETETGDS-----VYFNNDSLLSAKLSCGGA 185
           A  +L+VH     A L +  +M   +LLK E E  D+     +Y ++ ++ + + + G  
Sbjct: 107 APHVLKVHGSSWPAELIELCQMADAKLLKGEIEVPDTWNSGDIYLSSKTIKALQGTIGAI 166

Query: 186 IEACKAVVEG----RVKN-ALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESV 240
                ++ +G     + N A   IRPPGHH       GFCL +N  VA +     Y  +V
Sbjct: 167 ETGVDSIFKGPSAEHISNRAFVAIRPPGHHCHYGTPSGFCLLNNAHVAIEYAYDTY--NV 224

Query: 241 RRIMILDWDIHHGNGTQ------------------------KAFYSDNRVLYVSLHRY-- 274
             +++LD+D+HHG+GTQ                        K F    +V Y S+H    
Sbjct: 225 THVVVLDFDLHHGDGTQDICWKRAGFKPEEEPEDSSYDDFGKKFAEFPKVGYFSMHDINS 284

Query: 275 ---ELGKYYPGTVHG--------------NYEQTGEGKGEGFNCNIPWPYGGL--GDAEY 315
              E G      +                N   +     E FN      Y  L     E+
Sbjct: 285 FPTESGFATKENIKNASTCIMNSHDLNIWNIHLSKWTTEEEFNVLYRTKYRTLFAKADEF 344

Query: 316 MWAFQQVVMPMGREFQPDLVIISSGFDAADGD-TIGQCH---VSPSCYGHMTHMLKSLAR 371
             + +  +   GR F+  LV+IS+GFDA++ + T  Q H   V  S Y   T     LA+
Sbjct: 345 FRSAKLEMNQQGRPFK-GLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQ 403

Query: 372 ----GNLCVVLEGGYNLDSIAKSALGVAKILIG 400
               G +  ++EGGY+  +I     GV   LIG
Sbjct: 404 MHCHGKVLSLMEGGYSDKAICS---GVFAHLIG 433

>ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 668

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 88/332 (26%), Positives = 134/332 (40%), Gaps = 73/332 (21%)

Query: 135 ILQVHTKEHLAFLEKTPKMTREQLL-KETETGDS-----VYFNNDSLLSAKLSCGGAIEA 188
           +L+VH K+    L +  K    +L  KE E   S     +Y ++ ++ + + S G    A
Sbjct: 106 VLKVHGKDWPPQLLRLCKEADAKLAAKEVEVPASWNAGDIYLSSKTVEALQGSIGALETA 165

Query: 189 CKAVVEG----RVKN-ALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRI 243
             ++ +G     + N A   IRPPGHH       GFCL +N  VA +     +   V   
Sbjct: 166 VDSIFDGPSPEHISNRAFVAIRPPGHHCHVATPSGFCLLNNAHVAIEYAKDRF--GVTHA 223

Query: 244 MILDWDIHHGNGTQ-------------------------KAFYSDNRVLYVSLHRYELGK 278
            ILD+D+HHG+GTQ                         K F    RV Y S+H  ++  
Sbjct: 224 AILDFDLHHGDGTQDICWKRAGFRPDEEDEDSPGYDSFGKKFAEYPRVGYFSMH--DINS 281

Query: 279 YYPGTVHGNYEQTGEGKG---EGFNCNI------PWP----YGGLGDAEYMWA------- 318
           +   + +   E             + NI      PW     +  L   +Y          
Sbjct: 282 FPTESGYATKENVKNASTCIMNAHDVNIWNIHLSPWETEEDFAKLYHTKYRSLFVKADEF 341

Query: 319 FQQVVMPMGREFQP--DLVIISSGFDAADGD-TIGQCH---VSPSCYGHMTHMLKSLAR- 371
           F+Q  + M  + +P   LV+ISSGFDA++ + T  Q H   V    Y   T     L++ 
Sbjct: 342 FKQGKIEMAAQNKPFKGLVVISSGFDASEFEQTSMQRHGTNVPTYFYTAFTKDALKLSQM 401

Query: 372 ---GNLCVVLEGGYNLDSIAKSALGVAKILIG 400
              G +  ++EGGY+  +I     GV   LIG
Sbjct: 402 HCHGKVLSIMEGGYSDKAIVS---GVFAHLIG 430

>Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON}
           YPL116W (REAL)
          Length = 697

 Score = 67.8 bits (164), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 70/137 (51%), Gaps = 13/137 (9%)

Query: 132 AEEILQVHTKEHLAFLEKTPKMTREQLLK-ETETGDS-----VYFNNDSLLSAKLSCGGA 185
           A  +L+VH     A L +  +M   +LLK E E  D+     +Y ++ ++ + + + G  
Sbjct: 107 APHVLKVHGSHWPAELIELCQMADAKLLKGEIEVPDTWNSGDIYLSSKTIKALQGTIGAI 166

Query: 186 IEACKAVVEG----RVKN-ALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESV 240
                ++ EG     + N A   IRPPGHH       GFCL +N  VA +     Y  +V
Sbjct: 167 ETGVDSIFEGPSAEHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAYDTY--NV 224

Query: 241 RRIMILDWDIHHGNGTQ 257
             +++LD+D+HHG+GTQ
Sbjct: 225 THVVVLDFDLHHGDGTQ 241

>TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa]
           {ON} Anc_8.607 YPL116W
          Length = 694

 Score = 67.4 bits (163), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 76/298 (25%), Positives = 126/298 (42%), Gaps = 67/298 (22%)

Query: 200 ALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMILDWDIHHGNGTQ-- 257
           A   IRPPGHH +     GFCL +N  ++ +    +Y   +   +ILD+D+HHG+GTQ  
Sbjct: 187 AFVAIRPPGHHCKVATPSGFCLLNNAHISIEYAADHY--GITHAVILDFDLHHGDGTQDI 244

Query: 258 -----------------------KAFYSDNRVLYVSLHRYELGKYYPGTVHG---NYEQT 291
                                  K F    +V Y S+H  ++  +   T +    N    
Sbjct: 245 CWKRAGFRSEDEPEGSEGYDDFGKKFAEFPKVGYFSMH--DINSFPTETGYATKVNIRNA 302

Query: 292 GEGKGEGFNCNI------PW----PYGGLGDAEY--MWA-----FQQVVMPMGREFQP-- 332
                +G + NI      PW     +  L  ++Y  ++A     F+     M +E +P  
Sbjct: 303 STCIMDGHDLNIWNIHLSPWNTEEDFQKLYQSKYRTLFAKADDYFRNAKYQMAQEGKPFK 362

Query: 333 DLVIISSGFDAADGD-TIGQCH---VSPSCYGHMTHMLKSLA----RGNLCVVLEGGYNL 384
            LV+IS+GFDA++ + T  Q H   V  + Y   T     LA    +G +  +LEGGY+ 
Sbjct: 363 GLVVISAGFDASEYEQTSMQRHNVNVPTNFYTMFTKDALKLAQIHCQGKVLSLLEGGYSD 422

Query: 385 DSIAKSALGVAKILIGEPPDELPHPTQQPKPEAIETIETVIRTQSKYWNCFKSTHSND 442
            ++     GV   LIG       +     +  + + ++ ++R    +W  +K+  S D
Sbjct: 423 KALTS---GVFAHLIG-----FQNQNWINEWGSEQVVKEIVRGCKPHWKPYKTKKSRD 472

>Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {ON}
           YPL116W (HOS3) - sequence similar to the histone
           deacetylase Hda1p [contig 61] FULL
          Length = 708

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 91/380 (23%), Positives = 152/380 (40%), Gaps = 85/380 (22%)

Query: 132 AEEILQVHTKEHLAFLEKTPKMTREQLLK-ETETGDS-----VYFNNDSLLSAKLSCGGA 185
           A+ +L+VH  +    L K  + +++ L + E E  +S     +Y +  ++ + + S G  
Sbjct: 108 ADHVLKVHGADWPHELLKLCQQSQKALDRGEVEVPESWNVGDIYLSQQTIGALEGSIGAL 167

Query: 186 IEACKAVVEGRV-----KNALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESV 240
                ++  G         A   +RPPGHH+      GFCL +N  +A +     Y  +V
Sbjct: 168 ETGIDSIFAGPTPEETSNRAFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTY--NV 225

Query: 241 RRIMILDWDIHHGNGTQ------------------------KAFYSDNRVLYVSLHRY-- 274
              ++LD+D+HHG+GTQ                        K F    +V Y S+H    
Sbjct: 226 THAVVLDFDLHHGDGTQDICWKRAGFKPDECADSGEFDEFGKKFAEYPKVGYFSVHDINS 285

Query: 275 ---ELGKYYPGTVHGNYEQTGEGKGEGFNCNIPW-----PYGG------LGDAEYMWAF- 319
              ELG         N         +  + NI W     PY        L   +Y   F 
Sbjct: 286 FPTELGY----ATKENIRNAATCIMDAHDVNI-WNVHLQPYDSEEAFTKLYQTKYRTLFA 340

Query: 320 ---------QQVVMPMGREFQPDLVIISSGFDAADGDTIG-QCH---VSPSCYGHMTHML 366
                    +Q +  +G+ F+  LV+IS+GFDA++ +    Q H   V    Y   T   
Sbjct: 341 KADEFFRISKQTMKALGKPFK-GLVVISAGFDASEYEQPSMQRHAVNVPTFFYNTFTKDA 399

Query: 367 KSLAR----GNLCVVLEGGYNLDSIAKSALGVAKILIGEPPDELPHPTQQPKPEAIETIE 422
             LA+    G +  V+EGGY+  +I     GV   LIG     L + +   +  + + ++
Sbjct: 400 LKLAQMHSHGKVLSVMEGGYSDGAITS---GVFAHLIG-----LQNQSWINEWGSAQVVK 451

Query: 423 TVIRTQSKYWNCFKSTHSND 442
            ++R     W  +K+  + D
Sbjct: 452 EIVRGCKPNWKPYKTKRARD 471

>KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {ON}
           Anc_8.607 YPL116W
          Length = 717

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 51/102 (50%), Gaps = 7/102 (6%)

Query: 161 ETETGDSVYFNNDSLLSAKLSCGGAIEACKAVVEGR-----VKNALAVIRPPGHHAEPEI 215
           E+     +Y N+D++++ K S G       ++  G         A   IRPPGHH    +
Sbjct: 141 ESWNAGDIYLNSDTIMALKGSIGAIETGVDSIFNGPSPEHICNRAFVAIRPPGHHCHVGM 200

Query: 216 AGGFCLFSNVAVAAQNILKNYPESVRRIMILDWDIHHGNGTQ 257
             GFCL +N  +  +     Y   V  +++LD+D+HHG+GTQ
Sbjct: 201 PSGFCLLNNANITIEYAANTY--GVTHVVVLDFDLHHGDGTQ 240

 Score = 35.0 bits (79), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 65/137 (47%), Gaps = 17/137 (12%)

Query: 314 EYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIG----QCHVSPSCYGHMTHMLKSL 369
           E+  A +  +  MG+ ++  LV+ISSGFDA++ + +       +V  + Y   T     L
Sbjct: 346 EFFKAAKLEMASMGKPYK-GLVLISSGFDASEFEQVSMQRHSVNVPTTFYTMFTKDALKL 404

Query: 370 AR----GNLCVVLEGGYNLDSIAKSALGVAKILIGEPPDELPHPTQQPKPEAIETIETVI 425
           A+    G +  ++EGGY+  +I     GV   LIG     L +     +  + + ++ ++
Sbjct: 405 AQMHCHGKVISIMEGGYSDKAITS---GVFAHLIG-----LQNQDWIKEWGSEQVVKEIV 456

Query: 426 RTQSKYWNCFKSTHSND 442
           R     W  +K+  ++D
Sbjct: 457 RGCKPTWKPYKTKRNDD 473

>TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {ON}
           Anc_3.362 YPR068C
          Length = 494

 Score = 64.7 bits (156), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 70/272 (25%), Positives = 121/272 (44%), Gaps = 40/272 (14%)

Query: 209 HHAEPEIAGGFCLFSNVAVAAQNILKNYPESV---RRIMILDWDIHHGNGTQKAFYSDNR 265
           HHA    A GFC  +++ V+  N L+  P      R++  +D D+HHG+G + AF     
Sbjct: 206 HHAMKSRANGFCYINDI-VSLINELRKTPGQQGHKRKLTYIDLDLHHGDGVENAFNYSKD 264

Query: 266 VLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFN-CNIPWPYGGLGDAEYMWAFQQVVM 324
           +  +S+H +E G +YP T    +     GK +  N  N+P  + GL ++        +++
Sbjct: 265 IQIISIHLFEPG-FYPCTGGLKF-----GKPKSNNIINLPVKH-GLSNSNMFELVTNIII 317

Query: 325 PMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLAR----------GNL 374
           P+    Q D ++I  G D  + D   +  +  +  G    ++K +A            N+
Sbjct: 318 PLIELHQSDDIVILCGGDGLNNDYYNEWQL--TIIGLTRCIIKIIAAFVGPHQPGSCKNV 375

Query: 375 CVVLEGGYN--LDSIAKSALGVAKI-LIGEPP-------DELPHPTQQPKPEAI-----E 419
            ++  GGYN  L S   + L    + L G  P        E+PH T   K + +     E
Sbjct: 376 VLLGGGGYNELLASRFYTYLTYKVLQLAGRIPPAATTLAAEVPHGTIDDKDKELLIKDHE 435

Query: 420 TIETVIRTQSKYWNCFKSTHSNDGCNFKEEVT 451
            I+   +   KYW C++  +  DG +FK ++ 
Sbjct: 436 HIDEYEKEYYKYW-CYEIENGLDGLSFKRQIN 466

>KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 715

 Score = 64.7 bits (156), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 66/138 (47%), Gaps = 15/138 (10%)

Query: 132 AEEILQVHTKEHLAFLEKTPKMTREQLLKET-------ETGDSVYFNNDSLLSAKLSCGG 184
           A  +L+VH K+    L K  K + +++  E          GD +Y +  ++ + + S G 
Sbjct: 104 APHVLKVHGKDWPRELLKLCKESEKKIDNEEVEVPPDWNVGD-IYLSKHTIAALEGSIGA 162

Query: 185 AIEACKAVVEG-----RVKNALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPES 239
                 ++ +G         A   IRPPGHH+      GFCL +N  +A +   + Y   
Sbjct: 163 LEIGVDSIFQGVSVEQTANRAFIAIRPPGHHSHASTPSGFCLLNNAHIAIEYAFEKY--D 220

Query: 240 VRRIMILDWDIHHGNGTQ 257
           V   +ILD+D+HHG+GTQ
Sbjct: 221 VTHAVILDFDLHHGDGTQ 238

>Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116W
           (REAL)
          Length = 697

 Score = 63.9 bits (154), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 87/333 (26%), Positives = 135/333 (40%), Gaps = 70/333 (21%)

Query: 132 AEEILQVHTKEHLAFLEKTPKMTREQLLK-ETETGDS-----VYFNNDSLLSAKLSCGGA 185
           A  + +VH     A L K  +    +LLK E E  D+     +Y ++ ++ + + + G  
Sbjct: 107 APHVFKVHGSHWPAELIKLCQEADSKLLKGEIEVPDTWNSGDIYLSSKTIKALQGTIGAI 166

Query: 186 IEACKAVVEG----RVKN-ALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESV 240
                ++ +G     + N A   IRPPGHH       GFCL +N  VA +     Y  +V
Sbjct: 167 ETGVDSIFKGPSPEHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAHDAY--NV 224

Query: 241 RRIMILDWDIHHGNGTQ------------------------KAFYSDNRVLYVSLHRY-- 274
             +++LD+D+HHG+GTQ                        K F    +V Y S+H    
Sbjct: 225 THVVVLDFDLHHGDGTQDICWKRAGFKPEEEAKDTSYDDFGKKFAEFPKVGYFSMHDINS 284

Query: 275 ---ELGKYYPGTVHG--------------NYEQTGEGKGEGFNCNIPWPYGGL-GDAEYM 316
              E G      +                N   +     E FN      Y  L   A+  
Sbjct: 285 FPTESGFATKENIKNASTCIMNSHDLNIWNVHLSKWTTEEEFNILYRTKYRTLFAKADEF 344

Query: 317 WAFQQVVMP-MGREFQPDLVIISSGFDAADGD-TIGQCH-VSPSCYGHMTHMLKSL---- 369
           +   +V M   G+ F+  LV+IS+GFDA++ + T  Q H V+   Y + T    +L    
Sbjct: 345 FKSAKVEMKQQGKSFE-GLVVISAGFDASEFEQTSMQRHSVNVPTYFYTTFTKDALKLAQ 403

Query: 370 --ARGNLCVVLEGGYNLDSIAKSALGVAKILIG 400
               G +  ++EGGY+  +I     GV   LIG
Sbjct: 404 MHCHGKVLSLMEGGYSDKAICS---GVFAHLIG 433

>NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.607
           YPL116W
          Length = 684

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 75/296 (25%), Positives = 119/296 (40%), Gaps = 66/296 (22%)

Query: 164 TGDSVYFNNDSLLSAKLSCGGAIEACKAVVEG----RVKN-ALAVIRPPGHHAEPEIAGG 218
           +GD +Y ++ ++ + + S G    A  ++ +G     + N A   IRPPGHH       G
Sbjct: 144 SGD-IYLSSKTVQALQGSIGALETAVDSIFKGPSPEHISNRAFVAIRPPGHHCHFATPSG 202

Query: 219 FCLFSNVAVAAQNILKNYPESVRRIMILDWDIHHGNGTQ------KAFYSDN-------- 264
           FC+ +N  VA +    +Y   V  + +LD+D+HHG+GTQ        F  D         
Sbjct: 203 FCVLNNAHVAIEYAADSY--DVTHVAVLDFDLHHGDGTQDICWKRAGFKPDEETKENEEY 260

Query: 265 -----------RVLYVSLHRYELGKYYPG-TVHGNYEQTGEGKGEGFNCNI------PWP 306
                      RV Y S+H         G     N +          + NI       W 
Sbjct: 261 DGFGKKLAEFPRVGYFSMHDINSFPTESGFATKENIKNASTCIMNSHDLNIWNIHLSSWS 320

Query: 307 ----YGGLGDAEYMWAFQQV----------VMPMGREFQPDLVIISSGFDAADGD-TIGQ 351
               +  L  ++Y   F +           +  MG+ F+  L+++S+GFDA++ +    Q
Sbjct: 321 NEEEFSKLYRSKYRLLFAKADEFFKTAKSEMADMGKPFK-GLILLSAGFDASEFEQKTMQ 379

Query: 352 CH---VSPSCYGHMTHMLKSLA----RGNLCVVLEGGYNLDSIAKSALGVAKILIG 400
            H   V    Y   T     LA    +G +  ++EGGY+  +I     GV   LIG
Sbjct: 380 RHSVNVPTEFYTMFTKDALKLAQMHCQGKVLSLMEGGYSDKAITS---GVFAHLIG 432

>KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8.607
           YPL116W
          Length = 677

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 86/338 (25%), Positives = 136/338 (40%), Gaps = 77/338 (22%)

Query: 132 AEEILQVHTKEHLAFLEKTPKMTREQLL-------KETETGDSVYFNNDSLLSAKLSCGG 184
           A  +L+VH       + K  K   E+L        KE   GD +Y ++ +L + + + G 
Sbjct: 104 APHVLKVHGSRWPREVYKLCKRADEKLARGEIEVPKEWNAGD-IYLSSATLTALRGTIGA 162

Query: 185 AIEACKAVVEG----RVKN-ALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPES 239
                  +  G     + N    V+RPPGHH       GFCL +N  ++ +     Y   
Sbjct: 163 LETGVDTIFTGASPEHISNRVFVVVRPPGHHCHVTGPSGFCLLNNAHISIEYAADTY--G 220

Query: 240 VRRIMILDWDIHHGNGTQ------KAFYSDN---------------------RVLYVSLH 272
           V    ILD+D+HHG+GTQ        F  D                      +V Y S+H
Sbjct: 221 VTHAAILDFDLHHGDGTQDICWKRAGFKPDGATREENEEPYDDFGKRTAAFPKVGYFSMH 280

Query: 273 RYELGKYYPGTVHGNYEQTGEGKG---EGFNCNI------PWP----YGGLGDAEY--MW 317
             ++  +   + +   E          +  + NI      PW     +  L  ++Y  ++
Sbjct: 281 --DINSFPTESGYATSENIRNASTCIMDSHDLNIWNVHLAPWATEEDFMKLYRSKYRTLF 338

Query: 318 A-----FQQVVMPMGREFQP--DLVIISSGFDAADGD-TIGQCH---VSPSCYGHMTHML 366
           A     F+   + M ++  P   LV+IS+GFDA++ + T  Q H   V    Y   T  +
Sbjct: 339 AKADEYFKTARLEMQKQGTPFKGLVVISAGFDASEFEQTSMQRHSVNVPTEFYTLFTKDV 398

Query: 367 KSLA----RGNLCVVLEGGYNLDSIAKSALGVAKILIG 400
             LA    +G +  V+EGGY+  +I     GV   LIG
Sbjct: 399 LKLAQMHTQGKVLSVMEGGYSDKAITS---GVFAHLIG 433

>CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highly
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116w HOS3
          Length = 678

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 83/330 (25%), Positives = 131/330 (39%), Gaps = 70/330 (21%)

Query: 135 ILQVHTKEHLAFLEKTPKMTREQLLK-ETETGDS-----VYFNNDSLLSAKLSCGGAIEA 188
           +L+VH  E    L +  K +  +L + E E  D+     +Y  + ++ + + + G     
Sbjct: 106 VLKVHGSEWPRTLLQLCKQSDSKLARGEVEVPDNWNAGDIYLTSRTIEALQGTIGAVETG 165

Query: 189 CKAVVEG----RVKNALAV-IRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRI 243
             ++  G     + N + V IRPPGHH       GFCL +N  +  +     Y   V   
Sbjct: 166 VDSIFSGPSLEHISNRVFVAIRPPGHHCHYATPSGFCLLNNAHIGIEYAADKY--GVTHA 223

Query: 244 MILDWDIHHGNGTQ------------------------KAFYSDNRVLYVSLHRYELGKY 279
           +ILD+D+HHG+GTQ                        K F    +V Y S+H       
Sbjct: 224 VILDFDLHHGDGTQDLCWKRAGFKPDEHTEEDGYDEFGKKFAEFPKVGYFSMHDINSFPT 283

Query: 280 YPG-TVHGNYEQTGEGKGEGFNCNI------PWP----YGGLGDAEYMWAFQQV------ 322
             G     N +          + NI       W     +  +  ++Y   F +       
Sbjct: 284 ESGFATKENIKNASTCIMNSHDLNIWNVHLSRWSTEEEFAKIYKSKYRTLFAKADEFFKN 343

Query: 323 ----VMPMGREFQPDLVIISSGFDAADGD-TIGQCH---VSPSCYGHMTHMLKSLA---- 370
               +  +G+ F+  LV+IS+GFDA++ + T  Q H   V  S Y   T     LA    
Sbjct: 344 SKNEMNELGKPFK-GLVVISAGFDASEFEQTSMQRHSVNVPTSFYTMFTKDALKLAQMHC 402

Query: 371 RGNLCVVLEGGYNLDSIAKSALGVAKILIG 400
           +G +  +LEGGY+  +I     GV   LIG
Sbjct: 403 QGKVLSLLEGGYSDKAITS---GVFSHLIG 429

>NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.607
           YPL116W
          Length = 700

 Score = 61.2 bits (147), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 64/134 (47%), Gaps = 13/134 (9%)

Query: 135 ILQVHTKEHLAFLEKTPKMTREQLLK------ETETGDSVYFNNDSLLSAKLSCGGAIEA 188
           + +VH KE    + +  K   E+L K      E+     +Y ++ ++ + + + G     
Sbjct: 108 VYKVHGKEWPKEVIQLCKEADEKLAKGEIEVPESWNAGDIYLSSKTIQALQGTIGALETG 167

Query: 189 CKAVVEG----RVKN-ALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRI 243
             ++ +G     + N A   IRPPGHH       GFCL +N  VA +     Y   V  +
Sbjct: 168 VDSIFKGPSADHISNRAFVAIRPPGHHCHFATPSGFCLLNNAHVAIEYAADTY--GVTHV 225

Query: 244 MILDWDIHHGNGTQ 257
            +LD+D+HHG+GTQ
Sbjct: 226 AVLDFDLHHGDGTQ 239

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 62/137 (45%), Gaps = 17/137 (12%)

Query: 314 EYMWAFQQVVMPMGREFQPDLVIISSGFDAADGD-TIGQCH---VSPSCYGHMTHMLKSL 369
           EY    +  +  +GR F+  +V+IS+GFDA++ + T  Q H   V    Y   T     L
Sbjct: 343 EYFKTAKLEMAALGRPFK-GMVLISAGFDASEFEQTTMQRHGSNVPTEFYTMFTKDALKL 401

Query: 370 A----RGNLCVVLEGGYNLDSIAKSALGVAKILIGEPPDELPHPTQQPKPEAIETIETVI 425
           A    +G +  ++EGGY+  +I     GV   LIG     L +     +  +   I+ ++
Sbjct: 402 AQMHCQGKVLSLMEGGYSDKAITS---GVFAHLIG-----LQNQDWIKEWGSEHVIKEIV 453

Query: 426 RTQSKYWNCFKSTHSND 442
           R     W  +K+  S D
Sbjct: 454 RGCKPAWKPYKTKRSKD 470

>TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.607
           YPL116W
          Length = 698

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 53/99 (53%), Gaps = 8/99 (8%)

Query: 164 TGDSVYFNNDSLLSAKLSCGGAIEACKAVVEG----RVKN-ALAVIRPPGHHAEPEIAGG 218
           +GD +Y +++++ + + S G       ++  G     + N A   IRPPGHH       G
Sbjct: 146 SGD-IYLSSETIKAIEGSIGALELGLDSIFHGPSAEHISNRAFVAIRPPGHHCHVSTPSG 204

Query: 219 FCLFSNVAVAAQNILKNYPESVRRIMILDWDIHHGNGTQ 257
           FCL +N  +A +   + Y   V   +ILD+D+HHG+GTQ
Sbjct: 205 FCLLNNAQIAIEYAYEKY--GVSHAVILDFDLHHGDGTQ 241

 Score = 37.0 bits (84), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 64/137 (46%), Gaps = 17/137 (12%)

Query: 314 EYMWAFQQVVMPMGREFQPDLVIISSGFDAADGD-TIGQCH---VSPSCYGHMTHMLKSL 369
           E+    +  +  M + F+  LV+IS+GFDA++ + T  Q H   V  S Y   T     L
Sbjct: 348 EFFKNAKNQMQEMNKPFK-GLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKL 406

Query: 370 AR----GNLCVVLEGGYNLDSIAKSALGVAKILIGEPPDELPHPTQQPKPEAIETIETVI 425
           A+    G +  VLEGGY+  +IA    GV   LIG     L +     +  + + I+ ++
Sbjct: 407 AQLHCNGKVLSVLEGGYSDKAIAS---GVFSHLIG-----LQNQNWIKEWGSEQVIKEIV 458

Query: 426 RTQSKYWNCFKSTHSND 442
           R     W  +K+  S D
Sbjct: 459 RGCKPSWTPYKTKKSRD 475

>Smik_16.223 Chr16 (406804..410484) [3681 bp, 1226 aa] {ON} YPL012W
           (REAL)
          Length = 1226

 Score = 35.0 bits (79), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 47/116 (40%), Gaps = 29/116 (25%)

Query: 323 VMPMGREF-QPDLVIISS---GFDAADGDTIGQCH-----VSPSCYGHMTHMLKSLARGN 373
           ++ MGR+  +P+ +I  S   G+D A  D +         +S    G   HM+ S   G 
Sbjct: 849 LINMGRKMNEPNSIIKLSQIPGYDPATPDQLSSISEFFKIISAGLIGESQHMVSSSITGY 908

Query: 374 LCVVLEGGYNLDS--------------------IAKSALGVAKILIGEPPDELPHP 409
            C+V E    +DS                    I KSA+G  K+ +   P+EL  P
Sbjct: 909 ACLVFEFKNEIDSGILMDIYDTIELYLTSNSREIVKSAIGFTKVCVLGLPEELMRP 964

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 79,266,551
Number of extensions: 3576077
Number of successful extensions: 9600
Number of sequences better than 10.0: 106
Number of HSP's gapped: 9562
Number of HSP's successfully gapped: 122
Length of query: 712
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 595
Effective length of database: 40,065,477
Effective search space: 23838958815
Effective search space used: 23838958815
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)