Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E07678g2.286ON47747724240.0
Kwal_27.115322.286ON47948018610.0
KLTH0G10362g2.286ON52948418660.0
KLLA0E08361g2.286ON49149217790.0
KAFR0H033102.286ON48848917420.0
Ecym_33252.286ON49648517180.0
NDAI0G006602.286ON49649617110.0
CAGL0M06941g2.286ON49249316970.0
KNAG0H020002.286ON49849616910.0
TPHA0C034002.286ON49449316760.0
Suva_14.3252.286ON49048916730.0
YNL022C2.286ON49049016730.0
ADL215W2.286ON48448716450.0
Skud_14.3072.286ON49048916370.0
Kpol_1003.382.286ON49649616350.0
Smik_14.3092.286ON49048916350.0
NCAS0G037902.286ON49249516350.0
TDEL0G021702.286ON48448516180.0
ZYRO0A01892g2.286ON46548015890.0
TBLA0B069602.286ON50850715660.0
KAFR0J009702.247ON6102351661e-11
KNAG0I018702.247ON6292351624e-11
CAGL0J10032g2.247ON6192001607e-11
TBLA0E038502.247ON6322001591e-10
Kpol_1003.152.247ON6332001572e-10
SAKL0E08624g2.247ON6112001562e-10
NCAS0G030302.247ON4902001543e-10
ZYRO0A01562g2.247ON6172001544e-10
ADL254W2.247ON6032001544e-10
KLLA0F03399g2.247ON6192001544e-10
KLTH0G09460g2.247ON6372001544e-10
TPHA0C031502.247ON6082001544e-10
Kwal_23.48412.247ON6272051526e-10
NDAI0D010502.247ON6252001527e-10
Skud_14.2712.247ON6192001519e-10
YNL061W (NOP2)2.247ON6182051501e-09
Smik_14.2662.247ON6182241501e-09
TPHA0H001508.171ON6492921501e-09
Suva_14.2802.247ON6202001492e-09
Ecym_32842.247ON6062001482e-09
TDEL0C041502.247ON6142001482e-09
Kpol_1002.1098.171ON6702931473e-09
NDAI0B018308.171ON6862861464e-09
AFR179C8.171ON7002891439e-09
KNAG0D020508.171ON6822921402e-08
SAKL0H19448g8.171ON6912881384e-08
ZYRO0G08998g8.171ON6832931375e-08
NCAS0B043908.171ON6712921366e-08
Smik_2.928.171ON6742921367e-08
Suva_2.978.171ON6702921357e-08
TBLA0A087408.171ON6862951358e-08
KLTH0H08096g8.171ON6882871341e-07
Ecym_23538.171ON6902891331e-07
NDAI0B029808.171ON6792961312e-07
YBL024W (NCL1)8.171ON6842921312e-07
TDEL0B043908.171ON6732931313e-07
NCAS0B056408.171ON6592971313e-07
Skud_2.818.171ON6812921303e-07
KAFR0B022208.171ON6862931277e-07
KLLA0F12562g8.171ON7042921261e-06
CAGL0K01991g8.171ON6722171205e-06
KNAG0G015108.171ON6662881152e-05
TPHA0C028708.171ON6742901133e-05
Ecym_30036.1ON31974970.002
Kwal_14.20818.171ON272124910.010
Smik_6.4746.1ON31874880.029
Skud_16.116.1ON31874870.033
YPL266W (DIM1)6.1ON31874870.033
KNAG0L024406.1ON31781870.033
SAKL0E00660g6.1ON32274870.034
Suva_16.396.1ON31874860.042
Kpol_449.126.1ON31977850.056
CAGL0L07678g6.1ON31774840.081
ZYRO0F13486g1.251ON1610127850.087
KAFR0B064506.1ON31877830.11
AEL012C3.152ON18886810.13
ACR026W6.1ON31974820.16
NDAI0I027106.1ON31974810.18
NCAS0D022506.1ON31974810.19
Kpol_2001.31.251ON1643112810.28
KLLA0D00594g6.1ON32074790.32
TDEL0G047006.1ON31974790.36
ZYRO0F00308g6.1ON31974770.59
KLTH0C11704g6.1ON32274760.71
TPHA0J002006.1ON31974760.76
TBLA0A070806.1ON32174760.79
Kwal_56.223176.1ON36274760.97
KLLA0E16391g5.126ON25973741.3
TBLA0H018805.370ON170846732.3
ZYRO0E07854g6.261ON46039705.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E07678g
         (477 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E07678g Chr5 complement(621183..622616) [1434 bp, 477 aa] {...   938   0.0  
Kwal_27.11532 s27 complement(837572..839011) [1440 bp, 479 aa] {...   721   0.0  
KLTH0G10362g Chr7 (876756..878345) [1590 bp, 529 aa] {ON} highly...   723   0.0  
KLLA0E08361g Chr5 complement(751889..753364) [1476 bp, 491 aa] {...   689   0.0  
KAFR0H03310 Chr8 complement(630597..632063) [1467 bp, 488 aa] {O...   675   0.0  
Ecym_3325 Chr3 (623214..624704) [1491 bp, 496 aa] {ON} similar t...   666   0.0  
NDAI0G00660 Chr7 (144471..145961) [1491 bp, 496 aa] {ON} Anc_2.2...   663   0.0  
CAGL0M06941g Chr13 complement(706878..708356) [1479 bp, 492 aa] ...   658   0.0  
KNAG0H02000 Chr8 complement(353074..354570) [1497 bp, 498 aa] {O...   655   0.0  
TPHA0C03400 Chr3 (747016..748500) [1485 bp, 494 aa] {ON} Anc_2.2...   650   0.0  
Suva_14.325 Chr14 complement(574309..575781) [1473 bp, 490 aa] {...   649   0.0  
YNL022C Chr14 complement(591427..592899) [1473 bp, 490 aa] {ON} ...   649   0.0  
ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic ho...   638   0.0  
Skud_14.307 Chr14 complement(562104..563576) [1473 bp, 490 aa] {...   635   0.0  
Kpol_1003.38 s1003 (94479..95969) [1491 bp, 496 aa] {ON} (94479....   634   0.0  
Smik_14.309 Chr14 complement(553805..555277) [1473 bp, 490 aa] {...   634   0.0  
NCAS0G03790 Chr7 complement(699962..701440) [1479 bp, 492 aa] {O...   634   0.0  
TDEL0G02170 Chr7 (427274..428728) [1455 bp, 484 aa] {ON} Anc_2.2...   627   0.0  
ZYRO0A01892g Chr1 (156967..158364) [1398 bp, 465 aa] {ON} simila...   616   0.0  
TBLA0B06960 Chr2 (1646966..1648492) [1527 bp, 508 aa] {ON} Anc_2...   607   0.0  
KAFR0J00970 Chr10 (174873..176705) [1833 bp, 610 aa] {ON} Anc_2....    69   1e-11
KNAG0I01870 Chr9 complement(366800..368689) [1890 bp, 629 aa] {O...    67   4e-11
CAGL0J10032g Chr10 (983405..985264) [1860 bp, 619 aa] {ON} highl...    66   7e-11
TBLA0E03850 Chr5 (967569..969467) [1899 bp, 632 aa] {ON} Anc_2.2...    66   1e-10
Kpol_1003.15 s1003 (41683..43584) [1902 bp, 633 aa] {ON} (41683....    65   2e-10
SAKL0E08624g Chr5 complement(704579..706414) [1836 bp, 611 aa] {...    65   2e-10
NCAS0G03030 Chr7 (556908..558380) [1473 bp, 490 aa] {ON} Anc_2.2...    64   3e-10
ZYRO0A01562g Chr1 (128145..129998) [1854 bp, 617 aa] {ON} simila...    64   4e-10
ADL254W Chr4 (253602..255413) [1812 bp, 603 aa] {ON} Syntenic ho...    64   4e-10
KLLA0F03399g Chr6 (319007..320866) [1860 bp, 619 aa] {ON} simila...    64   4e-10
KLTH0G09460g Chr7 (787197..789110) [1914 bp, 637 aa] {ON} simila...    64   4e-10
TPHA0C03150 Chr3 (697508..699334) [1827 bp, 608 aa] {ON} Anc_2.2...    64   4e-10
Kwal_23.4841 s23 (890138..892021) [1884 bp, 627 aa] {ON} YNL061W...    63   6e-10
NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.2...    63   7e-10
Skud_14.271 Chr14 (500809..502668) [1860 bp, 619 aa] {ON} YNL061...    63   9e-10
YNL061W Chr14 (510540..512396) [1857 bp, 618 aa] {ON}  NOP2Proba...    62   1e-09
Smik_14.266 Chr14 (490908..492764) [1857 bp, 618 aa] {ON} YNL061...    62   1e-09
TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171...    62   1e-09
Suva_14.280 Chr14 (509488..511350) [1863 bp, 620 aa] {ON} YNL061...    62   2e-09
Ecym_3284 Chr3 (537227..539047) [1821 bp, 606 aa] {ON} similar t...    62   2e-09
TDEL0C04150 Chr3 complement(734914..736758) [1845 bp, 614 aa] {O...    62   2e-09
Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON} (272...    61   3e-09
NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.1...    61   4e-09
AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON} S...    60   9e-09
KNAG0D02050 Chr4 (339873..341921) [2049 bp, 682 aa] {ON} Anc_8.1...    59   2e-08
SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} high...    58   4e-08
ZYRO0G08998g Chr7 complement(726070..728121) [2052 bp, 683 aa] {...    57   5e-08
NCAS0B04390 Chr2 complement(795633..797648) [2016 bp, 671 aa] {O...    57   6e-08
Smik_2.92 Chr2 (166201..168225) [2025 bp, 674 aa] {ON} YBL024W (...    57   7e-08
Suva_2.97 Chr2 (172667..174679) [2013 bp, 670 aa] {ON} YBL024W (...    57   7e-08
TBLA0A08740 Chr1 (2141750..2143810) [2061 bp, 686 aa] {ON} Anc_8...    57   8e-08
KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} simila...    56   1e-07
Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}...    56   1e-07
NDAI0B02980 Chr2 complement(757926..759965) [2040 bp, 679 aa] {O...    55   2e-07
YBL024W Chr2 (172534..174588) [2055 bp, 684 aa] {ON}  NCL1S-aden...    55   2e-07
TDEL0B04390 Chr2 (769749..771770) [2022 bp, 673 aa] {ON} Anc_8.1...    55   3e-07
NCAS0B05640 Chr2 complement(1068983..1070962) [1980 bp, 659 aa] ...    55   3e-07
Skud_2.81 Chr2 (156273..158318) [2046 bp, 681 aa] {ON} YBL024W (...    55   3e-07
KAFR0B02220 Chr2 complement(438809..440869) [2061 bp, 686 aa] {O...    54   7e-07
KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} high...    53   1e-06
CAGL0K01991g Chr11 (173969..175987) [2019 bp, 672 aa] {ON} highl...    51   5e-06
KNAG0G01510 Chr7 complement(341469..343469) [2001 bp, 666 aa] {O...    49   2e-05
TPHA0C02870 Chr3 (620913..622937) [2025 bp, 674 aa] {ON} Anc_8.1...    48   3e-05
Ecym_3003 Chr3 complement(6934..7893) [960 bp, 319 aa] {ON} simi...    42   0.002
Kwal_14.2081 s14 (598648..599463) [816 bp, 272 aa] {ON} YBL024W ...    40   0.010
Smik_6.474 Chr6 complement(781184..782140) [957 bp, 318 aa] {ON}...    39   0.029
Skud_16.11 Chr16 (18214..19170) [957 bp, 318 aa] {ON} YPL266W (R...    38   0.033
YPL266W Chr16 (39121..40077) [957 bp, 318 aa] {ON}  DIM1Essentia...    38   0.033
KNAG0L02440 Chr12 (434232..435185) [954 bp, 317 aa] {ON} Anc_6.1...    38   0.033
SAKL0E00660g Chr5 complement(42779..43747) [969 bp, 322 aa] {ON}...    38   0.034
Suva_16.39 Chr16 (54705..55661) [957 bp, 318 aa] {ON} YPL266W (R...    38   0.042
Kpol_449.12 s449 complement(42834..43793) [960 bp, 319 aa] {ON} ...    37   0.056
CAGL0L07678g Chr12 complement(846285..847238) [954 bp, 317 aa] {...    37   0.081
ZYRO0F13486g Chr6 complement(1108746..1113578) [4833 bp, 1610 aa...    37   0.087
KAFR0B06450 Chr2 complement(1337903..1338859) [957 bp, 318 aa] {...    37   0.11 
AEL012C Chr5 complement(612993..613559) [567 bp, 188 aa] {ON} Sy...    36   0.13 
ACR026W Chr3 (404011..404970) [960 bp, 319 aa] {ON} Syntenic hom...    36   0.16 
NDAI0I02710 Chr9 (636403..637362) [960 bp, 319 aa] {ON} Anc_6.1 ...    36   0.18 
NCAS0D02250 Chr4 (419581..420540) [960 bp, 319 aa] {ON} Anc_6.1 ...    36   0.19 
Kpol_2001.3 s2001 complement(8876..10429,10432..13809) [4932 bp,...    36   0.28 
KLLA0D00594g Chr4 complement(57894..58856) [963 bp, 320 aa] {ON}...    35   0.32 
TDEL0G04700 Chr7 (858722..859681) [960 bp, 319 aa] {ON} Anc_6.1 ...    35   0.36 
ZYRO0F00308g Chr6 complement(32198..33157) [960 bp, 319 aa] {ON}...    34   0.59 
KLTH0C11704g Chr3 (966706..967674) [969 bp, 322 aa] {ON} highly ...    34   0.71 
TPHA0J00200 Chr10 complement(47344..48303) [960 bp, 319 aa] {ON}...    34   0.76 
TBLA0A07080 Chr1 complement(1748948..1749913) [966 bp, 321 aa] {...    34   0.79 
Kwal_56.22317 s56 complement(43543..44631) [1089 bp, 362 aa] {ON...    34   0.97 
KLLA0E16391g Chr5 (1465648..1466427) [780 bp, 259 aa] {ON} simil...    33   1.3  
TBLA0H01880 Chr8 (441695..446821) [5127 bp, 1708 aa] {ON} Anc_5....    33   2.3  
ZYRO0E07854g Chr5 complement(614363..615745) [1383 bp, 460 aa] {...    32   5.5  

>SAKL0E07678g Chr5 complement(621183..622616) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P53972 Saccharomyces
           cerevisiae YNL022C
          Length = 477

 Score =  938 bits (2424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/477 (95%), Positives = 456/477 (95%)

Query: 1   MNLYRDATWVFEYVEQEESKGKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKPF 60
           MNLYRDATWVFEYVEQEESKGKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKPF
Sbjct: 1   MNLYRDATWVFEYVEQEESKGKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKPF 60

Query: 61  LEKILKKSGILKDIPKKKGQPAFSNTTIXXXXXXXXXSKNKRIQMGKHPIKEFVLKHKVR 120
           LEKILKKSGILKDIPKKKGQPAFSNTTI         SKNKRIQMGKHPIKEFVLKHKVR
Sbjct: 61  LEKILKKSGILKDIPKKKGQPAFSNTTILLLVHDLLLSKNKRIQMGKHPIKEFVLKHKVR 120

Query: 121 LQAELAKLKVKLRVTNLSQLVKDDSNDMTPVRWIRINPVRCNGKVDDVKGELQKKFPTKV 180
           LQAELAKLKVKLRVTNLSQLVKDDSNDMTPVRWIRINPVRCNGKVDDVKGELQKKFPTKV
Sbjct: 121 LQAELAKLKVKLRVTNLSQLVKDDSNDMTPVRWIRINPVRCNGKVDDVKGELQKKFPTKV 180

Query: 181 SNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNPTPED 240
           SNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNPTPED
Sbjct: 181 SNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNPTPED 240

Query: 241 VIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKSIEV 300
           VIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKSIEV
Sbjct: 241 VIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKSIEV 300

Query: 301 HVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNKNXXXXXXXXXXXXMDQD 360
           HVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNKN            MDQD
Sbjct: 301 HVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNKNEVLPEEEQEKEEMDQD 360

Query: 361 LKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENERVVIDLLLDDKVQQWGWRV 420
           LKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENERVVIDLLLDDKVQQWGWRV
Sbjct: 361 LKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENERVVIDLLLDDKVQQWGWRV 420

Query: 421 RKRAGVIPTWSRRGFVEEFQQVYQDKQQAQELADGCIRALPKEDGGIGFFAVCFERD 477
           RKRAGVIPTWSRRGFVEEFQQVYQDKQQAQELADGCIRALPKEDGGIGFFAVCFERD
Sbjct: 421 RKRAGVIPTWSRRGFVEEFQQVYQDKQQAQELADGCIRALPKEDGGIGFFAVCFERD 477

>Kwal_27.11532 s27 complement(837572..839011) [1440 bp, 479 aa] {ON}
           YNL022C - Non-essential protein with similarity to S.
           pombe hypothetical protein E349594 [contig 27] FULL
          Length = 479

 Score =  721 bits (1861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/480 (70%), Positives = 395/480 (82%), Gaps = 4/480 (0%)

Query: 1   MNLYRDATWVFEYVEQEESKGKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKPF 60
           MN YRDATWV EYVE+ ES G++AGSLQTLVLNSCK+Y LKTNPKHLYA V+SCW+Y  F
Sbjct: 1   MNFYRDATWVLEYVEKAESSGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNEF 60

Query: 61  LEKILKKSGILKDIPKKKGQPAFSNTTIXXXXXXXXXSKNKRIQMGKHPIKEFVLKHKVR 120
           LEK+LKKS ILKD+PKKKG+  F+ TTI         +KNKRIQMGKHP+KEFVLKHK R
Sbjct: 61  LEKLLKKSEILKDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKTR 120

Query: 121 LQAELAKLKVKLRVTNLSQLVKDDSNDMTPVRWIRINPVRCNGKVDDVKGELQKKFPTKV 180
           L +EL +LK+KL+VT+L QL+KDD NDMTPVRW RINPVRC+GK ++V  EL KKFPT+V
Sbjct: 121 LNSELVRLKIKLKVTDLHQLLKDDRNDMTPVRWFRINPVRCHGKHEEVMAELAKKFPTRV 180

Query: 181 SNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNPTPED 240
            +W ++VPG+IYHDE+IPNLFGVHP DKITSHELYK GKIIIQDRASCFPAHILNP+P D
Sbjct: 181 DSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNPSPSD 240

Query: 241 VIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKSIEV 300
           VIID+C+APGNKTTHVAAHMF  +  P++  IHAFEKDPERAKTL+ M++ AGC K I +
Sbjct: 241 VIIDACAAPGNKTTHVAAHMFLND-QPQEPLIHAFEKDPERAKTLRTMVKTAGCSKGINI 299

Query: 301 HVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNKNXXXXXXXXXXXXMD-- 358
           HVGDFTKLAKP  F  V+GFIVDPSCSGSGIFGR+IIDD N                +  
Sbjct: 300 HVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHNKSREEGALPTQEEERQEIE 359

Query: 359 -QDLKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENERVVIDLLLDDKVQQWG 417
            +D+K RL KL+SFQF+I+K+A+SFP+AKKLVYSTCSIHAEENER+VIDLLLD KV++WG
Sbjct: 360 GKDIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENERIVIDLLLDSKVKEWG 419

Query: 418 WRVRKRAGVIPTWSRRGFVEEFQQVYQDKQQAQELADGCIRALPKEDGGIGFFAVCFERD 477
           WRVRKRAG IPTW RRGF  EF+ V+++   A+ELA+ CIR  PKEDGGIGFFAVCFERD
Sbjct: 420 WRVRKRAGAIPTWPRRGFYHEFEDVFREGDTAKELAEACIRVAPKEDGGIGFFAVCFERD 479

>KLTH0G10362g Chr7 (876756..878345) [1590 bp, 529 aa] {ON} highly
           similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022C
          Length = 529

 Score =  723 bits (1866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/484 (69%), Positives = 397/484 (82%), Gaps = 8/484 (1%)

Query: 1   MNLYRDATWVFEYVEQEESKGKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKPF 60
           MN YRDATWV EYVE  E  G++AGSLQTLVLNSCK+Y+LKTNPKH+YA V+SCW+Y  F
Sbjct: 47  MNFYRDATWVLEYVESAEKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNEF 106

Query: 61  LEKILKKSGILKDIPKKKGQPAFSNTTIXXXXXXXXXSKNKRIQMGKHPIKEFVLKHKVR 120
           L+K+LK+SGILKDIPKKKG+  F+ TTI         SKNKRIQMGKHP+KEFVLK+K R
Sbjct: 107 LDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKAR 166

Query: 121 LQAELAKLKVKLRVTNLSQLVKDDSNDMTPVRWIRINPVRCNGKVDDVKGELQKKFPTKV 180
           L +EL +LK+KL+VT+L QL+KDD NDMTPVRW R+NP+RC  K +D+  EL KKFPT+V
Sbjct: 167 LSSELVRLKIKLKVTDLQQLLKDDRNDMTPVRWFRLNPIRCGAKSEDILQELSKKFPTRV 226

Query: 181 SNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNPTPED 240
           ++W+ I PG IYHDE+IP LFGVHPADKITSHELYK GK+IIQDRASCFPAHILN + ED
Sbjct: 227 NSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASSED 286

Query: 241 VIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKSIEV 300
           +IID+C+APGNKTTHVAAH+F  + V +  +IHAFEKDPERAKTL+ MI  AGC K IEV
Sbjct: 287 LIIDACAAPGNKTTHVAAHIFQDQAV-ESVRIHAFEKDPERAKTLRTMINTAGCTKGIEV 345

Query: 301 HVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNKNXXXXXXXXXXXXM--- 357
           HVGDFT+LAKP KF  VTGFI+DPSCSGSGIFGRK+IDD N                   
Sbjct: 346 HVGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSKADGASPVEEEEKEEER 405

Query: 358 ----DQDLKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENERVVIDLLLDDKV 413
               D+DLK RL KL+SFQF+I+KHAMSFP+AKKLVYSTCS+HAEENER+V+DLLLD KV
Sbjct: 406 EDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIVVDLLLDSKV 465

Query: 414 QQWGWRVRKRAGVIPTWSRRGFVEEFQQVYQDKQQAQELADGCIRALPKEDGGIGFFAVC 473
           ++WGWRVRKRAGVIPTWSRRGF +EF++V++D+  A+ELA+ CIR  PKEDGGIGFFAVC
Sbjct: 466 KEWGWRVRKRAGVIPTWSRRGFYKEFEEVFRDEDTAKELAEACIRVAPKEDGGIGFFAVC 525

Query: 474 FERD 477
           FERD
Sbjct: 526 FERD 529

>KLLA0E08361g Chr5 complement(751889..753364) [1476 bp, 491 aa] {ON}
           similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022C
          Length = 491

 Score =  689 bits (1779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/492 (67%), Positives = 392/492 (79%), Gaps = 16/492 (3%)

Query: 1   MNLYRDATWVFEYVEQEESKGK-IAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKP 59
           M  YRDATWV E+VEQE SK K +AGSLQTLVL SCKRYKLKTNP+H+YAIV S W+Y+ 
Sbjct: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60

Query: 60  FLEKILKKSGILKDIPKKKGQPAFSNTTIXXXXXXXXXSKNKRIQMGKHPIKEFVLKHKV 119
           +L+KI+KKSGIL+D+PKKKG+P F+  TI         SK+KRIQMGKHPIK F+LKH+ 
Sbjct: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120

Query: 120 RLQAELAKLKVKLRVTNLSQLVK-DDSNDMTPVRWIRINPVRCNGKVDDVKGELQKKFPT 178
           RL+AEL KLKVKL+VT+LSQL+K DD  D+TPVRWIRINP+    + DDV  EL KKFP 
Sbjct: 121 RLKAELTKLKVKLKVTSLSQLIKTDDGEDVTPVRWIRINPILVKERYDDVLAELNKKFPQ 180

Query: 179 KVSNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNPTP 238
           +V++W +IVPG+IY+DE+IPNLFG+HP DKITSHE YKRGKIIIQDRASCFPAHILNP  
Sbjct: 181 RVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILNPNS 240

Query: 239 EDVIIDSCSAPGNKTTHVAAHMF-DPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKS 297
            DV+ID+C+APGNKTTHVAAH+F D +      +IHAFEKDPERAKTLQ M+  AGC K 
Sbjct: 241 TDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGCAKG 300

Query: 298 IEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNKNXXXXXXXXXXXXM 357
           +++HVGDFTKL KP+ F  VTGFIVDPSCSGSGIFGRK ID  N               +
Sbjct: 301 VKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQTSV 360

Query: 358 ------------DQDLKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENERVVI 405
                       +QDLK RL KLSSFQ+QI+KHAMSFP+AKK+ YSTCSIHAEENERVVI
Sbjct: 361 EPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENERVVI 420

Query: 406 DLLLDDKVQQWGWRVRKRAGVIPTWSRRGFVEEFQQVYQDKQQAQELADGCIRALPKEDG 465
           DLLLD KV++WGW+VRKR GVIPTW RRG+  EF++V+  K++A+ELA+GCIRALPKEDG
Sbjct: 421 DLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVFP-KEEAKELAEGCIRALPKEDG 479

Query: 466 GIGFFAVCFERD 477
           GIGFFAVCFERD
Sbjct: 480 GIGFFAVCFERD 491

>KAFR0H03310 Chr8 complement(630597..632063) [1467 bp, 488 aa] {ON}
           Anc_2.286 YNL022C
          Length = 488

 Score =  675 bits (1742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/489 (66%), Positives = 387/489 (79%), Gaps = 14/489 (2%)

Query: 1   MNLYRDATWVFEYVEQEESKGKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKPF 60
           M  YRDATWV EY+EQ++SKG+I+GSLQ+LVL SC++YKLKTNPKH+YA++ SCWKYKPF
Sbjct: 1   MEFYRDATWVLEYIEQQDSKGRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKPF 60

Query: 61  LEKILKKSGILKDIPKKKGQPAFSNTTIXXXXXXXXXSKNKRIQMGKHPIKEFVLKHKVR 120
           LEK++ KSGILKDIPKKKG+P ++  T+         SK KRIQMGKHPIK FVL++K R
Sbjct: 61  LEKVMSKSGILKDIPKKKGKPVYTRLTLLLLIHDLLLSKQKRIQMGKHPIKLFVLRYKSR 120

Query: 121 LQAELAKLKVKLRVTNLSQLVK--DDSNDMTPVRWIRINPVRCNGKVDDVKGELQKKFPT 178
           L +EL KLK+K +V +LS+LV   D SND+TPVRW RINP+RC      V  EL+KKFP 
Sbjct: 121 LHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRCPD-ASAVMKELEKKFPQ 179

Query: 179 KVSNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNPTP 238
           +V +W  IVPG+IYHDEFIP LFG+HP DKITSHELYK+G+IIIQDRASCFPAHILNPT 
Sbjct: 180 RVESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNPTL 239

Query: 239 EDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKSI 298
           ED IID+CSAPGNKTTHVA++MF    V   + I AFEKDPERAK LQKMI+VAGC K I
Sbjct: 240 EDKIIDACSAPGNKTTHVASYMFGNGLVDDVR-IFAFEKDPERAKVLQKMIKVAGCSKQI 298

Query: 299 EVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNK--------NXXXXXX 350
            V+VGDFTKLA P KF  VTGFIVDPSCSGSGIFGRK ID  N +        N      
Sbjct: 299 SVNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKKTQDIVDNGVPDEQ 358

Query: 351 XXXXXXMDQDLKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENERVVIDLLLD 410
                  + +L+ RL+KLSSFQFQ++KHAMSFP AK++VYSTCSIHAEENERV +DLLLD
Sbjct: 359 EEMAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENERVALDLLLD 418

Query: 411 DKVQQWGWRVRKRAGVIPTWSRRGFVEEFQQVYQDK--QQAQELADGCIRALPKEDGGIG 468
           +KV+QWGW++ KR  VIP W RRGFV EFQ++++DK   + QE+ADGCIRALP+EDGGIG
Sbjct: 419 EKVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDKTASECQEMADGCIRALPREDGGIG 478

Query: 469 FFAVCFERD 477
           FFA+CFERD
Sbjct: 479 FFAICFERD 487

>Ecym_3325 Chr3 (623214..624704) [1491 bp, 496 aa] {ON} similar to
           Ashbya gossypii ADL215W
          Length = 496

 Score =  666 bits (1718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/485 (66%), Positives = 385/485 (79%), Gaps = 10/485 (2%)

Query: 1   MNLYRDATWVFEYVEQEESK-GKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKP 59
           M  YRD++WV EY+EQE SK  +I+GSLQTLVL SCKRYKLKTNPKH+YAIV SCWKYK 
Sbjct: 14  MEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCWKYKM 73

Query: 60  FLEKILKKSGILKDIPKKKGQPAFSNTTIXXXXXXXXXSKNKRIQMGKHPIKEFVLKHKV 119
           +LEKI+K SG+L D+P KKG+P FS TTI         SKNKRI MGKHPIK FVLK +V
Sbjct: 74  YLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQV 133

Query: 120 RLQAELAKLKVKLRVTNLSQLVKDDSNDMTPVRWIRINPVRCNGKVDDVKGELQKKFPTK 179
           RL  E  K+ VKL+V +LS+LV+D+  DM+PVRWIRINP RC GKVDDV  EL+KKFP +
Sbjct: 134 RLSGEFKKMLVKLKVKSLSELVEDNDADMSPVRWIRINPFRCQGKVDDVLKELRKKFPKQ 193

Query: 180 VSNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNPTPE 239
           V +W++IVPG+IY DE+IPNL+GVHP+DKITSHELYKRGKIIIQDRASCFPA+ILNPTP 
Sbjct: 194 VDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILNPTPH 253

Query: 240 DVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKSIE 299
           DV+ID+CSAPGNKTTH+AAH+F P+      +I+AFE+D +RA+ L+KM+  AGC+  I+
Sbjct: 254 DVVIDACSAPGNKTTHIAAHIF-PDGNASDVKIYAFERDAKRAEILEKMVTSAGCESCIQ 312

Query: 300 VHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNK-------NXXXXXXXX 352
           + VGDFT+LAKP  F  VTGFI+DPSCSGSGIFGR+ +D  N         N        
Sbjct: 313 ISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSKLAEKVPNEVFEEQDP 372

Query: 353 XXXXMDQDLKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENERVVIDLLLDDK 412
                ++  KTRL KLSSFQFQI+KHAMSFPNAKKLVYSTCSIHAEENERVVIDLLLD  
Sbjct: 373 KEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEENERVVIDLLLDQN 432

Query: 413 VQQWGWRVRKRAGVIPTWSRRGFVEEFQQVYQDKQQAQELADGCIRALPKEDGGIGFFAV 472
           ++Q+GW+V KR  VIP W RRG + EF++V+   +QAQELADGCIRALPKEDGGIGFFAV
Sbjct: 433 IKQYGWKVAKRDSVIPAWQRRGILSEFEEVFP-HEQAQELADGCIRALPKEDGGIGFFAV 491

Query: 473 CFERD 477
           CFER+
Sbjct: 492 CFERE 496

>NDAI0G00660 Chr7 (144471..145961) [1491 bp, 496 aa] {ON} Anc_2.286
           YNL022C
          Length = 496

 Score =  663 bits (1711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/496 (66%), Positives = 397/496 (80%), Gaps = 20/496 (4%)

Query: 1   MNLYRDATWVFEYVEQEESKGKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKPF 60
           MN YRDATWV EYVEQ+E+KG+I+GSLQTLVL SC +YKLK NPKH+YA++ SCWKYKP+
Sbjct: 1   MNFYRDATWVLEYVEQQEAKGRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKPY 60

Query: 61  LEKILKKSGILKDIPKKKGQPAFSNTTIXXXXXXXXXSKNKRIQMGKHPIKEFVLKHKVR 120
           LEK++KKSGIL DIPKKKG+P +S  T+         SK+KRIQMGKHPIKE+VLKHK R
Sbjct: 61  LEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKSR 120

Query: 121 LQAELAKLKVKLRVTNLSQLV--KDDSNDMTPVRWIRINPVRC-NGK-VDDVKGELQKKF 176
           L +EL +LK+KL+V NLS++V   D + D+TPVRWIRINP+RC  G+ V+ V  EL KKF
Sbjct: 121 LHSELVRLKLKLKVKNLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKF 180

Query: 177 PTKVSNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNP 236
           P +V NW++IVPG+IY+DE+IP+L+G+HP DKITSHELYK+GKIIIQDRASCFPAHILNP
Sbjct: 181 PKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 237 TPEDVIIDSCSAPGNKTTHVAAHMF-DPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCD 295
           + +D+IID+C+APGNKTTHVA++MF D +      QI+AFEKDPERAK L+KMI+VAGC 
Sbjct: 241 SKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCS 300

Query: 296 KSIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTN-NKNXXXXXXXXXX 354
           K+I+V VGDFTK A PDKF  VTGFIVDPSCSGSGIFGRK +D  N  +N          
Sbjct: 301 KNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNDTTDKDKKS 360

Query: 355 XXMD-------------QDLKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENE 401
              D             +DLKTRL KLSSFQFQ++KHAMSFP AKK+VYSTCSIHAEENE
Sbjct: 361 TEEDDEVPDEQEDYNKKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEENE 420

Query: 402 RVVIDLLLDDKVQQWGWRVRKRAGVIPTWSRRGFVEEFQQVYQDK-QQAQELADGCIRAL 460
           RVV+DLLLD KV+QWGW+V  +  VIPTW RRG +EEF++V++D   + Q LADGCIRAL
Sbjct: 421 RVVLDLLLDSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDDPAKCQALADGCIRAL 480

Query: 461 PKEDGGIGFFAVCFER 476
           P++DGGIGFFAVCFER
Sbjct: 481 PRDDGGIGFFAVCFER 496

>CAGL0M06941g Chr13 complement(706878..708356) [1479 bp, 492 aa]
           {ON} similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022c
          Length = 492

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/493 (66%), Positives = 392/493 (79%), Gaps = 17/493 (3%)

Query: 1   MNLYRDATWVFEYVE-QEESKGKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKP 59
           M  YRD+TWV EY+E Q E  G+++GSLQT+VL  CK+Y++KTNPKH+YAIV SCWKYKP
Sbjct: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60

Query: 60  FLEKILKKSGILKDIPKKKGQPAFSNTTIXXXXXXXXXSKNKRIQMGKHPIKEFVLKHKV 119
           +L+KI+KKSG+L  IP+KKG+PAFS  T+         SK KRIQMGKHPIK +VLK+K 
Sbjct: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKLTLLLLCHDLLLSKAKRIQMGKHPIKNYVLKYKN 120

Query: 120 RLQAELAKLKVKLRVTNLSQLVKDDSND--MTPVRWIRINPVR-CNGKVDDVKGELQKKF 176
            L AE  KLK+KL++T+LSQ+V  D     MTPVRWIRINP+R  N   D V  EL+KKF
Sbjct: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRISNHDTDQVLNELKKKF 180

Query: 177 PTKVSNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNP 236
           PT+V+ W +I+PG+IY+DEFIPNL+G+H +DKITSHELYK+GKIIIQDRASCFPAHILNP
Sbjct: 181 PTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 237 TPEDVIIDSCSAPGNKTTHVAAHMF-DPEFVPKQK--QIHAFEKDPERAKTLQKMIQVAG 293
           + +DV+ID+CSAPGNKTTHVAAH+F DPE  P+    QI+AFEKDPERA+ LQKMI+ AG
Sbjct: 241 SADDVVIDACSAPGNKTTHVAAHIFGDPE-NPRNDNVQIYAFEKDPERAQILQKMIKTAG 299

Query: 294 CDKSIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNKNXXX------ 347
           C K+I+V+VGDFT++A P K+S VTGFI+DPSCSGSGIFGRK +D  NN           
Sbjct: 300 CHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNHGKKSNDEVPD 359

Query: 348 -XXXXXXXXXMDQDLKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENERVVID 406
                      ++ LK RL+KL+SFQFQI++HAMSFPNAKK+VYSTCSIHAEENERVVID
Sbjct: 360 ENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIHAEENERVVID 419

Query: 407 LLLDDKVQQWGWRVRKRAGVIPTWSRRGFVEEFQQVYQDK--QQAQELADGCIRALPKED 464
           LLLD KVQ WGWRV K+  V+PTW RRGF EEFQ+V+ DK  Q+ QELADGC+RALPKED
Sbjct: 420 LLLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRALPKED 479

Query: 465 GGIGFFAVCFERD 477
           GGIGFFAVCF RD
Sbjct: 480 GGIGFFAVCFVRD 492

>KNAG0H02000 Chr8 complement(353074..354570) [1497 bp, 498 aa] {ON}
           Anc_2.286 YNL022C
          Length = 498

 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/496 (64%), Positives = 386/496 (77%), Gaps = 20/496 (4%)

Query: 1   MNLYRDATWVFEYVEQEESKGKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKPF 60
           M+ YRDATWV E +E +++KGK++GSLQTLVLNSCKR+K+KTNPKH+YA+V SCW+YKPF
Sbjct: 1   MDFYRDATWVLESIENQDAKGKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKPF 60

Query: 61  LEKILKKSGILKDIPKKKGQPAFSNTTIXXXXXXXXXSKNKRIQMGKHPIKEFVLKHKVR 120
           LEK++KKS IL ++P+KKG P F   T+         SK+KRIQMGKHPIK FVLK+K R
Sbjct: 61  LEKVMKKSKILDEVPQKKGAPVFQRLTLLLLCHDLLLSKSKRIQMGKHPIKMFVLKYKTR 120

Query: 121 LQAELAKLKVKLRVTNLSQLVKDD--SNDMTPVRWIRINPVRCNGK--VDDVKGELQKKF 176
           L AELAK+KVKL+V +LSQL   D  +ND+TPVRW R+NP+RC  +  V  V  EL+KKF
Sbjct: 121 LNAELAKMKVKLKVKDLSQLTDSDDLTNDITPVRWFRVNPLRCTAEKPVQSVVTELRKKF 180

Query: 177 PTKVSNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNP 236
             KV +W ++VPG+IY+DE+IPNLF VHP DKITSHELYK+GKIIIQDRASCFPAHILNP
Sbjct: 181 TEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 237 TPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQK--QIHAFEKDPERAKTLQKMIQVAGC 294
             +D++ID+C+APGNKTTH+AAHMF  +   ++   QI+AFEKDPERA+ L KMI++AGC
Sbjct: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300

Query: 295 DKSIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNKNX--------- 345
            K IEV VGDFTKLA P     V G IVDPSCSGSGIFGRK ID  N+K           
Sbjct: 301 SKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTDEEKEEEER 360

Query: 346 --XXXXXXXXXXXMDQDLKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENERV 403
                        +D +LKTRL+KLSSFQFQI+K+A+SFP A K+VYSTCSIHAEENERV
Sbjct: 361 ELDAVPEEQEEQELDDNLKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEENERV 420

Query: 404 VIDLLLDDKVQQWGWRVRKRAGVIPTWSRRGFVEEFQQVYQDKQQA---QELADGCIRAL 460
           VIDLLLD KV++ GWRV  R+ VIPTW RRG V+EFQQV+++  ++   QE+ADGCIRAL
Sbjct: 421 VIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIRAL 480

Query: 461 PKEDGGIGFFAVCFER 476
           P+EDGGIGFFAVCFER
Sbjct: 481 PREDGGIGFFAVCFER 496

>TPHA0C03400 Chr3 (747016..748500) [1485 bp, 494 aa] {ON} Anc_2.286
           YNL022C
          Length = 494

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/493 (62%), Positives = 390/493 (79%), Gaps = 16/493 (3%)

Query: 1   MNLYRDATWVFEYVEQEESKGKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKPF 60
           MN YRDATWV E++E+E++KGKI+GS+Q++VL SCK YK+++NPKH+YA++ SCWKYKP+
Sbjct: 1   MNFYRDATWVLEFLEKEDAKGKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKPY 60

Query: 61  LEKILKKSGILKDIPKKKGQPAFSNTTIXXXXXXXXXSKNKRIQMGKHPIKEFVLKHKVR 120
           LE I+KKSGIL +IPKK G+P F   TI         SK+KRIQMGKHP+KE+VLK+K  
Sbjct: 61  LETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKTS 120

Query: 121 LQAELAKLKVKLRVTNLSQLV--KDDSNDMTPVRWIRINPVRC--NGKVDDVKGELQKKF 176
           L++E+ KL+VK+++ +   L+  +DD+ND+TPVRW RINP+R   +  V+ +  EL+KKF
Sbjct: 121 LRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKKF 180

Query: 177 PTKVSNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNP 236
           PT+V +WS+I  GTIYHDEFIPNLFGVH  DKITSHELYK+GKIIIQDRASCFPAH+LNP
Sbjct: 181 PTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNP 240

Query: 237 TPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDK 296
             +D++IDSC+APGNKTTH AA++       ++ QIHAFEKDPERAK LQKM++ AGC +
Sbjct: 241 GKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCAR 300

Query: 297 SIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNKNXXXXXXXXXXXX 356
           +IEV+VGDFTK+A P+KF  VTGFIVDPSCSGSGIFGRK ID  N K             
Sbjct: 301 TIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKEGEDVDEDDESE 360

Query: 357 M-----------DQDLKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENERVVI 405
                         DLKTRL+KL+SFQFQ++KHAM+FP A+KLVYSTCSIHAEENERVVI
Sbjct: 361 SIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENERVVI 420

Query: 406 DLLLDDKVQQWGWRVRKRAGVIPTWSRRGFVEEFQQVYQ-DKQQAQELADGCIRALPKED 464
           DLLLD+ +++ GWRV  R  VIPTW RRG+V+EF++V++ D+++ +E+A GCIRALPKED
Sbjct: 421 DLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRDDEEKCKEIAGGCIRALPKED 480

Query: 465 GGIGFFAVCFERD 477
           GGIGFFAVCFERD
Sbjct: 481 GGIGFFAVCFERD 493

>Suva_14.325 Chr14 complement(574309..575781) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/489 (64%), Positives = 384/489 (78%), Gaps = 13/489 (2%)

Query: 1   MNLYRDATWVFEYVEQEESKGKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKPF 60
           MN YRDATWV E +E+E +K +I+GS+QTLVL SCKRYKLK+NPKH+YA++ SCWKYKP+
Sbjct: 1   MNFYRDATWVLEDIEKEAAKVRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  LEKILKKSGILKDIPKKKGQPAFSNTTIXXXXXXXXXSKNKRIQMGKHPIKEFVLKHKVR 120
           LEK++KK+ IL++IPKKKG+P F+  T+         SK KRIQMGKHPIKE+VLK K  
Sbjct: 61  LEKVMKKARILEEIPKKKGKPLFARLTLLLLCHDLLLSKQKRIQMGKHPIKEYVLKFKSP 120

Query: 121 LQAELAKLKVKLRVTNLSQLV--KDDSNDMTPVRWIRINPVRC--NGKVDDVKGELQKKF 176
           L +E+ KLK+KL+V +LS+LV  +D  ND+ PVRWIRINP++C  +G  + V  EL+KKF
Sbjct: 121 LHSEMVKLKLKLKVRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKKF 180

Query: 177 PTKVSNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNP 236
             KV NWSE+VPG+IYHDE+IPNLFG+HP DKIT+HELYK GKIIIQDRASCFPAHIL+P
Sbjct: 181 TQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240

Query: 237 TPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDK 296
              D++ID+CSAPGNKTTH A+++F      K+ QI+AFEKDPERAK LQKMI+VAGC  
Sbjct: 241 GSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEKDPERAKILQKMIKVAGCSA 300

Query: 297 SIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNKNXXXXXXXXXXXX 356
           +I+V+VGDFTKLA P+K   VTGFIVDPSCSGSGIFGRK  D  N +             
Sbjct: 301 NIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIDEKDDEDDAVP 360

Query: 357 MDQ-------DLKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENERVVIDLLL 409
            +Q       +L+TRL KLSSFQFQ++KHAMSFP AKK+VYSTCSIHAEENERVVIDLLL
Sbjct: 361 DEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENERVVIDLLL 420

Query: 410 DDKVQQWGWRVRKRAGVIPTWSRRGFVEEFQQVYQD--KQQAQELADGCIRALPKEDGGI 467
           D  VQ+WGW+V  R  V+P+W RRG VEEF++V++D      Q+LA+GCIRALPKEDGGI
Sbjct: 421 DKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDGSAHDPQQLAEGCIRALPKEDGGI 480

Query: 468 GFFAVCFER 476
           GFFAVCF R
Sbjct: 481 GFFAVCFVR 489

>YNL022C Chr14 complement(591427..592899) [1473 bp, 490 aa] {ON}
           Putative cytosine 5-methyltransferase, contains seven
           beta-strand methyltransferase motif similar to
           NOP2/YNL061W; green fluorescent protein (GFP)-fusion
           protein localizes to the nucleus; predicted to be
           involved in ribosome biogenesis
          Length = 490

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/490 (64%), Positives = 384/490 (78%), Gaps = 13/490 (2%)

Query: 1   MNLYRDATWVFEYVEQEESKGKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKPF 60
           MN YRDATWV E +E+E +K +I+GS+QTLVL SCKRYKLK+NPKH+YA++ SCWKYKP+
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  LEKILKKSGILKDIPKKKGQPAFSNTTIXXXXXXXXXSKNKRIQMGKHPIKEFVLKHKVR 120
           LEK++KK+ IL+DIPKKKG+P FS  T+         SK KRIQMGKHPIK++VLK K  
Sbjct: 61  LEKVMKKAHILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LQAELAKLKVKLRVTNLSQLV--KDDSNDMTPVRWIRINPVRC--NGKVDDVKGELQKKF 176
           L +E+ KLK+KL+V  LS+LV  +D SND+ PVRWIRINP++C  NG+ + V  EL+KKF
Sbjct: 121 LHSEMVKLKLKLKVRELSELVLSEDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKKF 180

Query: 177 PTKVSNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNP 236
             KV  WSE+VPG+IY+DEFIPNLFG+HP+DKIT+HELYK GKIIIQDRASCFPAHILNP
Sbjct: 181 TLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILNP 240

Query: 237 TPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDK 296
            P D++IDSCSAPGNKTTH A++++         +I+AFEKDPERAK LQKMI++AGC  
Sbjct: 241 GPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCSP 300

Query: 297 SIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNKNXXXXXXXXXXXX 356
           +I V+VGDFTKLA P+K+  VT FIVDPSCSGSGIFGRK  D  N +             
Sbjct: 301 NISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNRRKIDDKDDDGGIVP 360

Query: 357 MDQ-------DLKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENERVVIDLLL 409
            +Q       +L+TRL KLSSFQFQ++KHAMSFP AKK+VYSTCSIHAEENERVVIDLLL
Sbjct: 361 DEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDLLL 420

Query: 410 DDKVQQWGWRVRKRAGVIPTWSRRGFVEEFQQVYQD--KQQAQELADGCIRALPKEDGGI 467
           D  V++WGW+V  +  VIP+W RRG VEEF++V++D      Q+LA+GCIRALPK DGGI
Sbjct: 421 DKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTYDPQQLAEGCIRALPKSDGGI 480

Query: 468 GFFAVCFERD 477
           GFFAVCFERD
Sbjct: 481 GFFAVCFERD 490

>ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL022C
          Length = 484

 Score =  638 bits (1645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/487 (63%), Positives = 373/487 (76%), Gaps = 13/487 (2%)

Query: 1   MNLYRDATWVFEYVEQE-ESKGKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKP 59
           M  YRDA+WV EY+EQE   K K+AGSL +LVL S K+YKLK++ +H+YAIV S WKYK 
Sbjct: 1   MEFYRDASWVLEYIEQEFARKSKVAGSLHSLVLQSHKKYKLKSDVRHVYAIVASFWKYKA 60

Query: 60  FLEKILKKSGILKDIPKKKGQPAFSNTTIXXXXXXXXXSKNKRIQMGKHPIKEFVLKHKV 119
           +L++I++KSG+LKD+P+KKG+PAF  +T+         SK KRI MGKHP+K FVLKH+ 
Sbjct: 61  YLDRIIEKSGLLKDVPRKKGEPAFKRSTLGLVVHDLLLSKKKRIHMGKHPLKAFVLKHQT 120

Query: 120 RLQAELAKLKVKLRVTNLSQLVKDDSNDMTPVRWIRINPVRCNGKVDDVKGELQKKFPTK 179
           RL+ E AK  VKL V +LS LV+D+  D TPVRWIR+NP R  G+ ++V  ELQKKFP +
Sbjct: 121 RLRGEYAKQLVKLGVADLSVLVQDEREDATPVRWIRLNPFRIRGQREEVLQELQKKFPRR 180

Query: 180 VSNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNPTPE 239
           V++W E+ PG+IY DE++  L+GVHPADKITSHELYKRGKIIIQDRASCFPA IL P   
Sbjct: 181 VADWRELTPGSIYEDEYVAGLYGVHPADKITSHELYKRGKIIIQDRASCFPAQILAPGRS 240

Query: 240 DVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKSIE 299
           DVIID+C+APGNKTTHVAAH+F PE      QIHAFE+DP+RAKTL+KMI  AGCD +IE
Sbjct: 241 DVIIDACAAPGNKTTHVAAHIF-PEGGADHAQIHAFERDPQRAKTLRKMIATAGCDNAIE 299

Query: 300 VHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNKNXXXXXXXXXXXXMDQ 359
           VHVGDFT+ A+P+ F  VTGFIVDPSCSGSGIFGR+++D T                 ++
Sbjct: 300 VHVGDFTRDAQPEIFKNVTGFIVDPSCSGSGIFGRQLVDATQETQKGTETDPSADVPEEE 359

Query: 360 ---------DLKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENERVVIDLLLD 410
                    +LK RL KLSSFQFQI+KHAMSFP+AKKL+YSTCS+HAEENERVVIDLLLD
Sbjct: 360 TFEATKSAVELKNRLAKLSSFQFQIVKHAMSFPSAKKLIYSTCSVHAEENERVVIDLLLD 419

Query: 411 DKVQQWGWRVRKRAGVIPTWSRRGFVEEFQQVYQDKQQAQELADGCIRALPKEDGGIGFF 470
            KVQ+ GW+V  R+ VIP W RRG   EF++V+ D  QA+ELA GCIR LPKEDGGIGFF
Sbjct: 420 SKVQKGGWKVASRSKVIPAWPRRGHQAEFEEVFPD--QAEELAGGCIRVLPKEDGGIGFF 477

Query: 471 AVCFERD 477
           AVCFER+
Sbjct: 478 AVCFERE 484

>Skud_14.307 Chr14 complement(562104..563576) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  635 bits (1637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/489 (63%), Positives = 381/489 (77%), Gaps = 13/489 (2%)

Query: 1   MNLYRDATWVFEYVEQEESKGKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKPF 60
           MN YRDATWV E +E+E +K +I+GS+QTLVL SCK+YKLK+NPKH+YA++ SCWKYKP+
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  LEKILKKSGILKDIPKKKGQPAFSNTTIXXXXXXXXXSKNKRIQMGKHPIKEFVLKHKVR 120
           LEK++KK+ IL+DIPKKKG+P FS  T+         SK KRIQMGKHPIK++VLK K  
Sbjct: 61  LEKVMKKARILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LQAELAKLKVKLRVTNLSQLV--KDDSNDMTPVRWIRINPVRC--NGKVDDVKGELQKKF 176
           L +E+ KLK+KL+V +LS++V  +D +ND+ PVRWIRINP++C  NG  + V  EL+KKF
Sbjct: 121 LHSEMVKLKLKLKVRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKKF 180

Query: 177 PTKVSNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNP 236
             KV+ WS++VPG+IY+DE+IPNLFG+HP DKIT+HELYK GKIIIQDRASCFPAHIL+P
Sbjct: 181 TLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240

Query: 237 TPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDK 296
             +D++ID+CSAPGNKTTH A+++          +I+AFEKDPERAK LQKM++VAGC  
Sbjct: 241 GADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVAGCSS 300

Query: 297 SIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNKNXXXXXXXXXXXX 356
           +I+V VGDFTKLA PDK    TGFIVDPSCSGSGIFGRK  D  N +             
Sbjct: 301 NIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDNDVIP 360

Query: 357 MDQ-------DLKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENERVVIDLLL 409
            +Q       +L+TRL KLSSFQFQ++KHAMSFP AKK+VYSTCSIHAEENERVVIDLLL
Sbjct: 361 DEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDLLL 420

Query: 410 DDKVQQWGWRVRKRAGVIPTWSRRGFVEEFQQVYQD--KQQAQELADGCIRALPKEDGGI 467
           D  VQ+WGW+V  R  VIP+W RRG VEEF +V++D      ++LA+GCIRALPKEDGGI
Sbjct: 421 DKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKEDGGI 480

Query: 468 GFFAVCFER 476
           GFFAVCFER
Sbjct: 481 GFFAVCFER 489

>Kpol_1003.38 s1003 (94479..95969) [1491 bp, 496 aa] {ON}
           (94479..95969) [1491 nt, 497 aa]
          Length = 496

 Score =  634 bits (1635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/496 (62%), Positives = 387/496 (78%), Gaps = 19/496 (3%)

Query: 1   MNLYRDATWVFEYVEQEESKGKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKPF 60
           M+ YRD+TWV EY+E+E +K KI+GSLQ LVL SCK+YK+K+NP+H+YA V SCWK KP+
Sbjct: 1   MDFYRDSTWVLEYLEKENAKDKISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKPY 60

Query: 61  LEKILKKSGILKDIPKKKGQPAFSNTTIXXXXXXXXXSKNKRIQMGKHPIKEFVLKHKVR 120
           LEK++K+SGIL DIP KKG+P F   T+         SK+KRIQMGKHPIK ++LK+K R
Sbjct: 61  LEKVMKRSGILDDIPNKKGKPQFERLTLLLLCHDLLLSKSKRIQMGKHPIKTYILKYKTR 120

Query: 121 LQAELAKLKVKLRVTNLSQLVKDDS--NDMTPVRWIRINPVRC--NGKVDDVKGELQKKF 176
           L +EL KLK+KL+V +LS+L++D++  +D+TPVRWIRINP+R   +  ++ +  EL KKF
Sbjct: 121 LHSELVKLKLKLKVRDLSELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKF 180

Query: 177 PTKVSNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNP 236
           PT+V++WS+IVPGTIYHD++IPNLFGVH  DKITSHELYK GK+IIQDRASCFPAHILNP
Sbjct: 181 PTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNP 240

Query: 237 TPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDK 296
              D++ID+C+APGNKTTH A+++       +  QI+AFEKDPERAK LQ MI+VAGC  
Sbjct: 241 GKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFEKDPERAKILQHMIKVAGCSN 300

Query: 297 SIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNKNXXXXXXXXXXXX 356
           +I+V+VGDFTK+A P+KF  VTGFIVDPSCSGSGIFGRK +D  N K             
Sbjct: 301 TIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQDD 360

Query: 357 MD--------------QDLKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENER 402
            D               DLKTRL+KL+SFQFQ++KHAMSFP AKK+VYSTCSIHAEENE 
Sbjct: 361 EDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEG 420

Query: 403 VVIDLLLDDKVQQWGWRVRKRAGVIPTWSRRGFVEEFQQVYQDK-QQAQELADGCIRALP 461
           VVIDLLLD KVQ+WGW+V  R+ VIPTW RRGF  EF +V++D+ ++ QELADGCIR LP
Sbjct: 421 VVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRDEDEKCQELADGCIRVLP 480

Query: 462 KEDGGIGFFAVCFERD 477
           KEDGGIGFFAVCFER+
Sbjct: 481 KEDGGIGFFAVCFERN 496

>Smik_14.309 Chr14 complement(553805..555277) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  634 bits (1635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/489 (64%), Positives = 375/489 (76%), Gaps = 13/489 (2%)

Query: 1   MNLYRDATWVFEYVEQEESKGKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKPF 60
           MN YRDATWV E +E+E +K +I+GS+QTLVL SCKRYKLK+NPKH+YA++ SCWKYKP+
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKPY 60

Query: 61  LEKILKKSGILKDIPKKKGQPAFSNTTIXXXXXXXXXSKNKRIQMGKHPIKEFVLKHKVR 120
           LEK++KK+ IL+DIPKKKG+P FS  T+         SK KRIQMGKHPIK++VLK K  
Sbjct: 61  LEKVMKKARILEDIPKKKGKPLFSRLTLLLLCHDLLISKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LQAELAKLKVKLRVTNLSQLV--KDDSNDMTPVRWIRINPVRC--NGKVDDVKGELQKKF 176
           L +E+ KLK+KL+V NLS+LV  +D +ND+ PVRWIRINP++C  NGK + V  EL+KKF
Sbjct: 121 LHSEMVKLKLKLKVRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKKF 180

Query: 177 PTKVSNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNP 236
             KV  WSE+VP +IY+DE+IPNLFG+HP+DKIT+HELYK GKIIIQDRASCFPAHILNP
Sbjct: 181 TLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILNP 240

Query: 237 TPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDK 296
            P D++ID+CSAPGNKTTH A+++        + +I+AFEKDPERAK LQKMI++AGC  
Sbjct: 241 GPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCSS 300

Query: 297 SIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNKNXXXXXXXXXXXX 356
           +I+V VGDFTKLA P+KF   TGFIVDPSCSGSGIFGRK  D  N K             
Sbjct: 301 NIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRKKMDDKDDDNDIVP 360

Query: 357 MDQ-------DLKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENERVVIDLLL 409
            +Q       +L+TRL KLSSFQFQ++KHAMSFP AKK+VYSTCSIHAEENERVVIDLLL
Sbjct: 361 DEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENERVVIDLLL 420

Query: 410 DDKVQQWGWRVRKRAGVIPTWSRRG--FVEEFQQVYQDKQQAQELADGCIRALPKEDGGI 467
           D  VQ+WGWRV  R+ VIP W RRG     E           QELA+GCIRALPK+DGGI
Sbjct: 421 DKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGAAHDPQELAEGCIRALPKDDGGI 480

Query: 468 GFFAVCFER 476
           GFFAVCFER
Sbjct: 481 GFFAVCFER 489

>NCAS0G03790 Chr7 complement(699962..701440) [1479 bp, 492 aa] {ON}
           Anc_2.286 YNL022C
          Length = 492

 Score =  634 bits (1635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/495 (65%), Positives = 392/495 (79%), Gaps = 22/495 (4%)

Query: 1   MNLYRDATWVFEYVEQEESKGKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKPF 60
           M  YRDATWV E+VEQE++KG+I+GSLQTLV  SCKRYKLK NPKH+YA++ SCWKYKP+
Sbjct: 1   MEFYRDATWVLEFVEQEDAKGRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKPY 60

Query: 61  LEKILKKSGILKDIPKKKGQPAFSNTTIXXXXXXXXXSKNKRIQMGKHPIKEFVLKHKVR 120
           LEK++KKSGIL +IPK+KG+P +S  T+         SK KRIQMGK PIK +VLKHK R
Sbjct: 61  LEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKSR 120

Query: 121 LQAELAKLKVKLRVTNLSQLVK--DDSNDMTPVRWIRINPVRCNGKVDDVKGELQKKFPT 178
           L +EL KLK+KL+V NLS+LV   D  NDMTPVRWIRINP+RC+  V+  K E+QKKFPT
Sbjct: 121 LHSELVKLKLKLKVKNLSELVSNADSENDMTPVRWIRINPLRCD--VEATKLEIQKKFPT 178

Query: 179 KVSNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNPTP 238
           +V NWS+IVPG+IY+DE+IPNLFG+HP DKITSH LYK+GKIIIQDRASCFPAHIL+P  
Sbjct: 179 RVENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHPDE 238

Query: 239 EDVIIDSCSAPGNKTTHVAAHMF-DPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKS 297
            DV+ID C+APGNKTTH A++M  +P   PK  QI+AFEK+PERAK L KMI+VAGC K+
Sbjct: 239 NDVVIDGCAAPGNKTTHTASYMIKEPSKDPKI-QIYAFEKNPERAKILDKMIKVAGCSKN 297

Query: 298 IEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNKNXXXXXXXXXXXXM 357
           I+++VGDFTK+A P+K+  VTGFIVDPSCSGSGIFGRK ID  N K              
Sbjct: 298 IKINVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNKDEADKKEGDE 357

Query: 358 D-------------QDLKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENERVV 404
           +             +DLKTRL+KLSSFQFQ++KHAMSFPNAKK+VYSTCSIHAEENERVV
Sbjct: 358 EEEVPDEQEEYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEENERVV 417

Query: 405 IDLLLDDKVQQWGWRVRKRAGVIPTWSRRGFVEEFQQVYQ---DKQQAQELADGCIRALP 461
           IDL+LD KV+QWGW+V  R+ VIPTW RRG VEEF++V++   +  + +ELA GCIRALP
Sbjct: 418 IDLMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCIRALP 477

Query: 462 KEDGGIGFFAVCFER 476
           + DGGIGFFAVCFER
Sbjct: 478 RSDGGIGFFAVCFER 492

>TDEL0G02170 Chr7 (427274..428728) [1455 bp, 484 aa] {ON} Anc_2.286
           YNL022C
          Length = 484

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/485 (64%), Positives = 380/485 (78%), Gaps = 10/485 (2%)

Query: 1   MNLYRDATWVFEYVEQEESKGKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKPF 60
           MN YRDATWV EYVEQE+ KG+++GS+QTLVL SC+RYKLK++PKHLYA+V SCW+YK  
Sbjct: 1   MNFYRDATWVLEYVEQEDEKGRLSGSMQTLVLKSCQRYKLKSDPKHLYAVVDSCWRYKAL 60

Query: 61  LEKILKKSGILKDIPKKKGQPAFSNTTIXXXXXXXXXSKNKRIQMGKHPIKEFVLKHKVR 120
           LEKI+K+S I  DIPKKKG+P +S  T+         SK KRIQMGK PIKE+VLKHK R
Sbjct: 61  LEKIMKRSKIYDDIPKKKGKPIYSRLTLLLMCHDLLISKQKRIQMGKLPIKEYVLKHKTR 120

Query: 121 LQAELAKLKVKLRVTNLSQLV--KDDSNDMTPVRWIRINPVRC-NGKVDDVKGELQKKFP 177
           L +EL KLK+KL+V +LS++V  +D SND+TPVRWIRINP+RC    V+ V  EL KKFP
Sbjct: 121 LNSELVKLKLKLKVKSLSEIVDKEDSSNDVTPVRWIRINPLRCPKNDVEPVLKELIKKFP 180

Query: 178 TKVSNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNPT 237
            +VS+WS+I  GT+Y+DEF+PNLFGVHP DKITSHELY++GKIIIQDR+SCFPAHILNP 
Sbjct: 181 QRVSHWSDITSGTLYYDEFVPNLFGVHPRDKITSHELYRQGKIIIQDRSSCFPAHILNPG 240

Query: 238 PEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQK-QIHAFEKDPERAKTLQKMIQVAGCDK 296
             DV+ID+C+APGNKTTHVAAH+  PE+  +Q  +I+AFEKDP RA  L+KM  VAGC +
Sbjct: 241 KNDVVIDACAAPGNKTTHVAAHIL-PEYTREQTPKIYAFEKDPARANILKKMTSVAGCGQ 299

Query: 297 SIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTN----NKNXXXXXXXX 352
           ++E+HVGDFTKLA P  F  VTG IVDPSCSGSGIFGRK +D  N               
Sbjct: 300 TVEIHVGDFTKLAVPANFKDVTGLIVDPSCSGSGIFGRKSVDSHNVAKKKTETDSEIPDE 359

Query: 353 XXXXMDQDLKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENERVVIDLLLDDK 412
               +  D+  RL+KL+SFQFQ++KHAMS PNAKK+VYSTCSIHAEENERVVIDLLLD  
Sbjct: 360 EEKMVGDDVANRLSKLASFQFQVVKHAMSMPNAKKIVYSTCSIHAEENERVVIDLLLDRN 419

Query: 413 VQQWGWRVRKRAGVIPTWSRRGFVEEFQQVYQDKQ-QAQELADGCIRALPKEDGGIGFFA 471
           +++WGW+V  R  VIP W RRG V+EF+QV++D   +  ELADGCIRALP+EDGGIGFFA
Sbjct: 420 IKEWGWKVASREEVIPKWPRRGKVKEFEQVFRDDPVKCNELADGCIRALPQEDGGIGFFA 479

Query: 472 VCFER 476
           VCF+R
Sbjct: 480 VCFKR 484

>ZYRO0A01892g Chr1 (156967..158364) [1398 bp, 465 aa] {ON} similar
           to uniprot|P53972 Saccharomyces cerevisiae YNL022C
          Length = 465

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/480 (61%), Positives = 379/480 (78%), Gaps = 19/480 (3%)

Query: 1   MNLYRDATWVFEYVEQEESKGKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKPF 60
           M+ YRD+TW+ EY+E EE KGK++GSLQ+ VL +C +YK+K NPKH+YA+V SCWKY+ +
Sbjct: 1   MDFYRDSTWILEYLEAEEKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRMY 60

Query: 61  LEKILKKSGILKDIPKKKGQPAFSNTTIXXXXXXXXXSKNKRIQMGKHPIKEFVLKHKVR 120
           LE+I+ KSGILK IP+KKG+PAFS  TI         SK KRIQMGKHPIK++VLK+K R
Sbjct: 61  LERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKTR 120

Query: 121 LQAELAKLKVKLRVTNLSQLV-KDDSNDMTPVRWIRINPVRCNGKVDDVKGELQKKFPTK 179
           L AEL KLKVKL+V  LS+LV +DD +D TPVRWIRINP++C+  V  V  +L KKFP +
Sbjct: 121 LHAELVKLKVKLKVKELSELVDQDDGDDATPVRWIRINPLKCDIPV--VVEQLNKKFPHR 178

Query: 180 VSNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNPTPE 239
           V +W ++ PG+IY+DE++PNLFG+HP++KITSH+LYK+GK+IIQDRASC PAHILNP  E
Sbjct: 179 VDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNPGKE 238

Query: 240 DVIIDSCSAPGNKTTHVAAHMFDP--EFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKS 297
           DV++D+C+APGNKTTH+AAH+     +    Q QIHAFEK+P RAK LQKM   AGC   
Sbjct: 239 DVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGCGSL 298

Query: 298 IEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNKNXXXXXXXXXXXXM 357
           +++HVGDFT+LA PD+F  VT  +VDPSCSGSGIFGRK ++ +N+               
Sbjct: 299 VKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLESSNDSQ------------- 345

Query: 358 DQDLKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENERVVIDLLLDDKVQQWG 417
           DQ L+ RL+KLSSFQFQ++KHAMS PNA+K+VYSTCS+HAEENERVVIDLLLD KV++WG
Sbjct: 346 DQKLQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEENERVVIDLLLDSKVKEWG 405

Query: 418 WRVRKRAGVIPTWSRRGFVEEFQQVYQ-DKQQAQELADGCIRALPKEDGGIGFFAVCFER 476
           W++  R+ V+PTW RRG  EEF++V++ DK + Q LA+ CIRALP+EDGGIGFFAVCF+R
Sbjct: 406 WQLSPRSEVVPTWPRRGIAEEFEEVFRDDKPKCQLLAESCIRALPREDGGIGFFAVCFQR 465

>TBLA0B06960 Chr2 (1646966..1648492) [1527 bp, 508 aa] {ON}
           Anc_2.286 YNL022C
          Length = 508

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/507 (59%), Positives = 383/507 (75%), Gaps = 30/507 (5%)

Query: 1   MNLYRDATWVFEYVEQEESKGKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKPF 60
           MN YRDATWV E++E ++ KG+++GSL +LV+ SCK++K+++NPKH+YA+V S WK+KPF
Sbjct: 1   MNFYRDATWVLEHLEAQDKKGRVSGSLLSLVVKSCKQFKIQSNPKHVYAVVESAWKFKPF 60

Query: 61  LEKILKKSGILKDIPKKKGQPAFSNTTIXXXXXXXXXSKNKRIQMGKHPIKEFVLKHKVR 120
           +E+I+ KSGIL DIPKKKG+P +   T+         SK++RIQMGKHPIK FVL +K R
Sbjct: 61  IERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKTR 120

Query: 121 LQAELAKLKVKLRVTNLSQLVKDDSN------DMTPVRWIRINPVRC--NGKVDDVKGEL 172
           L +EL KLK+KL+VTNL+ ++  +SN      D+TPVRWIRINP+R       DD+  EL
Sbjct: 121 LHSELVKLKLKLKVTNLNDMINANSNSNDSTDDITPVRWIRINPIRIPKQKSSDDIILEL 180

Query: 173 QKKFPTKVSNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAH 232
           +KKF TKV +WS+I PG IY+DE+IPNLFG+ P DKITSHELYK GKIIIQDRASCFPAH
Sbjct: 181 RKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAH 240

Query: 233 ILNPTPEDVIIDSCSAPGNKTTHVAAHMF----DPEFVPKQKQIHAFEKDPERAKTLQKM 288
           ILN TP+D IID+C+APGNKTTHVA+++     D      +K++ AFEKDPER+K L KM
Sbjct: 241 ILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKM 300

Query: 289 IQVAGCDKSIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNKNXXXX 348
           +++AGC K +E++ GDFTK+A P+K+  VTGFIVDPSCSGSGIFGRK ID+ N+      
Sbjct: 301 VKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKKLTE 360

Query: 349 XXXXXXXXMDQ----------------DLKTRLTKLSSFQFQILKHAMSFPNAKKLVYST 392
                    +Q                DL+TRL+KLSSFQFQ++KHAMSFP+AKK+VYST
Sbjct: 361 KVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYST 420

Query: 393 CSIHAEENERVVIDLLLDDKVQQWGWRVRKRAGVIPTWSRRGFVEEFQQVYQD--KQQAQ 450
           CSIHAEENERVVIDLLLD KV++WGW+V  R+  IPTW RRG V EF+ V+++      +
Sbjct: 421 CSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDPAMDPK 480

Query: 451 ELADGCIRALPKEDGGIGFFAVCFERD 477
           +LA+GCIR LPKEDGGIGFFAVCFER+
Sbjct: 481 QLAEGCIRTLPKEDGGIGFFAVCFERN 507

>KAFR0J00970 Chr10 (174873..176705) [1833 bp, 610 aa] {ON} Anc_2.247
           YNL061W
          Length = 610

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 98/235 (41%), Gaps = 54/235 (22%)

Query: 180 VSNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNPTPE 239
           + NW+++  G    D  +P   G  P         Y  G+ I+Q  +S  P   L+P   
Sbjct: 294 IGNWTKV--GLQIFDSQVP--IGATPE--------YLAGQYILQAASSFLPVIALDPQEN 341

Query: 240 DVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKSIE 299
           + I+D  SAPG KTT+++A M +   V       A + +  R K+L   I   GC  +I 
Sbjct: 342 ERILDMASAPGGKTTYISALMKNTGCV------FANDANKNRTKSLIANIHRLGCTNTI- 394

Query: 300 VHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNKNXXXXXXXXXXXXMDQ 359
             V ++     P         ++D  CSG+G+ G+                       DQ
Sbjct: 395 --VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGK-----------------------DQ 429

Query: 360 DLKTRLT-----KLSSFQFQILKHAMSFPNAKK-----LVYSTCSIHAEENERVV 404
            +K   T     ++   Q Q+L  A+   +A       +VYSTCS+  EE+E VV
Sbjct: 430 SVKVSRTEKDFIQIPHLQKQLLLSAIDSVDANSKSGGVIVYSTCSVAVEEDEAVV 484

>KNAG0I01870 Chr9 complement(366800..368689) [1890 bp, 629 aa] {ON}
           Anc_2.247 YNL061W
          Length = 629

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 99/235 (42%), Gaps = 54/235 (22%)

Query: 180 VSNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNPTPE 239
           + NW+++  G    D  +P   G  P         Y  G  I+Q  +S  P   L+P   
Sbjct: 311 IGNWTKV--GLQIFDSQVP--IGATPE--------YLAGHYILQAASSFLPVIALDPQEN 358

Query: 240 DVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKSIE 299
           + I+D  +APG KTT+++A M +   V       A + +  R K+L   I   GC  +I 
Sbjct: 359 ERILDMAAAPGGKTTYISAMMKNTGCV------FANDANKNRTKSLIANIHRLGCTNTI- 411

Query: 300 VHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNKNXXXXXXXXXXXXMDQ 359
             V ++     P         ++D  CSG+G+ G+                       DQ
Sbjct: 412 --VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGK-----------------------DQ 446

Query: 360 DLKTRLT-----KLSSFQFQILKHAMSF--PNAKK---LVYSTCSIHAEENERVV 404
            +K   T     ++   Q Q+L  A+     N+KK   +VYSTCS+  EE+E VV
Sbjct: 447 SVKVSRTEKDFIQIPHLQKQLLLSAIDSVDANSKKGGIIVYSTCSVAVEEDEAVV 501

>CAGL0J10032g Chr10 (983405..985264) [1860 bp, 619 aa] {ON} highly
           similar to uniprot|P40991 Saccharomyces cerevisiae
           YNL061w NOP2
          Length = 619

 Score = 66.2 bits (160), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 57/200 (28%), Positives = 88/200 (44%), Gaps = 42/200 (21%)

Query: 215 YKRGKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHA 274
           Y  G  I+Q  +S  P   L+P   + ++D  SAPG KTT+++A M +   V       A
Sbjct: 325 YLAGNYILQAASSFLPVVALDPQENERVLDMASAPGGKTTYISALMKNTGCV------FA 378

Query: 275 FEKDPERAKTLQKMIQVAGCDKSIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGR 334
            + + +R K+L   I   GC  +I   V ++     P         ++D  CSG+G+ G+
Sbjct: 379 NDANKKRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRVLLDAPCSGTGVIGK 435

Query: 335 KIIDDTNNKNXXXXXXXXXXXXMDQDLKTRLT-----KLSSFQFQILKHAMSF--PNAKK 387
                                  DQ +K   T     ++   Q Q+L  A+     N+KK
Sbjct: 436 -----------------------DQSVKVSRTEKDFIQIPHLQKQLLLSAIDSVDANSKK 472

Query: 388 ---LVYSTCSIHAEENERVV 404
              +VYSTCS+  EE+E VV
Sbjct: 473 GGVIVYSTCSVAVEEDEAVV 492

>TBLA0E03850 Chr5 (967569..969467) [1899 bp, 632 aa] {ON} Anc_2.247
           YNL061W
          Length = 632

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 55/200 (27%), Positives = 85/200 (42%), Gaps = 42/200 (21%)

Query: 215 YKRGKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHA 274
           Y  G  I+Q  +S  P   L+P   + ++D  SAPG KTT+++A M +         I A
Sbjct: 336 YLAGNYILQAASSFLPVIALDPQENERVLDMASAPGGKTTYISALMKNTGC------IFA 389

Query: 275 FEKDPERAKTLQKMIQVAGCDKSIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGR 334
            + +  R K+L   I   GC  +I   V ++     P         ++D  CSG+G+ G+
Sbjct: 390 NDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGK 446

Query: 335 KIIDDTNNKNXXXXXXXXXXXXMDQDLKTRLT-----KLSSFQFQILKHAM-----SFPN 384
                                  DQ +K   T     ++   Q Q++  A+     +  N
Sbjct: 447 -----------------------DQSVKVSRTEKDFIQIPHLQKQLILSAIDSLDSNSKN 483

Query: 385 AKKLVYSTCSIHAEENERVV 404
              LVYSTCS+  EE+E VV
Sbjct: 484 GGVLVYSTCSVAVEEDEAVV 503

>Kpol_1003.15 s1003 (41683..43584) [1902 bp, 633 aa] {ON}
           (41683..43584) [1902 nt, 634 aa]
          Length = 633

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 87/200 (43%), Gaps = 42/200 (21%)

Query: 215 YKRGKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHA 274
           Y  G+ I+Q  +S  P   L+P   + ++D  +APG KTT+++A M +   V       A
Sbjct: 337 YLAGQYILQAASSFLPVVALDPQENERVLDMAAAPGGKTTYISALMKNTGCV------FA 390

Query: 275 FEKDPERAKTLQKMIQVAGCDKSIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGR 334
            + +  R K+L   I   GC  +I   V ++     P         ++D  CSG+G+ G+
Sbjct: 391 NDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGK 447

Query: 335 KIIDDTNNKNXXXXXXXXXXXXMDQDLKTRLT-----KLSSFQFQILKHAMSFPNAKK-- 387
                                  DQ +K+  T     ++   Q Q+L  A+   +A    
Sbjct: 448 -----------------------DQSVKSSRTEKDFIQIPHLQKQLLLSAIDSVDANSKT 484

Query: 388 ---LVYSTCSIHAEENERVV 404
              +VYSTCS+  EE+E VV
Sbjct: 485 GGVIVYSTCSVAVEEDEAVV 504

>SAKL0E08624g Chr5 complement(704579..706414) [1836 bp, 611 aa] {ON}
           similar to uniprot|P40991 Saccharomyces cerevisiae
           YNL061W NOP2 Probable RNA m(5)C methyltransferase
           essential for processing and maturation of 27S pre-rRNA
           and large ribosomal subunit biogenesis localized to the
           nucleolus
          Length = 611

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 55/200 (27%), Positives = 85/200 (42%), Gaps = 42/200 (21%)

Query: 215 YKRGKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHA 274
           Y  G  I+Q  +S  P   L+P   + I+D  +APG KTT+++A M +   V       A
Sbjct: 316 YLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISALMKNTGCV------FA 369

Query: 275 FEKDPERAKTLQKMIQVAGCDKSIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGR 334
            + +  R K+L   I   GC  +I   V ++     P         ++D  CSG+G+ G+
Sbjct: 370 NDANKARTKSLIANIHRLGCHNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGK 426

Query: 335 KIIDDTNNKNXXXXXXXXXXXXMDQDLKTRLT-----KLSSFQFQILKHAMSFPNAKK-- 387
                                  DQ +K   T     ++   Q Q++  A+   +A    
Sbjct: 427 -----------------------DQSVKVSRTEKDFMQIPHLQKQLILSAIDSVDAHSKT 463

Query: 388 ---LVYSTCSIHAEENERVV 404
              +VYSTCS+  EENE VV
Sbjct: 464 GGVIVYSTCSVAVEENEAVV 483

>NCAS0G03030 Chr7 (556908..558380) [1473 bp, 490 aa] {ON} Anc_2.247
           YNL061W
          Length = 490

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 84/200 (42%), Gaps = 42/200 (21%)

Query: 215 YKRGKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHA 274
           Y  G  I+Q  +S  P   L+P   + I+D  +APG KTT+++A M +   V       A
Sbjct: 194 YLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTGCV------FA 247

Query: 275 FEKDPERAKTLQKMIQVAGCDKSIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGR 334
            + +  R K+L   I   GC  +I   V ++     P         ++D  CSG+G+ G+
Sbjct: 248 NDANKNRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGK 304

Query: 335 KIIDDTNNKNXXXXXXXXXXXXMDQDLKTRLT-----KLSSFQFQILKHAMSFPNAKK-- 387
                                  DQ +K   T     ++   Q Q+L  A+   +     
Sbjct: 305 -----------------------DQSVKVSRTEKDFIQIPHLQKQLLLSAIDSVDCNSKH 341

Query: 388 ---LVYSTCSIHAEENERVV 404
              +VYSTCS+  EE+E VV
Sbjct: 342 GGVIVYSTCSVAVEEDEAVV 361

>ZYRO0A01562g Chr1 (128145..129998) [1854 bp, 617 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 617

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 86/200 (43%), Gaps = 42/200 (21%)

Query: 215 YKRGKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHA 274
           Y  G  I+Q  +S  P   L+P   + I+D  +APG KTT+++A M +   V       A
Sbjct: 323 YLAGNYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISALMKNTGCV------FA 376

Query: 275 FEKDPERAKTLQKMIQVAGCDKSIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGR 334
            + +  R K+L   I   GC  +I   V ++     P         ++D  CSG+G+ G+
Sbjct: 377 NDANKSRTKSLVANIHRLGCTNTI---VCNYDAREFPRVIGGFDRILLDAPCSGTGVIGK 433

Query: 335 KIIDDTNNKNXXXXXXXXXXXXMDQDLKTRLT-----KLSSFQFQILKHAMSFPNAKK-- 387
                                  DQ +K   T     ++   Q Q+L  A+   ++    
Sbjct: 434 -----------------------DQSVKVSRTEKDFMQIPHLQKQLLLSAIDSVDSHSKT 470

Query: 388 ---LVYSTCSIHAEENERVV 404
              +VYSTCS+  EE+E+VV
Sbjct: 471 GGIIVYSTCSVAVEEDEQVV 490

>ADL254W Chr4 (253602..255413) [1812 bp, 603 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL061W (NOP2)
          Length = 603

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 85/200 (42%), Gaps = 42/200 (21%)

Query: 215 YKRGKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHA 274
           Y  G  I+Q  +S  P   L+P   + I+D  +APG KTT+++A M +   V       A
Sbjct: 309 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTGCV------FA 362

Query: 275 FEKDPERAKTLQKMIQVAGCDKSIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGR 334
            + +  R K+L   I   GC  +I   V ++     P         ++D  CSG+G+ G+
Sbjct: 363 NDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGK 419

Query: 335 KIIDDTNNKNXXXXXXXXXXXXMDQDLKTRLT-----KLSSFQFQILKHAMSFPNAKK-- 387
                                  DQ +K   T     ++   Q Q++  A+   ++    
Sbjct: 420 -----------------------DQSVKVNRTEKDFMQIPHLQKQLILSAIDSVDSNSKH 456

Query: 388 ---LVYSTCSIHAEENERVV 404
              +VYSTCS+  EENE VV
Sbjct: 457 GGVIVYSTCSVAVEENEAVV 476

>KLLA0F03399g Chr6 (319007..320866) [1860 bp, 619 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 619

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 85/200 (42%), Gaps = 42/200 (21%)

Query: 215 YKRGKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHA 274
           Y  G  I+Q  +S  P   L+P   + I+D  +APG KTT+++A M +   V       A
Sbjct: 319 YLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISAMMKNTGCV------FA 372

Query: 275 FEKDPERAKTLQKMIQVAGCDKSIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGR 334
            + +  R K+L   I   GC  +I   V ++     P         ++D  CSG+G+ G+
Sbjct: 373 NDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGK 429

Query: 335 KIIDDTNNKNXXXXXXXXXXXXMDQDLKTRLT-----KLSSFQFQILKHAMSFPNAKK-- 387
                                  DQ +K   T     ++   Q Q+L  A+   ++    
Sbjct: 430 -----------------------DQSVKVSRTEKDFMQIPHLQKQLLLSAIDSVDSNSKT 466

Query: 388 ---LVYSTCSIHAEENERVV 404
              +VYSTCS+  +ENE VV
Sbjct: 467 GGVIVYSTCSVAVDENEAVV 486

>KLTH0G09460g Chr7 (787197..789110) [1914 bp, 637 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 637

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 55/200 (27%), Positives = 84/200 (42%), Gaps = 42/200 (21%)

Query: 215 YKRGKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHA 274
           Y  G  I+Q  +S  P   L+P   + I+D  +APG KTT+++A M +   V       A
Sbjct: 333 YLAGHYILQAASSFLPVVALDPHENERILDMAAAPGGKTTYISAMMKNTGCV------FA 386

Query: 275 FEKDPERAKTLQKMIQVAGCDKSIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGR 334
            + +  R K+L   I   GC  +I   V ++     P         ++D  CSG+G+  +
Sbjct: 387 NDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIAK 443

Query: 335 KIIDDTNNKNXXXXXXXXXXXXMDQDLKTRLT-----KLSSFQFQILKHAMSFPNAKK-- 387
                                  DQ +K   T     ++   Q Q+L  A+   +A    
Sbjct: 444 -----------------------DQSVKVSRTDKDFMQIPHLQKQLLLSAIDSVDANSKT 480

Query: 388 ---LVYSTCSIHAEENERVV 404
              +VYSTCS+  EENE VV
Sbjct: 481 GGVIVYSTCSVAVEENEAVV 500

>TPHA0C03150 Chr3 (697508..699334) [1827 bp, 608 aa] {ON} Anc_2.247
           YNL061W
          Length = 608

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 86/200 (43%), Gaps = 42/200 (21%)

Query: 215 YKRGKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHA 274
           Y  G+ I+Q  +S  P   L+P   + ++D  +APG KTT+++A M +   V       A
Sbjct: 317 YLAGQYILQAASSFLPVVALDPQLNERVLDMAAAPGGKTTYISALMKNTGCV------FA 370

Query: 275 FEKDPERAKTLQKMIQVAGCDKSIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGR 334
            + +  R K+L   I   GC  +I   V ++     P         ++D  CSG+G+ G+
Sbjct: 371 NDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGK 427

Query: 335 KIIDDTNNKNXXXXXXXXXXXXMDQDLKTRLT-----KLSSFQFQILKHAMSFPNAKK-- 387
                                  DQ +K   T     ++   Q Q+L  A+   +A    
Sbjct: 428 -----------------------DQSVKVSRTEKDFIQIPHLQKQLLLSAIDSVDANSKT 464

Query: 388 ---LVYSTCSIHAEENERVV 404
              +VYSTCS+  EE+E VV
Sbjct: 465 GGFIVYSTCSVAVEEDEAVV 484

>Kwal_23.4841 s23 (890138..892021) [1884 bp, 627 aa] {ON} YNL061W
           (NOP2) - 90-kDa protein, located in nucleolus, that is
           homologous to a human proliferation-associated nucleolar
           protein, p120 [contig 5] FULL
          Length = 627

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 57/205 (27%), Positives = 86/205 (41%), Gaps = 43/205 (20%)

Query: 215 YKRGKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHA 274
           Y  G  I+Q  +S  P   L+P   + I+D  +APG KTT+++A M +   V       A
Sbjct: 331 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTGCV------FA 384

Query: 275 FEKDPERAKTLQKMIQVAGCDKSIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGR 334
            + +  R K+L   I   GC  +I   V ++     P         ++D  CSG+G+  +
Sbjct: 385 NDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIAK 441

Query: 335 KIIDDTNNKNXXXXXXXXXXXXMDQDLKTRLT-----KLSSFQFQILKHAMSFPNAKK-- 387
                                  DQ +K   T     ++   Q Q+L  A+   +A    
Sbjct: 442 -----------------------DQSVKVSRTEKDFIQIPHLQKQLLLSAIDSVDANSKT 478

Query: 388 ---LVYSTCSIHAEENERVVIDLLL 409
              +VYSTCS+  EENE  VID  L
Sbjct: 479 GGVIVYSTCSVAVEENE-AVIDYAL 502

>NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.247
           YNL061W
          Length = 625

 Score = 63.2 bits (152), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 83/200 (41%), Gaps = 42/200 (21%)

Query: 215 YKRGKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHA 274
           Y  G  I+Q  +S  P   L+P   + I+D  +APG KTT+++A M           + A
Sbjct: 329 YLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISALM------KNTGTVFA 382

Query: 275 FEKDPERAKTLQKMIQVAGCDKSIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGR 334
            + +  R K+L   I   GC  +I   V ++     P         ++D  CSG+G+ G+
Sbjct: 383 NDANKNRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGK 439

Query: 335 KIIDDTNNKNXXXXXXXXXXXXMDQDLKTRLT-----KLSSFQFQILKHAMSFPNAKK-- 387
                                  DQ +K   T     ++   Q Q+L  A+   +     
Sbjct: 440 -----------------------DQSVKVSRTEKDFIQIPHLQKQLLLSAIDSVDCNSKH 476

Query: 388 ---LVYSTCSIHAEENERVV 404
              +VYSTCS+  EE+E VV
Sbjct: 477 GGIIVYSTCSVAVEEDEAVV 496

>Skud_14.271 Chr14 (500809..502668) [1860 bp, 619 aa] {ON} YNL061W
           (REAL)
          Length = 619

 Score = 62.8 bits (151), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 84/200 (42%), Gaps = 42/200 (21%)

Query: 215 YKRGKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHA 274
           Y  G  I+Q  +S  P   L+P   + I+D  +APG KTT+++A M +   V       A
Sbjct: 323 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTGCV------FA 376

Query: 275 FEKDPERAKTLQKMIQVAGCDKSIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGR 334
            + +  R K+L   I   GC  +I   V ++     P         ++D  CSG+G+ G+
Sbjct: 377 NDANKSRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGK 433

Query: 335 KIIDDTNNKNXXXXXXXXXXXXMDQDLKTRLT-----KLSSFQFQILKHAMSFPNAKK-- 387
                                  DQ +K   T     ++   Q Q+L  A+   +     
Sbjct: 434 -----------------------DQSVKVSRTEKDFIQIPHLQKQLLLSAIDSVDCNSKH 470

Query: 388 ---LVYSTCSIHAEENERVV 404
              +VYSTCS+  EE+E VV
Sbjct: 471 GGVIVYSTCSVAVEEDEAVV 490

>YNL061W Chr14 (510540..512396) [1857 bp, 618 aa] {ON}  NOP2Probable
           RNA m(5)C methyltransferase, essential for processing
           and maturation of 27S pre-rRNA and large ribosomal
           subunit biogenesis; localized to the nucleolus;
           constituent of 66S pre-ribosomal particles
          Length = 618

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 86/205 (41%), Gaps = 43/205 (20%)

Query: 215 YKRGKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHA 274
           Y  G  I+Q  +S  P   L+P   + I+D  +APG KTT+++A M +   V       A
Sbjct: 322 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTGCV------FA 375

Query: 275 FEKDPERAKTLQKMIQVAGCDKSIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGR 334
            + +  R K+L   I   GC  +I   V ++     P         ++D  CSG+G+ G+
Sbjct: 376 NDANKSRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGK 432

Query: 335 KIIDDTNNKNXXXXXXXXXXXXMDQDLKTRLT-----KLSSFQFQILKHAMSFPNAKK-- 387
                                  DQ +K   T     ++   Q Q+L  A+   +     
Sbjct: 433 -----------------------DQSVKVSRTEKDFIQIPHLQKQLLLSAIDSVDCNSKH 469

Query: 388 ---LVYSTCSIHAEENERVVIDLLL 409
              +VYSTCS+  EE+E  VID  L
Sbjct: 470 GGVIVYSTCSVAVEEDE-AVIDYAL 493

>Smik_14.266 Chr14 (490908..492764) [1857 bp, 618 aa] {ON} YNL061W
           (REAL)
          Length = 618

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/224 (26%), Positives = 94/224 (41%), Gaps = 47/224 (20%)

Query: 215 YKRGKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHA 274
           Y  G  I+Q  +S  P   L+P   + I+D  +APG KTT+++A M +   V       A
Sbjct: 322 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTGCV------FA 375

Query: 275 FEKDPERAKTLQKMIQVAGCDKSIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGR 334
            + +  R K+L   I   GC  +I   V ++     P         ++D  CSG+G+ G+
Sbjct: 376 NDANKSRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGK 432

Query: 335 KIIDDTNNKNXXXXXXXXXXXXMDQDLKTRLT-----KLSSFQFQILKHAMSFPNAKK-- 387
                                  DQ +K   T     ++   Q Q+L  A+   +     
Sbjct: 433 -----------------------DQSVKVSRTEKDFIQIPHLQKQLLLSAIDSVDCNSKH 469

Query: 388 ---LVYSTCSIHAEENERVVIDLLL----DDKVQQWGWRVRKRA 424
              +VYSTCS+  EE+E  VID  L    + K+ + G  + K A
Sbjct: 470 GGVIVYSTCSVAVEEDE-AVIDYALRKRPNVKLVETGLAIGKEA 512

>TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171
           YBL024W
          Length = 649

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 77/292 (26%), Positives = 117/292 (40%), Gaps = 57/292 (19%)

Query: 218 GKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEK 277
           G I  Q+  S  P  +L+  P   ++D C+APG+KT  +   +      P    I A + 
Sbjct: 140 GNISRQEAVSMLPPILLDVKPHHTVLDMCAAPGSKTAQLMESLHIDSDEPSGFVI-ANDA 198

Query: 278 DPERAKTL-QKMIQVAGCDKSIEVHVGDF-------TKLAKPDKFSQVTGFIVDPSCSGS 329
           D +R+  L  ++ +++  +  I  H   F       TK A   +  +    + D  CSG 
Sbjct: 199 DNKRSHLLVHQLKRLSTSNVLIVNHDAQFFPNLKINTKDASSQEDLKFDRILCDVPCSGD 258

Query: 330 GIFGRKIIDDTNNKNXXXXXXXXXXXXMDQDLKTRLTKLSSFQFQILKHAMS-FPNAKKL 388
           G   RK ++   N N                       L + QF IL   ++      KL
Sbjct: 259 GTM-RKNVNVWKNWNTQNALG-----------------LHNVQFNILDRGLTLLKETGKL 300

Query: 389 VYSTCSIHAEENERVVIDLLLDDKVQQWGWRVR------KRAGVI-----PTWS--RRGF 435
           VYSTCS++  ENE VV  +L     ++WG +VR      K  G+I      TW    R  
Sbjct: 301 VYSTCSLNPIENEAVVAAVL-----RKWGDKVRLVCCDDKLKGLIRSKGLTTWPVINRDM 355

Query: 436 VEEFQQVYQDK-------QQAQELA----DGCIRALPKEDGGIGFFAVCFER 476
            E  +    DK          +E++    D C+R  P +    GFF   FE+
Sbjct: 356 EEVPRNRSDDKINKSCYPPTEEEVSKFNLDRCMRVYPHQQNTGGFFITMFEK 407

>Suva_14.280 Chr14 (509488..511350) [1863 bp, 620 aa] {ON} YNL061W
           (REAL)
          Length = 620

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 84/200 (42%), Gaps = 42/200 (21%)

Query: 215 YKRGKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHA 274
           Y  G  I+Q  +S  P   L+P   + I+D  +APG KTT+++A M +   V       A
Sbjct: 324 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTGCV------FA 377

Query: 275 FEKDPERAKTLQKMIQVAGCDKSIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGR 334
            + +  R K+L   I   GC  +I   V ++     P         ++D  CSG+G+ G+
Sbjct: 378 NDANKSRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGK 434

Query: 335 KIIDDTNNKNXXXXXXXXXXXXMDQDLKTRLT-----KLSSFQFQILKHAMSFPNAKK-- 387
                                  DQ +K   T     ++   Q Q+L  A+   +     
Sbjct: 435 -----------------------DQSVKVSRTEKDFIQIPHLQKQLLLSAIDSVDCNSKH 471

Query: 388 ---LVYSTCSIHAEENERVV 404
              +VYSTCS+  EE+E VV
Sbjct: 472 GGVIVYSTCSVAVEEDEAVV 491

>Ecym_3284 Chr3 (537227..539047) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii ADL254W
          Length = 606

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 84/200 (42%), Gaps = 42/200 (21%)

Query: 215 YKRGKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHA 274
           Y  G  I+Q  +S  P   L+P   + I+D  +APG KTT+++A M +   V       A
Sbjct: 311 YLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISALMKNTGCV------FA 364

Query: 275 FEKDPERAKTLQKMIQVAGCDKSIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGR 334
            + +  R K+L   I   GC  +I   V ++     P         ++D  CSG+G+  +
Sbjct: 365 NDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIAK 421

Query: 335 KIIDDTNNKNXXXXXXXXXXXXMDQDLKTRLT-----KLSSFQFQILKHAMSFPNAKK-- 387
                                  DQ +K   T     ++   Q Q++  A+   ++    
Sbjct: 422 -----------------------DQSVKVSRTEKDFMQIPHLQKQLILSAIDSVDSNSKT 458

Query: 388 ---LVYSTCSIHAEENERVV 404
              +VYSTCS+  EENE VV
Sbjct: 459 GGIIVYSTCSVAVEENEAVV 478

>TDEL0C04150 Chr3 complement(734914..736758) [1845 bp, 614 aa] {ON}
           Anc_2.247 YNL061W
          Length = 614

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 85/200 (42%), Gaps = 42/200 (21%)

Query: 215 YKRGKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHA 274
           Y  G  I+Q  +S  P   L+P   + I+D  +APG KTT+++A M +   V       A
Sbjct: 319 YLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISALMKNTGCV------FA 372

Query: 275 FEKDPERAKTLQKMIQVAGCDKSIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGR 334
            + +  R K+L   I   GC  +I   V ++     P         ++D  C+G+G+ G+
Sbjct: 373 NDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCTGTGVIGK 429

Query: 335 KIIDDTNNKNXXXXXXXXXXXXMDQDLKTRLT-----KLSSFQFQILKHAMSFPNAKK-- 387
                                  DQ +K   T     ++   Q Q+L  A+   ++    
Sbjct: 430 -----------------------DQSVKVSRTEKDFIQVPHLQKQLLLSAIDSVDSNSKT 466

Query: 388 ---LVYSTCSIHAEENERVV 404
              +VYSTCS+  EE+E VV
Sbjct: 467 GGIIVYSTCSVAVEEDEMVV 486

>Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON}
           (272892..274904) [2013 nt, 671 aa]
          Length = 670

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 76/293 (25%), Positives = 115/293 (39%), Gaps = 61/293 (20%)

Query: 218 GKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHV--AAHMFDPE---FV----PK 268
           G I  Q+  S  P  +L   P   ++D C+APG+KT  +  A HM D E   FV      
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHMEDDEPSGFVVANDAD 204

Query: 269 QKQIHAFEKDPERAKTLQKMI--QVAGCDKSIEVHVGDFTKLAKPDKFSQVTGFIVDPSC 326
            K+ H      +R  +   M+    A     I++H  D T+     +F +V   + D  C
Sbjct: 205 AKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLH-EDATQKKDVLRFDRV---LCDVPC 260

Query: 327 SGSGIFGRKIIDDTNNKNXXXXXXXXXXXXMDQDLKTRLTKLSSFQFQILKHAMSFPNAK 386
           SG G   + +                     D + ++ L  L + Q  IL   +     K
Sbjct: 261 SGDGTMRKNV-----------------NVWRDWNTQSGLG-LHTVQLNILNRGLHLLKPK 302

Query: 387 -KLVYSTCSIHAEENERVVIDLLLDDKVQQWGWRVRK-----------RAGVIPTW---- 430
            +LVYSTCS++  ENE VV   L     ++WG ++R            R+  I TW    
Sbjct: 303 GRLVYSTCSMNPIENEAVVAAAL-----RKWGDKIRLVNCDDKLPGLVRSKGISTWPVVD 357

Query: 431 -----SRRGFVEEFQQVYQDKQQAQELAD--GCIRALPKEDGGIGFFAVCFER 476
                 ++G     +  +    +  E  D   CIR  P +    GFF   FE+
Sbjct: 358 RNMEEKKKGDENTVESWFAPTPEEAEKFDLSSCIRVYPHQQNTGGFFITVFEK 410

>NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.171
           YBL024W
          Length = 686

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 69/286 (24%), Positives = 112/286 (39%), Gaps = 47/286 (16%)

Query: 218 GKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEK 277
           G I  Q+  S  P  +L   P   ++D C+APG+KT  +   +      P    + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQLIEALHKDTDEPTGFVV-ANDA 203

Query: 278 DPERAKTL-QKMIQVAGCDKSIEVHVGDF-------TKLAKPDKFSQVTGFIVDPSCSGS 329
           D +R+  L  ++ ++   +  +  H   F       T   K  +  +    + D  CSG 
Sbjct: 204 DAKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLHTDAEKKKEMLKFDRILCDVPCSGD 263

Query: 330 GIFGRKIIDDTNNKNXXXXXXXXXXXXMDQDLKTRLTKLSSFQFQILKHAMSF-PNAKKL 388
           G   RK ++   + N                       L + Q  IL   ++   +  +L
Sbjct: 264 GTM-RKNVNVWKDWNTQGGLG-----------------LHTVQLNILNRGLNLLKSGGRL 305

Query: 389 VYSTCSIHAEENERVVIDLL-----------LDDK----VQQWG---WRVRKRAGVIPTW 430
           VYSTCS++  ENE VV + L            DDK    V+  G   W V  R   +   
Sbjct: 306 VYSTCSMNPIENEAVVAEALRKWGSKIKLVNCDDKLVGLVRSKGISNWPVLDRNMAVKNK 365

Query: 431 SRRGFVEEFQQVYQDKQQAQELADGCIRALPKEDGGIGFFAVCFER 476
              G +E +    +++++   L D CIR  P +    GFF   FE+
Sbjct: 366 GDEGTIESWFPPTEEEREIFHL-DSCIRVYPHQQNTGGFFITVFEK 410

>AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL024W
           (NCL1)
          Length = 700

 Score = 59.7 bits (143), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 74/289 (25%), Positives = 113/289 (39%), Gaps = 56/289 (19%)

Query: 218 GKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHV--AAHMFDPEFVPKQKQIHAF 275
           G I  Q+  S  P ++L   P   ++D C+APG+KT  +  A H   PE       + A 
Sbjct: 146 GNISRQEAVSMIPPNVLGVEPHHSVLDMCAAPGSKTAQLVEALHANGPE---PSGFVVAN 202

Query: 276 EKDPERAKTLQKMIQVAGCDKSIEV-HVGDF---TKLAKPDK-FSQVTGFIVDPSCSGSG 330
           + D  R+  L   ++       I V H   F    K A+  K F +    + D  CSG G
Sbjct: 203 DADYRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTAEGSKDFLKFDRVLCDVPCSGDG 262

Query: 331 IFGRKIIDDTNNKNXXXXXXXXXXXXMDQDLKTRLTKLSSFQFQILKHAMSF-PNAKKLV 389
              + I                     D    + L  L + Q  IL   ++   N  +LV
Sbjct: 263 TMRKNI-----------------NVWKDWGTGSGLG-LHTVQLNILNRGLTLLKNGGRLV 304

Query: 390 YSTCSIHAEENERVVIDLLLDDKVQQWGWRVR-----------KRAGVIPTWSRRGFVEE 438
           YSTCS++  ENE VV   L     ++WG +++            R+  I +W       E
Sbjct: 305 YSTCSLNPIENEAVVAAAL-----RKWGAKIKLVNCDDQLLGLVRSTGISSWPVLDKNYE 359

Query: 439 FQQVYQD----------KQQAQEL-ADGCIRALPKEDGGIGFFAVCFER 476
            +    D          +++A+E   + CIR  P +    GFF   FE+
Sbjct: 360 EKNKGDDGTIATWFPPSEEEAKEFNLENCIRVYPHQQNTGGFFISVFEK 408

>KNAG0D02050 Chr4 (339873..341921) [2049 bp, 682 aa] {ON} Anc_8.171
           YBL024W
          Length = 682

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 75/292 (25%), Positives = 111/292 (38%), Gaps = 59/292 (20%)

Query: 218 GKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEK 277
           G I  Q+  S  P  +L   P+  ++D C+APG+KT  +   +      P    + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLLEALHRDTDEPTGFVV-ANDA 203

Query: 278 DPERAKTLQKMIQVAGCDKSIEV-HVGDFTKLAKPDKFSQVTG-------FIVDPSCSGS 329
           D  R+  L   ++       I V H   F    K  K S+           + D  CSG 
Sbjct: 204 DNRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTSKNSEKKSDLLKFDRILCDVPCSGD 263

Query: 330 GIFGR--KIIDDTNNKNXXXXXXXXXXXXMDQDLKTRLTKLSSFQFQILKHAMS-FPNAK 386
           G   +   +  D N +N                       L   Q  IL   +       
Sbjct: 264 GTMRKNVNVWRDWNTQNALG--------------------LHQVQANILNRGLHLLKKGG 303

Query: 387 KLVYSTCSIHAEENERVVIDLLLDDKVQQWGWRVR------KRAGVI--------PTWSR 432
           +LVYSTCS++  ENE VV   L     ++WG +VR      K  G++        PT +R
Sbjct: 304 RLVYSTCSMNPIENEAVVAQAL-----RKWGDKVRLVNCDDKLPGLVRNKGISKWPTLNR 358

Query: 433 R-GFVEEFQQVYQDK--QQAQELA-----DGCIRALPKEDGGIGFFAVCFER 476
               +E+ Q+   D   Q  +E A     + CIR  P +    GFF   FE+
Sbjct: 359 NMEEMEKGQEGANDSWFQPTEEEAEKFQLENCIRVYPHQQNTGGFFITVFEK 410

>SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 691

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 67/288 (23%), Positives = 115/288 (39%), Gaps = 54/288 (18%)

Query: 218 GKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEK 277
           G I  Q+  S  P  +L   P   ++D C+APG+KT  +   +   E  P    + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPNHTVLDMCAAPGSKTAQLIEALHAQEDEPTGFVV-ANDA 203

Query: 278 DPERAKTL-QKMIQVAGCDKSIEVHVGDFTKLAK--PD--KFSQVTGFIVDPSCSGSGIF 332
           D +R+  L  ++ ++   +  +  H   F    K  PD  +F +    + D  CSG G  
Sbjct: 204 DAKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKSQPDSKEFLKFDRVLCDVPCSGDGTM 263

Query: 333 GRKIIDDTNNKNXXXXXXXXXXXXMDQDLKTRLTKLSSFQFQILKHAMSF-PNAKKLVYS 391
            + +                     D    + L  L + Q  IL   ++   +  +LVYS
Sbjct: 264 RKNV-----------------NVWRDWGTASGLG-LHTVQLNILNRGLNLLKDGGRLVYS 305

Query: 392 TCSIHAEENERVVIDLLLDDKVQQWGWRVR------KRAGVI--------PTWSR----- 432
           TCS++  ENE V+   L     ++WG ++R      K  G++        P + +     
Sbjct: 306 TCSLNPIENESVIAAAL-----RKWGDKIRLVNCDEKLPGLVRSKGITQWPVYDKNFALK 360

Query: 433 ----RGFVEEFQQVYQDKQQAQELADGCIRALPKEDGGIGFFAVCFER 476
                G +E +    +++     L + CIR  P +    GFF   FE+
Sbjct: 361 EKGDEGVIETWFPPTEEEATRFHL-ENCIRVYPHQQNTGGFFITVFEK 407

>ZYRO0G08998g Chr7 complement(726070..728121) [2052 bp, 683 aa] {ON}
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 683

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 67/293 (22%), Positives = 113/293 (38%), Gaps = 61/293 (20%)

Query: 218 GKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEK 277
           G I  Q+  S  P  +L+  P   ++D C+APG+KT  +  ++      P    + A + 
Sbjct: 142 GNISRQEAVSMIPPTLLDVQPHHTVLDMCAAPGSKTAQMIEYLHRDNDEPSGFVV-ANDA 200

Query: 278 DPERAKTLQKMIQVAGCDKSIEV-HVGDFTKLAK--PD--------KFSQVTGFIVDPSC 326
           D +R+  L   ++       I V H   F    K  PD        +F +V   + D  C
Sbjct: 201 DAKRSHMLVHQLKRLNSANLIVVNHDAQFFPRVKAHPDHTNKKDILRFDRV---LCDVPC 257

Query: 327 SGSGIFGRKIIDDTNNKNXXXXXXXXXXXXMDQDLKTRLTKLSSFQFQILKHAMSF-PNA 385
           SG G   + +                     D   +  L  L + Q  IL   +    + 
Sbjct: 258 SGDGTMRKNV-----------------NVWRDWTTQNGLA-LHNVQLNILNRGLHLLKSG 299

Query: 386 KKLVYSTCSIHAEENERVVIDLLLDDKVQQWGWRVR--KRAGVIPTWSRRGFVEEFQQVY 443
            +LVYSTCS++  ENE VV + L     ++WG +VR    +  +P   R   + ++  + 
Sbjct: 300 GRLVYSTCSMNPIENEAVVAEAL-----RKWGGKVRLVDCSDKLPGLVRSNGINQWPVLN 354

Query: 444 QDKQQAQELADG--------------------CIRALPKEDGGIGFFAVCFER 476
           ++ +  ++  DG                    C+R  P +    GFF    E+
Sbjct: 355 RNMETKEKGEDGTNDSWFPPTDEEAARFHLDYCVRVYPHQQNTGGFFITVLEK 407

>NCAS0B04390 Chr2 complement(795633..797648) [2016 bp, 671 aa] {ON}
           Anc_8.171 YBL024W
          Length = 671

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 71/292 (24%), Positives = 115/292 (39%), Gaps = 59/292 (20%)

Query: 218 GKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEK 277
           G I  Q+  S  P  +L   P+  ++D C+APG+KT  +   +      P    + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLIEALHKDTDEPTGFVV-ANDA 203

Query: 278 DPERAKTL-QKMIQVAGCDKSIEVHVGDFTKLAK----PDKFSQVTGF---IVDPSCSGS 329
           D  R+  L  ++ ++   +  +  H   F    K     +K   +  F   + D  CSG 
Sbjct: 204 DARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLHDDAEKKRDMLKFDRILCDVPCSGD 263

Query: 330 GIFGRKIIDDTNNKNXXXXXXXXXXXXMDQDLKTRLTKLSSFQFQILKHAMSF--PNAKK 387
           G   RK ++   + N                       L + Q+ IL   +    PN + 
Sbjct: 264 GTM-RKNVNVWKDWNAQGALG-----------------LHTVQWNILNRGLHLLKPNGR- 304

Query: 388 LVYSTCSIHAEENERVVIDLLLDDKVQQWGWRVR------KRAGVI--------PTWSR- 432
           LVYSTCS++  ENE VV   L     ++WG ++R      K  G++        P  +R 
Sbjct: 305 LVYSTCSLNPIENEAVVAQAL-----RKWGNKIRLVNCDEKLPGLVRSKGISQWPVLNRD 359

Query: 433 --------RGFVEEFQQVYQDKQQAQELADGCIRALPKEDGGIGFFAVCFER 476
                    G +E +    +++     L D CIR  P +    GFF   FE+
Sbjct: 360 LETKNKNDEGVLESWFPPSEEEASLFNL-DACIRVYPHQQNTGGFFITVFEK 410

>Smik_2.92 Chr2 (166201..168225) [2025 bp, 674 aa] {ON} YBL024W
           (REAL)
          Length = 674

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 66/292 (22%), Positives = 112/292 (38%), Gaps = 59/292 (20%)

Query: 218 GKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEK 277
           G I  Q+  S  P  +L   P   ++D C+APG+KT  +   +      P    + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGFVV-ANDA 203

Query: 278 DPERAKTL-QKMIQVAGCDKSIEVHVGDF-------TKLAKPDKFSQVTGFIVDPSCSGS 329
           D  R+  L  ++ ++   +  +  H   F          +  +   +    + D  CSG 
Sbjct: 204 DARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHGNSSNKNDVLKFDRILCDVPCSGD 263

Query: 330 GIFGRKIIDDTNNKNXXXXXXXXXXXXMDQDLKTRL-TKLSSFQFQILKHAMSF-PNAKK 387
           G   + +                    + +D  T+    L + Q  IL   +    N  +
Sbjct: 264 GTMRKNV-------------------NVWKDWNTQAGLGLHTVQLNILNRGLHLLKNNGR 304

Query: 388 LVYSTCSIHAEENERVVIDLLLDDKVQQWGWRVR------KRAGVI--------PTWSR- 432
           LVYSTCS++  ENE VV + L     ++WG ++R      K  G+I        P + R 
Sbjct: 305 LVYSTCSLNPIENEAVVAEAL-----RKWGDKIRLVNCDDKLPGLIRSKGVSKWPVYDRN 359

Query: 433 --------RGFVEEFQQVYQDKQQAQELADGCIRALPKEDGGIGFFAVCFER 476
                    G +E F    +++     L + C+R  P +    GFF   FE+
Sbjct: 360 LTEKTKGDEGTLESFFSPSEEEASRFNLQN-CMRVYPHQQNTGGFFITVFEK 410

>Suva_2.97 Chr2 (172667..174679) [2013 bp, 670 aa] {ON} YBL024W
           (REAL)
          Length = 670

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 66/292 (22%), Positives = 116/292 (39%), Gaps = 59/292 (20%)

Query: 218 GKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEK 277
           G I  Q+  S  P  +L   P   ++D C+APG+KT  +   +      P    + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGFVV-ANDA 203

Query: 278 DPERAKTL-QKMIQVAGCDKSIEVHVGDFTKLAK----PDKFSQVTGF---IVDPSCSGS 329
           D  R+  L  ++ ++   +  +  H   F    +     +K + V  F   + D  CSG 
Sbjct: 204 DARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHENSNKKNDVLKFDRILCDVPCSGD 263

Query: 330 GIFGRKIIDDTNNKNXXXXXXXXXXXXMDQDLKTRL-TKLSSFQFQILKHAMSF-PNAKK 387
           G   + +                    + +D  T+    L + Q  IL   +    +  +
Sbjct: 264 GTMRKNV-------------------NVWKDWNTQAGLGLHTVQLNILNRGLHLLKDGGR 304

Query: 388 LVYSTCSIHAEENERVVIDLLLDDKVQQWGWRVR------KRAGVI--------PTWSR- 432
           LVYSTCS++  ENE V+ + L     ++WG ++R      K +G++        P + R 
Sbjct: 305 LVYSTCSLNPIENEAVIAEAL-----RKWGDKIRLVNCDDKLSGLVRSKGVSKWPVYDRN 359

Query: 433 --------RGFVEEFQQVYQDKQQAQELADGCIRALPKEDGGIGFFAVCFER 476
                    G +E F    +++     L + C+R  P +    GFF   FE+
Sbjct: 360 LTEKTKGDEGTLESFFAPSEEEASKFNLQN-CMRVYPHQQNTGGFFITVFEK 410

>TBLA0A08740 Chr1 (2141750..2143810) [2061 bp, 686 aa] {ON}
           Anc_8.171 YBL024W
          Length = 686

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 73/295 (24%), Positives = 116/295 (39%), Gaps = 65/295 (22%)

Query: 218 GKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHV--AAHMFDPE---FV----PK 268
           G I  Q+  S  P  +L   P   ++D C+APG+KT  +  A HM + E   FV      
Sbjct: 145 GNISRQEAVSMIPPLVLEVKPHHTVLDMCAAPGSKTAQMIEALHMENAEPTGFVVANDSD 204

Query: 269 QKQIHAFEKDPERAKTLQKMI--QVAGCDKSIEVHVGDFTKLAKPDKFSQVTGFIVDPSC 326
            ++ H      +R  +   M+    A     I++ VGD  K     KF ++   + D  C
Sbjct: 205 YRRSHMLVHQLKRLNSANMMVVNHDAQFFPRIKLSVGD-NKAKDALKFDRI---LCDVPC 260

Query: 327 SGSGIFGRKIIDDTNNKNXXXXXXXXXXXXMDQDLKTRL-TKLSSFQFQILKHAMS-FPN 384
           SG G   + +                    + +D  T+    L + Q+ IL   +     
Sbjct: 261 SGDGTMRKNV-------------------NVWKDWNTQAGLGLHTIQYNILNRGLHLLKT 301

Query: 385 AKKLVYSTCSIHAEENERVVIDLLLDDKVQQWGWRVR------KRAGVI--------PTW 430
             +LVYSTCS++  ENE VV   L     + WG +++      K  G+I        P +
Sbjct: 302 GGRLVYSTCSLNPIENEAVVARAL-----RTWGSKIKIINCDDKLPGLIRSNGVTQWPVF 356

Query: 431 SR---------RGFVEEFQQVYQDKQQAQELADGCIRALPKEDGGIGFFAVCFER 476
            R          G +E +     ++  A  L + C+R  P +    GFF    E+
Sbjct: 357 DRNMESKNKGDEGTLESWFPPTDEEVTAFNLQN-CMRVYPHQQNTGGFFITVIEK 410

>KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} similar
           to uniprot|P38205 Saccharomyces cerevisiae YBL024W
          Length = 688

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 68/287 (23%), Positives = 112/287 (39%), Gaps = 52/287 (18%)

Query: 218 GKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEK 277
           G I  Q+  S  P  +L       ++D C+APG+KT  +   +   E  P    + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVESHHSVLDMCAAPGSKTAQMIEALHSSEDEPTGFVV-ANDA 203

Query: 278 DPERAKTL-QKMIQVAGCDKSIEVHVGDFTKLAKPDK----FSQVTGFIVDPSCSGSGIF 332
           D  R+  L  ++ ++   +  +  H   F    K DK    F +    + D  CSG G  
Sbjct: 204 DARRSHMLVHQLKRLNSANLVVVNHDAQFFPRVKTDKETNQFLKFDRILCDVPCSGDGTM 263

Query: 333 GRKIIDDTNNKNXXXXXXXXXXXXMDQDLKTRLTKLSSFQFQILKHAMSF-PNAKKLVYS 391
            + +                     D    + L  L + Q  ILK  ++      +LVYS
Sbjct: 264 RKNV-----------------NVWKDWGTASGLG-LHTVQLNILKRGLNLLKKGGRLVYS 305

Query: 392 TCSIHAEENERVVIDLLLDDKVQQWGWRVR--KRAGVIPTWSRRGFVEEF---QQVYQDK 446
           TCS++  ENE VV   L     +QWG +++    +  +P   R   +  +    + ++ K
Sbjct: 306 TCSMNPIENEAVVAAAL-----RQWGDKIKLVDCSDKLPGLVRSKGISNWPVIDKAFEKK 360

Query: 447 QQ-------------AQELA----DGCIRALPKEDGGIGFFAVCFER 476
           ++             A+E A    D CIR  P +    GFF    E+
Sbjct: 361 EKGDEGTTESWFPPSAEEAADFHLDRCIRVYPHQQNTGGFFITVIEK 407

>Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}
           similar to Ashbya gossypii AFR179C
          Length = 690

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 69/289 (23%), Positives = 111/289 (38%), Gaps = 56/289 (19%)

Query: 218 GKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHV--AAHMFDPEFVPKQKQIHAF 275
           G I  Q+  S  P  +L   P+  ++D C+APG+KT  +  A H   PE       + A 
Sbjct: 145 GNISRQEAVSMIPPLLLEVEPQHTVLDMCAAPGSKTAQLIEALHAKGPE---PSGFVVAN 201

Query: 276 EKDPERAKTLQKMIQVAGCDKSIEV-HVGDFTKLAKPDK----FSQVTGFIVDPSCSGSG 330
           + D  R+  L   ++       I V H   F    K  +    F +    + D  CSG G
Sbjct: 202 DADYRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTSEGSKDFLRFDRVLCDVPCSGDG 261

Query: 331 IFGRKIIDDTNNKNXXXXXXXXXXXXMDQDLKTRLTKLSSFQFQILKHAMSF-PNAKKLV 389
              + I                     D    + L  L + Q  IL   ++   +  +LV
Sbjct: 262 TMRKNI-----------------NVWKDWATASGLG-LHTVQVNILNRGLNLLKDGGRLV 303

Query: 390 YSTCSIHAEENERVVIDLLLDDKVQQWGWRVR--KRAGVIPTWSRRGFVEE---FQQVYQ 444
           YSTCS++  ENE VV   L     ++WG +++  +    +P   R   + +   + + + 
Sbjct: 304 YSTCSLNPIENEAVVAAAL-----RKWGDKIKLVECGDKLPGLIRSQGISQWPVYDKGFN 358

Query: 445 DKQQAQELADG-----------------CIRALPKEDGGIGFFAVCFER 476
            KQ++ E  D                  C+R  P +    GFF   FE+
Sbjct: 359 AKQRSDEGVDASWFPPTDEEISKFHLESCVRVYPHQQNTGGFFIAVFEK 407

>NDAI0B02980 Chr2 complement(757926..759965) [2040 bp, 679 aa] {ON} 
          Length = 679

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 67/296 (22%), Positives = 109/296 (36%), Gaps = 66/296 (22%)

Query: 218 GKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHV--AAHMFDPEFVPKQKQIHAF 275
           G I  Q+  S  P  +L+  P   ++D C+APG+KT  +  A HM  PE       + A 
Sbjct: 139 GNISRQEAVSMIPPIVLDVKPHHTVLDMCAAPGSKTAQLIEALHMDGPE---PSGFVVAN 195

Query: 276 EKDPERAKTL-QKMIQVAGCDKSIEVHVGDFTKLAKPD--------KFSQVTGFIVDPSC 326
           + D +R+  L  ++ ++   +  +  H   F    + D        ++ +    + D  C
Sbjct: 196 DSDSKRSHMLVHQLKRLNSANLMVVNHDAQFFPKIQLDSNKGRHNKEYLKFDRILCDVPC 255

Query: 327 SGSGIFGRK--IIDDTNNKNXXXXXXXXXXXXMDQDLKTRLTKLSSFQFQILKHAMSF-P 383
           SG G   +   I  D N +N                       L + Q  IL   +    
Sbjct: 256 SGDGTIRKNVNIWKDWNTQNSL--------------------GLHNVQLNILNRGIQLLK 295

Query: 384 NAKKLVYSTCSIHAEENERVVIDLLLDDKVQQWG-----------------------WRV 420
           +  +LVYSTCS+   ENE V+   L     ++WG                       W V
Sbjct: 296 SGGRLVYSTCSLSPIENEAVISATL-----RKWGNKIKLVDCKEMLPGLISSPGISKWEV 350

Query: 421 RKRAGVIPTWSRRGFVEEFQQVYQDKQQAQELADGCIRALPKEDGGIGFFAVCFER 476
             R   I +       + + Q  +++     L+  CIR  P +    GFF    E+
Sbjct: 351 YDRTMSIVSKGAEKSKDTWFQPTEEEANDFNLSH-CIRVFPHQQNTGGFFIAVLEK 405

>YBL024W Chr2 (172534..174588) [2055 bp, 684 aa] {ON}
           NCL1S-adenosyl-L-methionine-dependent tRNA:
           m5C-methyltransferase, methylates cytosine to m5C at
           several positions in tRNAs and intron-containing
           pre-tRNAs; increases proportion of tRNALeu(CAA) with m5C
           at wobble position in response to hydrogen peroxide,
           causing selective translation of mRNA from genes
           enriched in TTG codon; loss of NCL1 confers
           hypersensitivity to oxidative stress; similar to Nop2p
           and human proliferation associated nucleolar protein
           p120
          Length = 684

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 68/292 (23%), Positives = 115/292 (39%), Gaps = 59/292 (20%)

Query: 218 GKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEK 277
           G I  Q+  S  P  +L   P   ++D C+APG+KT  +   +      P    + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGFVV-ANDA 203

Query: 278 DPERAKTL-QKMIQVAGCDKSIEVHVGDF---TKL-AKPDKFSQVTGF---IVDPSCSGS 329
           D  R+  L  ++ ++   +  +  H   F    +L    +  + V  F   + D  CSG 
Sbjct: 204 DARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHGNSNNKNDVLKFDRILCDVPCSGD 263

Query: 330 GIFGRKIIDDTNNKNXXXXXXXXXXXXMDQDLKTRL-TKLSSFQFQILKHAMSF-PNAKK 387
           G   + +                    + +D  T+    L + Q  IL   +    N  +
Sbjct: 264 GTMRKNV-------------------NVWKDWNTQAGLGLHAVQLNILNRGLHLLKNNGR 304

Query: 388 LVYSTCSIHAEENERVVIDLLLDDKVQQWGWRVR------KRAGVI--------PTWSR- 432
           LVYSTCS++  ENE VV + L     ++WG ++R      K  G+I        P + R 
Sbjct: 305 LVYSTCSLNPIENEAVVAEAL-----RKWGDKIRLVNCDDKLPGLIRSKGVSKWPVYDRN 359

Query: 433 --------RGFVEEFQQVYQDKQQAQELADGCIRALPKEDGGIGFFAVCFER 476
                    G ++ F    +++     L + C+R  P +    GFF   FE+
Sbjct: 360 LTEKTKGDEGTLDSFFSPSEEEASKFNLQN-CMRVYPHQQNTGGFFITVFEK 410

>TDEL0B04390 Chr2 (769749..771770) [2022 bp, 673 aa] {ON} Anc_8.171
           YBL024W
          Length = 673

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 73/293 (24%), Positives = 112/293 (38%), Gaps = 60/293 (20%)

Query: 218 GKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHV--AAHMFDPE---FV----PK 268
           G I  Q+  S  P  +L   P   ++D C+APG+KT  +  A H    E   FV      
Sbjct: 143 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQMIEALHKDTDEPTGFVVANDAD 202

Query: 269 QKQIHAFEKDPERAKTLQKMI--QVAGCDKSIEVHVGDFTKLAKPDKFSQVTGFIVDPSC 326
            K+ H      +R  +   M+    A     I+    D +  A   KF +V   + D  C
Sbjct: 203 SKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKSSAADDSSKANVLKFDRV---LCDVPC 259

Query: 327 SGSGIFGRKIIDDTNNKNXXXXXXXXXXXXMDQDLKTRLTKLSSFQFQILKHAMSF-PNA 385
           SG G         T  KN            +          L + QF IL   +    N 
Sbjct: 260 SGDG---------TMRKNVNVWRDWTPQGGLG---------LHTVQFNILNRGLHLLKNK 301

Query: 386 KKLVYSTCSIHAEENERVVIDLLLDDKVQQWGWRVRKRA--GVIPTWSRRGFVEEFQQVY 443
            +LVYSTCS++  ENE VV + L     ++WG ++R  +    +P   R   V ++  + 
Sbjct: 302 GRLVYSTCSMNPIENEAVVAEAL-----RKWGDKIRLVSCEDKLPGLVRSKGVSQWPVID 356

Query: 444 Q--------------------DKQQAQELADGCIRALPKEDGGIGFFAVCFER 476
           +                    +++ A+   + CIR  P +    GFF   FE+
Sbjct: 357 RNMTPREKGDEGTHDSWFPPTEEEAAKFNLENCIRVYPHQQNTGGFFITVFEK 409

>NCAS0B05640 Chr2 complement(1068983..1070962) [1980 bp, 659 aa]
           {ON} 
          Length = 659

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 67/297 (22%), Positives = 109/297 (36%), Gaps = 69/297 (23%)

Query: 218 GKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEK 277
           G I  Q+  S  P  +L   P   ++D C+APG+KT  +   +      P    + A + 
Sbjct: 139 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQLLEALHRDSNEPTGFVV-ANDS 197

Query: 278 DPERAKTLQKMIQVAGCDKSIEVH-----------VGDFTKLAKPDKFSQVTGFIVDPSC 326
           D  RA  L   ++       + V+             D T  +   K+ ++   + D  C
Sbjct: 198 DSRRAYMLVHQLKRLNSANLLVVNHDAQFFPKIKLRADATNKSGMLKYDRI---LCDVPC 254

Query: 327 SGSGIFGR--KIIDDTNNKNXXXXXXXXXXXXMDQDLKTRLTKLSSFQFQILKHAMS-FP 383
           SG G   +   +  D N +N                       L + Q  IL   +    
Sbjct: 255 SGDGTMRKNVNVWKDWNTQNALG--------------------LHNVQLNILNRGLQLLK 294

Query: 384 NAKKLVYSTCSIHAEENERVVIDLLLDDKVQQWGWRVRK-----------RAGVIPTWSR 432
           +  +LVYSTCS++  ENE VV   L     ++WG +++            R+  I  WS 
Sbjct: 295 DNGRLVYSTCSLNPIENEAVVAAAL-----RKWGNKIKLVDCQNKLQGLVRSNGISHWSV 349

Query: 433 RGFVEEFQQVYQDKQQAQ----ELADG---------CIRALPKEDGGIGFFAVCFER 476
             +  E   + +D +  +    E  D          C+R  P +    GFF   FE+
Sbjct: 350 --YDREMNAITKDSESTKSSWFEPTDAEKENFNLEHCMRVYPHQQNTGGFFIAVFEK 404

>Skud_2.81 Chr2 (156273..158318) [2046 bp, 681 aa] {ON} YBL024W
           (REAL)
          Length = 681

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 65/292 (22%), Positives = 112/292 (38%), Gaps = 59/292 (20%)

Query: 218 GKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEK 277
           G I  Q+  S  P  +L   P   ++D C+APG+KT  +   +      P    + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGFVV-ANDA 203

Query: 278 DPERAKTL-QKMIQVAGCDKSIEVHVGDF-------TKLAKPDKFSQVTGFIVDPSCSGS 329
           D  R+  L  ++ ++   +  +  H   F           K +   +    + D  CSG 
Sbjct: 204 DARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHGNSNKKNDILKFDRILCDVPCSGD 263

Query: 330 GIFGRKIIDDTNNKNXXXXXXXXXXXXMDQDLKTRL-TKLSSFQFQILKHAMSFPNAK-K 387
           G   + +                    + +D  T+    L + Q  IL   +    +  +
Sbjct: 264 GTMRKNV-------------------NVWKDWNTQAGLGLHTVQLNILNRGLHLLKSNGR 304

Query: 388 LVYSTCSIHAEENERVVIDLLLDDKVQQWGWRVR------KRAGVI--------PTWSR- 432
           LVYSTCS++  ENE V+ + L     ++WG ++R      K  G+I        P + R 
Sbjct: 305 LVYSTCSLNPIENEAVIAEAL-----RKWGDKIRLVNCDDKLTGLIRSKGVSKWPVYDRN 359

Query: 433 --------RGFVEEFQQVYQDKQQAQELADGCIRALPKEDGGIGFFAVCFER 476
                    G +E F    +++     L + C+R  P +    GFF   FE+
Sbjct: 360 LTEKNKGDEGTLESFFPPSEEEASKFNLKN-CMRVYPHQQNTGGFFISVFEK 410

>KAFR0B02220 Chr2 complement(438809..440869) [2061 bp, 686 aa] {ON}
           Anc_8.171 YBL024W
          Length = 686

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 68/293 (23%), Positives = 114/293 (38%), Gaps = 61/293 (20%)

Query: 218 GKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHV--AAHMFDPEFVPKQKQIHAF 275
           G I  Q+  S  P  +L   P+  ++D C+APG+KT  +  A HM   E       + A 
Sbjct: 146 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLIEALHMDTDE---PTGFVVAN 202

Query: 276 EKDPERAKTL-QKMIQVAGCDKSIEVHVGDFTKLAK----PDKFSQVTGF---IVDPSCS 327
           + D  R+  L  ++ ++   +  +  H   F    K     DK   +  F   + D  CS
Sbjct: 203 DADSRRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKISNDSDKKKDLLKFDRILCDVPCS 262

Query: 328 GSGIFGRKIIDDTNNKNXXXXXXXXXXXXMDQDLKTRLTKLSSFQFQILKHAMS-FPNAK 386
           G G   + +                     D + ++ L  L + Q+ IL   ++   +  
Sbjct: 263 GDGTMRKNV-----------------NVWKDWNTQSGLG-LHTVQYNILNRGLNLLKSGG 304

Query: 387 KLVYSTCSIHAEENERVVIDLLLDDKVQQWGWRVRK-----------RAGVIPTW----- 430
           +LVYSTCS++  ENE VV   L     + WG +++            R+  I  W     
Sbjct: 305 RLVYSTCSLNPIENEAVVAQAL-----RTWGDKIKLVNCGDKLPGLVRSQGISQWPVIDR 359

Query: 431 -------SRRGFVEEFQQVYQDKQQAQELADGCIRALPKEDGGIGFFAVCFER 476
                     G +E +    +++ +   L + CIR  P +    GFF    E+
Sbjct: 360 NMTEKNKGDEGTIESWFPPSEEEAKNFHL-ENCIRVYPHQQNTGGFFITVIEK 411

>KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 704

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 67/292 (22%), Positives = 113/292 (38%), Gaps = 58/292 (19%)

Query: 218 GKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEK 277
           G I  Q+  S  P  +L+  P   ++D C+APG+KT  +   +      P    I A + 
Sbjct: 145 GNISRQEAVSMIPPIVLDVKPHHYVLDMCAAPGSKTAQLIEALHAESDEPSGFVI-ANDA 203

Query: 278 DPERAKTL-QKMIQVAGCDKSIEVHVGDF--------TKLAKPDKFSQVTGFIVDPSCSG 328
           D +R+  L  ++ ++   +  +  H   F        T+ +K  +F +    + D  CSG
Sbjct: 204 DYKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKVDSTEGSKGPQFLKFDRVLCDVPCSG 263

Query: 329 SGIFGRKIIDDTNNKNXXXXXXXXXXXXMDQDLKTRLTKLSSFQFQILKHAMSF-PNAKK 387
            G   + +                     D +  + L  L   Q  IL+  ++      K
Sbjct: 264 DGTMRKNV-----------------NVWKDWNTGSGLG-LHIVQLNILERGLNLLKEGGK 305

Query: 388 LVYSTCSIHAEENERVVIDLLLDDKVQQWGWRVR--KRAGVIPTWSRRGFVEEFQQVYQD 445
           LVYSTCS++  ENE V+   L     ++WG +VR       +P   R   + E+ +VY  
Sbjct: 306 LVYSTCSLNPIENEAVIAAAL-----RRWGDKVRLVNCDDQLPGLVRSKGITEW-KVYDK 359

Query: 446 KQQAQELA---------------------DGCIRALPKEDGGIGFFAVCFER 476
           + Q +E                       + C+R    +    GFF   FE+
Sbjct: 360 QFQVREKGHENCLDSWFPPTAEEVEKFHLENCMRVYQHQQNTGGFFITVFEK 411

>CAGL0K01991g Chr11 (173969..175987) [2019 bp, 672 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024w NCL1 tRNA (cytosine-5-)-methyltransferase
          Length = 672

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 54/217 (24%), Positives = 89/217 (41%), Gaps = 41/217 (18%)

Query: 218 GKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEK 277
           G I  Q+  S  P  +L   P   ++D C+APG+KTT +   +      P    + A + 
Sbjct: 143 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTTQMIEALHKDTDEPTGFVV-ANDA 201

Query: 278 DPERAKTL-QKMIQVAGCDKSIEVHVGDF----------TKLAKPDKFSQVTGFIVDPSC 326
           D  R+  L  ++ ++   +  +  H   F          +K     KF ++   + D  C
Sbjct: 202 DSRRSHMLVHQLKRLNSANLMVVNHDAQFFPRIILSDEPSKKKAQLKFDRI---LCDVPC 258

Query: 327 SGSGIFGRKIIDDTNNKNXXXXXXXXXXXXMDQDLKTR-LTKLSSFQFQILKHAMSF-PN 384
           SG G   + +                    + +D  T+    L + Q  IL   +    N
Sbjct: 259 SGDGTMRKNV-------------------NVWKDWNTQGALGLHTVQLNILDRGLHLLQN 299

Query: 385 AKKLVYSTCSIHAEENERVVIDLLLDDKVQQWGWRVR 421
             +LVYSTCS++  ENE VV + L     ++WG +VR
Sbjct: 300 NGRLVYSTCSMNPIENEAVVAEAL-----RRWGDKVR 331

>KNAG0G01510 Chr7 complement(341469..343469) [2001 bp, 666 aa] {ON}
           Anc_8.171 YBL024W
          Length = 666

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 70/288 (24%), Positives = 106/288 (36%), Gaps = 51/288 (17%)

Query: 218 GKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEK 277
           G I  Q+  S  P  +L       ++D C+APG+KT  +   +      P    I A + 
Sbjct: 159 GNISRQEAVSMIPPLLLRLESNHNVLDMCAAPGSKTAQLIEQLHKDTDEPT-GIIVANDS 217

Query: 278 DPERAKTLQKMIQVAGCDKSIEV-HVGDFTKLAKPDKFS-----QVTGFIVDPSCSGSGI 331
           D  R+  L   ++       + V H   F    + +  +     +    + D  CSG G 
Sbjct: 218 DMRRSYLLVHQLKRLNSSNILVVNHDAQFFPNIRTNSLNNNITMKFDRILCDVPCSGDGT 277

Query: 332 FGRKIIDDTNNKNXXXXXXXXXXXXMDQDLKTRLTKLSSFQFQILKHAMSF-PNAKKLVY 390
             RK I+  N                D   +  L  L   Q  IL   +    N  +LVY
Sbjct: 278 L-RKNINIWN----------------DWRFQNAL-GLHRLQNNILNRGLQLLRNGGRLVY 319

Query: 391 STCSIHAEENERVVIDLL-----------LDDKVQQW-------GWRVRKRAGVIPTWSR 432
           STCS++  ENE V+ + L            DD++           W V  R G +     
Sbjct: 320 STCSMNPIENEAVIANALRNWAGEVSLVNFDDELPGLIRSRGISSWPVIDRNGEM---RE 376

Query: 433 RGFVEEFQQVY---QDKQQAQELADGCIRALPKEDGGIGFFAVCFERD 477
           RG  E     +    D+Q+   L + CIR  P +     FF   FE++
Sbjct: 377 RGDPETLDSWFPPTADEQKTFNL-EKCIRVYPHQQDTGAFFIAVFEKN 423

>TPHA0C02870 Chr3 (620913..622937) [2025 bp, 674 aa] {ON} Anc_8.171
           YBL024W
          Length = 674

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 63/290 (21%), Positives = 100/290 (34%), Gaps = 55/290 (18%)

Query: 218 GKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEK 277
           G I  Q+  S  P  +L       ++D C+APG+KT  +   +   E  P    + A + 
Sbjct: 144 GNISRQEAVSMIPPILLEVESNHTVLDMCAAPGSKTAQLIEALHTNEDEPTGIVV-ANDA 202

Query: 278 DPERAKTL--------QKMIQVAGCDKSIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGS 329
           D  R+  L           + V   D      +         + F +    + D  CSG 
Sbjct: 203 DARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIALHENTTDSNDFLKFDRILCDVPCSGD 262

Query: 330 GIFGRKIIDDTNNKNXXXXXXXXXXXXMDQDLKTRLTKLSSFQFQILKHAMSFPNAK-KL 388
           G         T  KN            +          L + Q  IL   +     K +L
Sbjct: 263 G---------TMRKNVNVWRDWTSQGGLG---------LHNIQLNILNRGLHLLKPKGRL 304

Query: 389 VYSTCSIHAEENERVVIDLLLDDKVQQWGWRVR-----------KRAGVIPTWSRRGFVE 437
           VYSTCS++  ENE V+   L     ++WG ++R            R+  I +W       
Sbjct: 305 VYSTCSMNPIENEAVIAAAL-----RKWGSKIRVINCDEKLPGLVRSKGIDSWPVFNRDM 359

Query: 438 EFQQ-----------VYQDKQQAQELADGCIRALPKEDGGIGFFAVCFER 476
           E +Q              +++++Q     CIR  P +     FF    E+
Sbjct: 360 EIRQKGDQGVSNTWFPPSEEEKSQFNLQNCIRVYPHQQNTGAFFITVIEK 409

>Ecym_3003 Chr3 complement(6934..7893) [960 bp, 319 aa] {ON} similar
           to Ashbya gossypii ACR026W
          Length = 319

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 9/74 (12%)

Query: 238 PEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKS 297
           P D++++     GN TT +         + K +++ A E DP  A  L K +     +K 
Sbjct: 56  PSDIVLEVGPGTGNLTTRI---------LEKARKVVAVEFDPRMAAELTKRVHGTAAEKK 106

Query: 298 IEVHVGDFTKLAKP 311
           +E+ +GDFTK   P
Sbjct: 107 LEIILGDFTKTELP 120

>Kwal_14.2081 s14 (598648..599463) [816 bp, 272 aa] {ON} YBL024W
           (NCL1) - Probable proliferating-cell nucleolar antigen
           (human p120) [contig 230] PARTIAL
          Length = 272

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 52/124 (41%), Gaps = 6/124 (4%)

Query: 218 GKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEK 277
           G I  Q+  S  P  +L   P   ++D C+APG+KT  +   +   E  P    + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPHHAVLDMCAAPGSKTAQMIEALHATEDEPTGFVV-ANDA 203

Query: 278 DPERAKTL-QKMIQVAGCDKSIEVHVGDFTKLAKPD----KFSQVTGFIVDPSCSGSGIF 332
           D  R+  L  ++ ++   +  +  H   F    K D    +F +    + D  CSG G  
Sbjct: 204 DARRSHMLVHQLKRLNSANLMVVNHDAQFFPRVKLDNDSNQFLKFDRVLCDVPCSGDGTM 263

Query: 333 GRKI 336
            + +
Sbjct: 264 RKNV 267

>Smik_6.474 Chr6 complement(781184..782140) [957 bp, 318 aa] {ON}
           YPL266W (REAL)
          Length = 318

 Score = 38.5 bits (88), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 9/74 (12%)

Query: 238 PEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKS 297
           P DV+++     GN T  +         + + K + A E DP  A  L K ++    +K 
Sbjct: 56  PSDVVLEVGPGTGNLTVRI---------LEQAKSVVAVEMDPRMAAELTKRVRGTQVEKK 106

Query: 298 IEVHVGDFTKLAKP 311
           +E+ +GDF K   P
Sbjct: 107 LEIMLGDFMKTELP 120

>Skud_16.11 Chr16 (18214..19170) [957 bp, 318 aa] {ON} YPL266W
           (REAL)
          Length = 318

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 9/74 (12%)

Query: 238 PEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKS 297
           P DV+++     GN T  +         + + K + A E DP  A  L K ++    +K 
Sbjct: 56  PSDVVLEVGPGTGNLTVRI---------LEQAKNVVAVEMDPRMAAELTKRVRGTPVEKK 106

Query: 298 IEVHVGDFTKLAKP 311
           +E+ +GDF K   P
Sbjct: 107 LEIMLGDFMKTELP 120

>YPL266W Chr16 (39121..40077) [957 bp, 318 aa] {ON}  DIM1Essential
           18S rRNA dimethylase (dimethyladenosine transferase),
           responsible for conserved m6(2)Am6(2)A dimethylation in
           3'-terminal loop of 18S rRNA, part of 90S and 40S
           pre-particles in nucleolus, involved in pre-ribosomal
           RNA processing
          Length = 318

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 9/74 (12%)

Query: 238 PEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKS 297
           P DV+++     GN T  +         + + K + A E DP  A  L K ++    +K 
Sbjct: 56  PSDVVLEVGPGTGNLTVRI---------LEQAKNVVAVEMDPRMAAELTKRVRGTPVEKK 106

Query: 298 IEVHVGDFTKLAKP 311
           +E+ +GDF K   P
Sbjct: 107 LEIMLGDFMKTELP 120

>KNAG0L02440 Chr12 (434232..435185) [954 bp, 317 aa] {ON} Anc_6.1
           YPL266W
          Length = 317

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 12/81 (14%)

Query: 231 AHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQ 290
           AHI    P D++++     GN T  +         + K K++ A E DP  A  L K + 
Sbjct: 52  AHI---KPSDIVLEVGPGTGNLTVRI---------LEKAKKVVAVEMDPRMAAELTKRVH 99

Query: 291 VAGCDKSIEVHVGDFTKLAKP 311
               +K +++ +GDF K   P
Sbjct: 100 GTPAEKKLDIMLGDFMKTELP 120

>SAKL0E00660g Chr5 complement(42779..43747) [969 bp, 322 aa] {ON}
           highly similar to uniprot|P41819 Saccharomyces
           cerevisiae YPL266W DIM1 Essential 18S rRNA dimethylase
           responsible for conserved m6(2)Am6(2)A dimethylation in
           3'- terminal loop of 18 S rRNA part of 90S and 40S pre-
           particles in nucleolus involved in pre-ribosomal RNA
           processing
          Length = 322

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 9/74 (12%)

Query: 238 PEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKS 297
           P DV+++     GN T  +         + + +++ A E DP  A  L K +     +K 
Sbjct: 57  PSDVVLEVGPGTGNLTVRI---------LEQARRVVAVEMDPRMAAELTKRVHGTAAEKK 107

Query: 298 IEVHVGDFTKLAKP 311
           +E+ +GDF K   P
Sbjct: 108 LEILLGDFMKTELP 121

>Suva_16.39 Chr16 (54705..55661) [957 bp, 318 aa] {ON} YPL266W
           (REAL)
          Length = 318

 Score = 37.7 bits (86), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 9/74 (12%)

Query: 238 PEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKS 297
           P DV+++     GN T  +         + + K + A E DP  A  L K ++    +K 
Sbjct: 56  PSDVVLEVGPGTGNLTVRI---------LEQAKNVVAVEMDPRMAAELTKRVRGTPVEKK 106

Query: 298 IEVHVGDFTKLAKP 311
           +E+ +GDF K   P
Sbjct: 107 LEILLGDFMKTELP 120

>Kpol_449.12 s449 complement(42834..43793) [960 bp, 319 aa] {ON}
           complement(42834..43793) [960 nt, 320 aa]
          Length = 319

 Score = 37.4 bits (85), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 35/77 (45%), Gaps = 9/77 (11%)

Query: 235 NPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGC 294
           N  P D++++     GN T  +         + + +++ A E DP  A  L K +     
Sbjct: 54  NIKPSDIVLEVGPGTGNLTVRI---------LEQARKVVAVEMDPRMAAELTKRVHGTPA 104

Query: 295 DKSIEVHVGDFTKLAKP 311
           +K +E+ +GDF K   P
Sbjct: 105 EKKLEIMLGDFMKTELP 121

>CAGL0L07678g Chr12 complement(846285..847238) [954 bp, 317 aa] {ON}
           highly similar to uniprot|P41819 Saccharomyces
           cerevisiae YPL266w DIM1
          Length = 317

 Score = 37.0 bits (84), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 34/74 (45%), Gaps = 9/74 (12%)

Query: 238 PEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKS 297
           P D++++     GN T  +         + + +++ A E DP  A  L K +     +K 
Sbjct: 56  PSDIVLEVGPGTGNLTVRI---------LEQARKVVAVEMDPRMAAELTKRVHGTPAEKK 106

Query: 298 IEVHVGDFTKLAKP 311
           +E+ +GDF K   P
Sbjct: 107 LEIMLGDFMKTELP 120

>ZYRO0F13486g Chr6 complement(1108746..1113578) [4833 bp, 1610 aa]
            {ON} similar to uniprot|P36126 Saccharomyces cerevisiae
            YKR031C SPO14 Phospholipase D catalyzes the hydrolysis of
            phosphatidylcholine producing choline and phosphatidic
            acid involved in Sec14p-independent secretion required
            for meiosis and spore formation differently regulated in
            secretion and meiosis
          Length = 1610

 Score = 37.4 bits (85), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 57/127 (44%), Gaps = 14/127 (11%)

Query: 205  PADKITSHELYKRGKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFDPE 264
            P DK+ + ELY  GK++I D  +C              I+  S  GN+ + VAA + D +
Sbjct: 1018 PHDKLVTEELYVHGKVLIVDDRACIVG--------SANINERSQLGNRDSEVAAIIRDTD 1069

Query: 265  FVP---KQKQIHAFEKDPERAKTLQKMIQVAGCD-KSIEVHVGDFTKLAKPDKFSQVTGF 320
             V    + K+ +A     E  + L  M +  GCD  S+EV    F +L    K +  +  
Sbjct: 1070 LVKTKMEDKEYYAGRFPWELRQRL--MREHLGCDVDSVEVVERKFGRLKDLAKKNYNSLH 1127

Query: 321  IVDPSCS 327
            I+ P  S
Sbjct: 1128 ILSPGAS 1134

>KAFR0B06450 Chr2 complement(1337903..1338859) [957 bp, 318 aa] {ON}
           Anc_6.1 YPL266W
          Length = 318

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 35/77 (45%), Gaps = 9/77 (11%)

Query: 235 NPTPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGC 294
           N  P DV+++     GN T  +         + + +++ A E DP  A  L K +     
Sbjct: 53  NIKPSDVVLEVGPGTGNLTVRI---------LEQARKVVAVEMDPRMAAELTKRVHGTPA 103

Query: 295 DKSIEVHVGDFTKLAKP 311
           ++ +E+ +GDF K   P
Sbjct: 104 ERKLEIILGDFMKTELP 120

>AEL012C Chr5 complement(612993..613559) [567 bp, 188 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL067C
           (RTG1)
          Length = 188

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 41/86 (47%), Gaps = 17/86 (19%)

Query: 381 SFPNA-KKLVYSTCSIHAEENERVVIDLLLDDKVQQWGWRVRKRAGVIPTWSRRGFVEEF 439
           SFP +    V S+C+I +E +ER   D + D        R+++   VIP        EEF
Sbjct: 3   SFPGSIPSSVLSSCTIASERSERKRRDNIND--------RIQELLNVIP--------EEF 46

Query: 440 QQVYQDKQQAQELADGCIRALPKEDG 465
            Q Y  K++ QE   G   ALPK  G
Sbjct: 47  FQDYYQKKKDQESESGTPGALPKNKG 72

>ACR026W Chr3 (404011..404970) [960 bp, 319 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL266W (DIM1)
          Length = 319

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 34/74 (45%), Gaps = 9/74 (12%)

Query: 238 PEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKS 297
           P D++++     GN T  +         + + +++ A E DP  A  L K +     +K 
Sbjct: 56  PSDIVLEVGPGTGNLTVRI---------LEQARKVVAVEFDPRMAAELTKRVHGTPAEKK 106

Query: 298 IEVHVGDFTKLAKP 311
           +E+ +GDF K   P
Sbjct: 107 LEIMLGDFMKTELP 120

>NDAI0I02710 Chr9 (636403..637362) [960 bp, 319 aa] {ON} Anc_6.1
           YPL266W
          Length = 319

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 33/74 (44%), Gaps = 9/74 (12%)

Query: 238 PEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKS 297
           P D++++     GN T  +         + + + + A E DP  A  L K +     +K 
Sbjct: 57  PSDIVLEVGPGTGNLTVRI---------LEQARNVIAVEMDPRMAAELTKRVHGTPGEKK 107

Query: 298 IEVHVGDFTKLAKP 311
           +E+ +GDF K   P
Sbjct: 108 LEIMLGDFMKTELP 121

>NCAS0D02250 Chr4 (419581..420540) [960 bp, 319 aa] {ON} Anc_6.1
           YPL266W
          Length = 319

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 34/74 (45%), Gaps = 9/74 (12%)

Query: 238 PEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKS 297
           P D++++     GN T  +         + + +++ A E DP  A  L K +     +K 
Sbjct: 57  PSDIVLEVGPGTGNLTVRI---------LEQARKVVAVEMDPRMAAELTKRVHGTPSEKK 107

Query: 298 IEVHVGDFTKLAKP 311
           +E+ +GDF K   P
Sbjct: 108 LEILLGDFMKTDLP 121

>Kpol_2001.3 s2001 complement(8876..10429,10432..13809) [4932 bp, 1643
            aa] {ON} complement(8876..10429,10432..13809) [4932 nt,
            1644 aa]
          Length = 1643

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 52/112 (46%), Gaps = 14/112 (12%)

Query: 203  VHPADKITSHELYKRGKIIIQDRASCFPAHILNPTPEDVIIDSCSAPGNKTTHVAAHMFD 262
            + P DKI + +LY   K++I D  +C              I+  S  GN+ + VA  + D
Sbjct: 1040 IGPKDKIVTEQLYVHAKLLITDDRNCIIG--------SANINERSQAGNRDSEVAIVIRD 1091

Query: 263  PEFVPKQ---KQIHAFEKDPERAKTLQKMIQVAGCDKS-IEVHVGDFTKLAK 310
             +FV  +   K+ +A     E  + L  M +  GCD++ +E+    F +L K
Sbjct: 1092 TDFVKTKMNGKEYYAGRFAWELRQRL--MREHLGCDRNLVEIVERKFGRLEK 1141

>KLLA0D00594g Chr4 complement(57894..58856) [963 bp, 320 aa] {ON}
           highly similar to uniprot|P41819 Saccharomyces
           cerevisiae YPL266W DIM1 Essential 18S rRNA dimethylase
           responsible for conserved m6(2)Am6(2)A dimethylation in
           3'- terminal loop of 18 S rRNA part of 90S and 40S pre-
           particles in nucleolus involved in pre-ribosomal RNA
           processing
          Length = 320

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 34/74 (45%), Gaps = 9/74 (12%)

Query: 238 PEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKS 297
           P D++++     GN T  +         + + +++ A E DP  A  L K +     +K 
Sbjct: 57  PSDIVLEIGPGTGNLTVRI---------LEQARKVVAVEFDPRMAAELTKRVHGTPVEKK 107

Query: 298 IEVHVGDFTKLAKP 311
           +E+ +GDF K   P
Sbjct: 108 LEILLGDFMKTELP 121

>TDEL0G04700 Chr7 (858722..859681) [960 bp, 319 aa] {ON} Anc_6.1
           YPL266W
          Length = 319

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 32/74 (43%), Gaps = 9/74 (12%)

Query: 238 PEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKS 297
           P D +++     GN T  +         + + K + A E DP  A  L K +     ++ 
Sbjct: 57  PSDTVLEVGPGTGNLTVRI---------LEQAKNVIAVEMDPRMAAELTKRVHGTPVERK 107

Query: 298 IEVHVGDFTKLAKP 311
           +E+ +GDF K   P
Sbjct: 108 LEILLGDFMKTELP 121

>ZYRO0F00308g Chr6 complement(32198..33157) [960 bp, 319 aa] {ON}
           highly similar to uniprot|P41819 Saccharomyces
           cerevisiae YPL266W DIM1 Essential 18S rRNA dimethylase
           responsible for conserved m6(2)Am6(2)A dimethylation in
           3'- terminal loop of 18 S rRNA part of 90S and 40S pre-
           particles in nucleolus involved in pre-ribosomal RNA
           processing
          Length = 319

 Score = 34.3 bits (77), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 33/74 (44%), Gaps = 9/74 (12%)

Query: 238 PEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKS 297
           P D +++     GN T  +   +         ++ +A E DP  A  L K ++    ++ 
Sbjct: 57  PSDTVLEVGPGTGNLTVRILEQV---------RKAYAVEMDPRMAAELTKRVRGTDGERK 107

Query: 298 IEVHVGDFTKLAKP 311
           +E+ +GDF K   P
Sbjct: 108 LEILLGDFIKTDLP 121

>KLTH0C11704g Chr3 (966706..967674) [969 bp, 322 aa] {ON} highly
           similar to uniprot|P41819 Saccharomyces cerevisiae
           YPL266W DIM1 Essential 18S rRNA dimethylase responsible
           for conserved m6(2)Am6(2)A dimethylation in 3'- terminal
           loop of 18 S rRNA part of 90S and 40S pre- particles in
           nucleolus involved in pre-ribosomal RNA processing
          Length = 322

 Score = 33.9 bits (76), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 33/74 (44%), Gaps = 9/74 (12%)

Query: 238 PEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKS 297
           P DV+++     GN T  +         + + +++ A E DP     L K +     +K 
Sbjct: 57  PSDVVLEVGPGTGNLTVRI---------LEQARKVIAVEMDPRMGAELTKRVHGTAGEKK 107

Query: 298 IEVHVGDFTKLAKP 311
           +++ +GDF K   P
Sbjct: 108 LDILLGDFMKTDLP 121

>TPHA0J00200 Chr10 complement(47344..48303) [960 bp, 319 aa] {ON}
           Anc_6.1 YPL266W
          Length = 319

 Score = 33.9 bits (76), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 34/74 (45%), Gaps = 9/74 (12%)

Query: 238 PEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKS 297
           P D++++     GN T  +         + + +++ A E DP  A  L K +     +K 
Sbjct: 57  PSDIVLEVGPGTGNLTVRI---------LEQARKVVAVEMDPRMAAELTKRVHGTPGEKK 107

Query: 298 IEVHVGDFTKLAKP 311
           +++ +GDF K   P
Sbjct: 108 LDILLGDFMKTDLP 121

>TBLA0A07080 Chr1 complement(1748948..1749913) [966 bp, 321 aa] {ON}
           Anc_6.1 YPL266W
          Length = 321

 Score = 33.9 bits (76), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 34/74 (45%), Gaps = 9/74 (12%)

Query: 238 PEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKS 297
           P D++++     GN T  +         + + +++ A E DP  A  L K +     +K 
Sbjct: 57  PSDIVLEVGPGTGNLTVRI---------LEQARKVIAVEFDPRMAAELTKRVHGTPAEKK 107

Query: 298 IEVHVGDFTKLAKP 311
           +++ +GDF K   P
Sbjct: 108 LDIILGDFMKTELP 121

>Kwal_56.22317 s56 complement(43543..44631) [1089 bp, 362 aa] {ON}
           YPL266W (DIM1) - dimethyladenosine transferase [contig
           186] FULL
          Length = 362

 Score = 33.9 bits (76), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 33/74 (44%), Gaps = 9/74 (12%)

Query: 238 PEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKS 297
           P DV+++     GN T  +         + + +++ A E DP     L K +     +K 
Sbjct: 97  PSDVVLEVGPGTGNLTVRI---------LEQARKVIAVEMDPRMGAELTKRVHGTSGEKK 147

Query: 298 IEVHVGDFTKLAKP 311
           +++ +GDF K   P
Sbjct: 148 LDILLGDFMKTDLP 161

>KLLA0E16391g Chr5 (1465648..1466427) [780 bp, 259 aa] {ON} similar
           to uniprot|P42940 YGR207C Saccharomyces cerevisiae YGR2
           Hypothetical ORF
          Length = 259

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 2/73 (2%)

Query: 270 KQIHAFEKDPERAKTLQKMIQVAGCDKSIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGS 329
           + IHA    P +A+ + +     GCD S  V   D T+L +P   S+V   IV+   +  
Sbjct: 62  ESIHAVSVGPLKAQDVLRTALAKGCDSSTLVE-HDSTEL-EPLVISKVLKKIVEDKNANL 119

Query: 330 GIFGRKIIDDTNN 342
            + G++ IDD +N
Sbjct: 120 VVLGKQAIDDDSN 132

>TBLA0H01880 Chr8 (441695..446821) [5127 bp, 1708 aa] {ON} Anc_5.370
           YHR080C
          Length = 1708

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 7/46 (15%)

Query: 196 FIPNLFGVHPADKIT-------SHELYKRGKIIIQDRASCFPAHIL 234
           F  N+ G+ P +K+        S ++ ++GK+ I DR  CF A+IL
Sbjct: 829 FFKNINGISPDEKLIIDITCALSRDILQQGKMYITDRNICFNANIL 874

>ZYRO0E07854g Chr5 complement(614363..615745) [1383 bp, 460 aa] {ON}
           highly similar to uniprot|Q12464 Saccharomyces
           cerevisiae YPL235W RVB2 RUVB-like protein TIP49b
           Homologue
          Length = 460

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 24/39 (61%), Gaps = 5/39 (12%)

Query: 162 NGKVDDVKGELQKKFPTKVSNW-----SEIVPGTIYHDE 195
            G   +++ E++++  TKV+ W     +EIVPG ++ DE
Sbjct: 257 TGDTGEIRSEVREQINTKVAEWKEEGKAEIVPGVLFIDE 295

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,973,153
Number of extensions: 2273036
Number of successful extensions: 5452
Number of sequences better than 10.0: 93
Number of HSP's gapped: 5437
Number of HSP's successfully gapped: 99
Length of query: 477
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 364
Effective length of database: 40,524,141
Effective search space: 14750787324
Effective search space used: 14750787324
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)