Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E07656g2.287ON36836819520.0
Kwal_27.115282.287ON36736817200.0
KLTH0G10384g2.287ON36736817140.0
NCAS0B062502.287ON37337316300.0
TDEL0G021802.287ON36936916120.0
CAGL0G02585g2.287ON37237215830.0
Suva_9.1052.287ON37137115790.0
NDAI0B035502.287ON37237215780.0
KLLA0E08339g2.287ON36936815650.0
ZYRO0A01914g2.287ON36836815610.0
KNAG0A054202.287ON37237115590.0
YIL094C (LYS12)2.287ON37137115540.0
Kpol_1003.392.287ON37037015530.0
Smik_9.852.287ON37137115460.0
Skud_9.792.287ON37137115360.0
TBLA0B059402.287ON36936915310.0
KAFR0J013602.287ON37337215190.0
TPHA0C034102.287ON37137114910.0
Ecym_33262.287ON36636814730.0
ADL214C2.287ON36736813980.0
KLLA0E03125g5.473ON3683534822e-56
ADL223W2.278ON3623804725e-55
CAGL0I07227g5.473ON3683764691e-54
KLTH0F15048g5.473ON3683534655e-54
Suva_8.1885.473ON3693754648e-54
Ecym_23135.473ON3703914631e-53
NCAS0H022505.473ON4223594643e-53
AFR137C5.473ON3673904603e-53
Smik_15.3165.473ON3693904594e-53
NDAI0C014105.473ON3693724594e-53
Ecym_33162.278ON3623804584e-53
Smik_14.2902.278ON3603824585e-53
Skud_15.3005.473ON3693964586e-53
Kwal_55.212735.473ON3683894561e-52
SAKL0G03520g5.473ON3693964552e-52
YNL037C (IDH1)2.278ON3603864542e-52
Skud_14.2932.278ON3613824524e-52
KNAG0B040705.473ON3733524516e-52
YOR136W (IDH2)5.473ON3693964491e-51
Kwal_23.50122.278ON3613854472e-51
TPHA0D015602.278ON3603854445e-51
Kpol_1039.352.278ON3593814439e-51
KAFR0B063705.473ON3783604403e-50
TDEL0A033705.473ON3713594377e-50
KLTH0G10186g2.278ON3603844367e-50
KLLA0F04103g2.278ON3613834368e-50
Kpol_543.85.473ON3683544324e-49
TPHA0J027705.473ON3763724324e-49
TDEL0C038402.278ON3613864314e-49
SAKL0E07876g2.278ON3613844299e-49
TBLA0B022405.473ON3733544291e-48
NDAI0B035902.278ON3593554262e-48
Kpol_440.125.473ON3683894263e-48
ZYRO0D11220g5.473ON3683524254e-48
NCAS0B062902.278ON3593554166e-47
KAFR0J014102.278ON3503774071e-45
TPHA0E014805.473ON3773534063e-45
CAGL0G02673g2.278ON3583744035e-45
KNAG0A052802.278ON3613834036e-45
TBLA0B069102.278ON3653543993e-44
ZYRO0D02838g2.278ON3613813889e-43
TDEL0B060001.402ON3623643827e-42
TBLA0C015001.402ON3653693792e-41
KLLA0D04906g1.402ON3623643741e-40
Ecym_12961.402ON3633623731e-40
KLTH0H12188g1.402ON3643673722e-40
Suva_14.3022.278ON3003273584e-39
NDAI0G042301.402ON3633643625e-39
KNAG0I012801.402ON4473693651e-38
Skud_3.431.402ON3643673573e-38
YCL018W (LEU2)1.402ON3643673573e-38
AAL012C1.402ON3723683487e-37
Smik_3.661.402ON3643673478e-37
Kwal_0.2251.402ON3643683479e-37
Suva_3.31.402ON3643643442e-36
CAGL0H03795g1.402ON3653663433e-36
ZYRO0E04796g1.402ON3623643416e-36
Kpol_1048.631.402ON3643653391e-35
KAFR0I022001.402ON3653603363e-35
SAKL0D08690g1.402ON3643683339e-35
NCAS0C048701.402ON3653653284e-34
TPHA0B037301.402ON3653733083e-31
AAL022W1.396ON4151961452e-09
Ecym_13061.396ON4151301452e-09
KAFR0H031601.396ON4211271416e-09
Smik_12.2351.396ON4122251408e-09
KLTH0H12012g1.396ON4131261372e-08
SAKL0D08426g1.396ON4112331372e-08
YLR174W (IDP2)1.396ON4122251372e-08
KAFR0I021301.396ON4081271362e-08
TBLA0C012901.396ON4181301354e-08
Kpol_1055.784.254ON4272071345e-08
Suva_10.2711.396ON4121331336e-08
Skud_12.2391.396ON4122181336e-08
TPHA0B036601.396ON4221261328e-08
TDEL0B061001.396ON4141301329e-08
KNAG0I013201.396ON4121261311e-07
CAGL0H03663g1.396ON4181331301e-07
YNL009W (IDP3)1.396ON4201261292e-07
ZYRO0E05016g1.396ON4111451292e-07
TPHA0B022104.254ON4332711282e-07
Kwal_0.1911.396ON4111411283e-07
KLLA0F12342g1.396ON4152291283e-07
Suva_14.3391.396ON4171261283e-07
Smik_14.3191.396ON4181261273e-07
Smik_4.1694.254ON4281151273e-07
Skud_14.3181.396ON4201261274e-07
NCAS0A087201.396ON4131331256e-07
Kwal_23.42104.254ON4221821248e-07
CAGL0B04917g1.396ON4111991248e-07
Suva_4.1844.254ON4291151249e-07
KNAG0H016701.396ON4241261249e-07
YDL066W (IDP1)4.254ON4281151221e-06
Skud_4.1894.254ON4291151222e-06
TDEL0E011604.254ON4231821222e-06
Kpol_1048.701.396ON4191061212e-06
NDAI0G008501.396ON4191261212e-06
KLLA0B03355g4.254ON4292711212e-06
NDAI0D043604.254ON4241151202e-06
KAFR0G032604.254ON4211771203e-06
CAGL0D00770g4.254ON4231261193e-06
AER061C4.254ON4251381176e-06
SAKL0H02860g4.254ON4211151169e-06
KLTH0D14476g4.254ON4201161169e-06
NCAS0G036201.396ON4182161159e-06
NDAI0G051601.396ON4201231151e-05
NCAS0A025104.254ON4261151113e-05
KNAG0D044104.254ON4281371104e-05
ZYRO0B12496g4.254ON4221151096e-05
Ecym_32654.254ON424981052e-04
Suva_14.303singletonON5350932e-04
TBLA0A080104.254ON4281141043e-04
Suva_16.4833.502ON61377770.48
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E07656g
         (368 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly...   756   0.0  
Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094...   667   0.0  
KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {...   664   0.0  
NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON} Anc_2...   632   0.0  
TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {O...   625   0.0  
CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly...   614   0.0  
Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON...   612   0.0  
NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.2...   612   0.0  
KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly...   607   0.0  
ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {...   605   0.0  
KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON}              605   0.0  
YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}  ...   603   0.0  
Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {O...   602   0.0  
Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}...   600   0.0  
Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}...   596   0.0  
TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa] ...   594   0.0  
KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2....   589   0.0  
TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {O...   578   0.0  
Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}...   572   0.0  
ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON} S...   543   0.0  
KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly...   190   2e-56
ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic ho...   186   5e-55
CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {...   185   1e-54
KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]...   183   5e-54
Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W ...   183   8e-54
Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}...   182   1e-53
NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473    183   3e-53
AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON} S...   181   3e-53
Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136...   181   4e-53
NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {O...   181   4e-53
Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar t...   181   4e-53
Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037...   181   5e-53
Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136...   181   6e-53
Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {...   180   1e-52
SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly...   179   2e-52
YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON} ...   179   2e-52
Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037...   178   4e-52
KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {O...   178   6e-52
YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subun...   177   1e-51
Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C...   176   2e-51
TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {O...   175   5e-51
Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa] ...   175   9e-51
KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa] ...   174   3e-50
TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.4...   172   7e-50
KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly...   172   7e-50
KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON} unipro...   172   8e-50
Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON} (21411..22...   171   4e-49
TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2....   171   4e-49
TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {O...   170   4e-49
SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {...   169   9e-49
TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {O...   169   1e-48
NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {O...   168   2e-48
Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON} (32084..3...   168   3e-48
ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly...   168   4e-48
NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa] ...   164   6e-47
KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {...   161   1e-45
TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {O...   160   3e-45
CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {...   159   5e-45
KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON}              159   6e-45
TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON}            158   3e-44
ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} simila...   154   9e-43
TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON} Anc_1...   151   7e-42
TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {O...   150   2e-41
KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly...   148   1e-40
Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar t...   148   1e-40
KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} high...   147   2e-40
Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C...   142   4e-39
NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa] ...   144   5e-39
KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {O...   145   1e-38
Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)   142   3e-38
YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}  LEU2Beta-iso...   142   3e-38
AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON} S...   138   7e-37
Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)   138   8e-37
Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W (L...   138   9e-37
Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)      137   2e-36
CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}             136   3e-36
ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON} unipro...   135   6e-36
Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON} (1820...   135   1e-35
KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.4...   134   3e-35
SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {...   132   9e-35
NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {O...   130   4e-34
TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {O...   123   3e-31
AAL022W Chr1 (302946..304193) [1248 bp, 415 aa] {ON} Syntenic ho...    60   2e-09
Ecym_1306 Chr1 complement(619565..620812) [1248 bp, 415 aa] {ON}...    60   2e-09
KAFR0H03160 Chr8 complement(602807..604072) [1266 bp, 421 aa] {O...    59   6e-09
Smik_12.235 Chr12 (451719..452957) [1239 bp, 412 aa] {ON} YLR174...    59   8e-09
KLTH0H12012g Chr8 (1026586..1027827) [1242 bp, 413 aa] {ON} high...    57   2e-08
SAKL0D08426g Chr4 (705189..706424) [1236 bp, 411 aa] {ON} highly...    57   2e-08
YLR174W Chr12 (504591..505829) [1239 bp, 412 aa] {ON}  IDP2Cytos...    57   2e-08
KAFR0I02130 Chr9 (438428..439654) [1227 bp, 408 aa] {ON} Anc_1.3...    57   2e-08
TBLA0C01290 Chr3 complement(283624..284880) [1257 bp, 418 aa] {O...    57   4e-08
Kpol_1055.78 s1055 (207889..209172) [1284 bp, 427 aa] {ON} (2078...    56   5e-08
Suva_10.271 Chr10 (476726..477964) [1239 bp, 412 aa] {ON} YLR174...    56   6e-08
Skud_12.239 Chr12 (451342..452580) [1239 bp, 412 aa] {ON} YLR174...    56   6e-08
TPHA0B03660 Chr2 (863280..864548) [1269 bp, 422 aa] {ON} Anc_1.3...    55   8e-08
TDEL0B06100 Chr2 complement(1076365..1077609) [1245 bp, 414 aa] ...    55   9e-08
KNAG0I01320 Chr9 complement(255478..256716) [1239 bp, 412 aa] {O...    55   1e-07
CAGL0H03663g Chr8 (337533..338789) [1257 bp, 418 aa] {ON} highly...    55   1e-07
YNL009W Chr14 (614821..616083) [1263 bp, 420 aa] {ON}  IDP3Perox...    54   2e-07
ZYRO0E05016g Chr5 complement(379654..380889) [1236 bp, 411 aa] {...    54   2e-07
TPHA0B02210 Chr2 (509945..511246) [1302 bp, 433 aa] {ON} Anc_4.2...    54   2e-07
Kwal_0.191 s0 (98033..99268) [1236 bp, 411 aa] {ON} YLR174W (IDP...    54   3e-07
KLLA0F12342g Chr6 (1137608..1138855) [1248 bp, 415 aa] {ON} high...    54   3e-07
Suva_14.339 Chr14 (594794..596047) [1254 bp, 417 aa] {ON} YNL009...    54   3e-07
Smik_14.319 Chr14 (573167..574423) [1257 bp, 418 aa] {ON} YLR174...    54   3e-07
Smik_4.169 Chr4 (311244..312530) [1287 bp, 428 aa] {ON} YDL066W ...    54   3e-07
Skud_14.318 Chr14 (581597..582859) [1263 bp, 420 aa] {ON} YNL009...    54   4e-07
NCAS0A08720 Chr1 complement(1722511..1723752) [1242 bp, 413 aa] ...    53   6e-07
Kwal_23.4210 s23 (619516..620784) [1269 bp, 422 aa] {ON} YDL066W...    52   8e-07
CAGL0B04917g Chr2 complement(477939..479174) [1236 bp, 411 aa] {...    52   8e-07
Suva_4.184 Chr4 (324382..325671) [1290 bp, 429 aa] {ON} YDL066W ...    52   9e-07
KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.3...    52   9e-07
YDL066W Chr4 (334835..336121) [1287 bp, 428 aa] {ON}  IDP1Mitoch...    52   1e-06
Skud_4.189 Chr4 (330300..331589) [1290 bp, 429 aa] {ON} YDL066W ...    52   2e-06
TDEL0E01160 Chr5 (234217..235488) [1272 bp, 423 aa] {ON} Anc_4.2...    52   2e-06
Kpol_1048.70 s1048 complement(198298..199557) [1260 bp, 419 aa] ...    51   2e-06
NDAI0G00850 Chr7 (179074..180333) [1260 bp, 419 aa] {ON} Anc_1.396     51   2e-06
KLLA0B03355g Chr2 (303444..304733) [1290 bp, 429 aa] {ON} highly...    51   2e-06
NDAI0D04360 Chr4 (1024297..1025571) [1275 bp, 424 aa] {ON} Anc_4...    51   2e-06
KAFR0G03260 Chr7 complement(675642..676907) [1266 bp, 421 aa] {O...    51   3e-06
CAGL0D00770g Chr4 (95715..96986) [1272 bp, 423 aa] {ON} highly s...    50   3e-06
AER061C Chr5 complement(749709..750986) [1278 bp, 425 aa] {ON} S...    50   6e-06
SAKL0H02860g Chr8 (280944..282209) [1266 bp, 421 aa] {ON} highly...    49   9e-06
KLTH0D14476g Chr4 complement(1184813..1186075) [1263 bp, 420 aa]...    49   9e-06
NCAS0G03620 Chr7 complement(675224..676480) [1257 bp, 418 aa] {O...    49   9e-06
NDAI0G05160 Chr7 complement(1250883..1252145) [1263 bp, 420 aa] ...    49   1e-05
NCAS0A02510 Chr1 complement(476363..477643) [1281 bp, 426 aa] {O...    47   3e-05
KNAG0D04410 Chr4 complement(799414..800700) [1287 bp, 428 aa] {O...    47   4e-05
ZYRO0B12496g Chr2 complement(1007086..1008354) [1269 bp, 422 aa]...    47   6e-05
Ecym_3265 Chr3 (504267..505541) [1275 bp, 424 aa] {ON} similar t...    45   2e-04
Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C ...    40   2e-04
TBLA0A08010 Chr1 (1981576..1982862) [1287 bp, 428 aa] {ON} Anc_4...    45   3e-04
Suva_16.483 Chr16 complement(831888..833729) [1842 bp, 613 aa] {...    34   0.48 

>SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  756 bits (1952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/368 (100%), Positives = 368/368 (100%)

Query: 1   MLRSTVSQFARRSYASAAKPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQ 60
           MLRSTVSQFARRSYASAAKPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQ
Sbjct: 1   MLRSTVSQFARRSYASAAKPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQ 60

Query: 61  AGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120
           AGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV
Sbjct: 61  AGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120

Query: 121 RPVKSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAK 180
           RPVKSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAK
Sbjct: 121 RPVKSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAK 180

Query: 181 IALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVD 240
           IALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVD
Sbjct: 181 IALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVD 240

Query: 241 SMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPCHGSAP 300
           SMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPCHGSAP
Sbjct: 241 SMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPCHGSAP 300

Query: 301 DIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQQV 360
           DIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQQV
Sbjct: 301 DIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQQV 360

Query: 361 VDDILSKM 368
           VDDILSKM
Sbjct: 361 VDDILSKM 368

>Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094C
           (LYS12) - Homo-isocitrate dehydrogenase [contig 27] FULL
          Length = 367

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/368 (86%), Positives = 347/368 (94%), Gaps = 1/368 (0%)

Query: 1   MLRSTVSQFARRSYASAAKPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQ 60
           MLR++ +Q ARRSY SA K LTIGLIPGDGIG+EVIPAGKLVLENLSSKH LKFNFIDL+
Sbjct: 1   MLRTSFNQLARRSYTSATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLE 60

Query: 61  AGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120
           AGWQTFLDTGKALPDETI+ILK++CQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV
Sbjct: 61  AGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120

Query: 121 RPVKSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAK 180
           RPVKSV  + ++P+DM+IVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISE AT +IA 
Sbjct: 121 RPVKSVL-SQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIAN 179

Query: 181 IALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVD 240
           IALEI+LQR K NG ATLTVTHKSNVLSQSDGLFRE+C+ VYESN++++G+I YNEQIVD
Sbjct: 180 IALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVD 239

Query: 241 SMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPCHGSAP 300
           SMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG DF+VGEPCHGSAP
Sbjct: 240 SMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAP 299

Query: 301 DIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQQV 360
           DIAGKGISNP+ATIRSTALMLEFMG+ EAAQDIHKAVD N+R+N +KTPDLGGKSTTQQV
Sbjct: 300 DIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQV 359

Query: 361 VDDILSKM 368
           VDD+LS+M
Sbjct: 360 VDDVLSRM 367

>KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 367

 Score =  664 bits (1714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/368 (86%), Positives = 347/368 (94%), Gaps = 1/368 (0%)

Query: 1   MLRSTVSQFARRSYASAAKPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQ 60
           MLR++ +Q ARRSYASA+K LTIGLIPGDGIGKEVIPAG+ VLENLSSKH LKF+FIDLQ
Sbjct: 1   MLRASFTQLARRSYASASKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQ 60

Query: 61  AGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120
           AGWQTF +TGKALPDETI+IL++ CQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV
Sbjct: 61  AGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120

Query: 121 RPVKSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAK 180
           RPVKSV    +RPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETAT +IA 
Sbjct: 121 RPVKSVL-PQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIAN 179

Query: 181 IALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVD 240
           IALEI+LQR K NG+ATLTVTHKSNVLSQSDGLFREVC+ VYESNK+++G+I YNEQIVD
Sbjct: 180 IALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVD 239

Query: 241 SMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPCHGSAP 300
           SMVYR+FREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG DF+VGEPCHGSAP
Sbjct: 240 SMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAP 299

Query: 301 DIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQQV 360
           DIAGKGISNP+ATIRSTALMLEFMG+ EAAQDIHKAVD N+R+N IKTPDLGGKSTTQQV
Sbjct: 300 DIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTTQQV 359

Query: 361 VDDILSKM 368
           V+D+LS+M
Sbjct: 360 VEDVLSRM 367

>NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON}
           Anc_2.287
          Length = 373

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/373 (80%), Positives = 342/373 (91%), Gaps = 5/373 (1%)

Query: 1   MLRSTVSQFAR---RSYASAA--KPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFN 55
           MLR+  S+FA    R+YA+ A  K LTIGLIPGDGIGKEVIPAGK VLENL+SKH LKF+
Sbjct: 1   MLRTAASRFATSTCRTYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFD 60

Query: 56  FIDLQAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLG 115
           FIDLQAG+QTFLDTGKALPDET+++LKS CQGALFGAVQSPT KVEGYSSPIVALRK++G
Sbjct: 61  FIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMG 120

Query: 116 LYANVRPVKSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETAT 175
           L+ANVRPVKSV GT DRPVDM+IVRENTEDLYIK EKTYID+ TGTRVAEA KRISE AT
Sbjct: 121 LFANVRPVKSVSGTKDRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIAT 180

Query: 176 TDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYN 235
             IA IAL+I+LQRLK NGKATLTVTHKSNVLSQSDGLFRE+CK+VYESNK++YG+I YN
Sbjct: 181 RRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYN 240

Query: 236 EQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPC 295
           EQIVDSMVYR+FREP+CFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG + ++GEPC
Sbjct: 241 EQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 300

Query: 296 HGSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKS 355
           HGSAPDIAGKGI+NPIATIRSTALMLEF+G+ +AAQDIH+AV+ N+REN+IKTPDLGG S
Sbjct: 301 HGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNS 360

Query: 356 TTQQVVDDILSKM 368
           TTQQV +D+L+++
Sbjct: 361 TTQQVTEDVLARL 373

>TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {ON}
           Anc_2.287 YIL094C
          Length = 369

 Score =  625 bits (1612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/369 (79%), Positives = 335/369 (90%), Gaps = 1/369 (0%)

Query: 1   MLRSTVSQFA-RRSYASAAKPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDL 59
           MLRS + + A RR+YASA K + IGLIPGDGIGKEVIPAGK VLENLS KH L F+FIDL
Sbjct: 1   MLRSAIGRLATRRAYASAPKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFIDL 60

Query: 60  QAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYAN 119
           QAGW TF +TGKALP++T+++LK+ CQGALFGAVQSPT KVEGYSSPIVALRK+LGLYAN
Sbjct: 61  QAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYAN 120

Query: 120 VRPVKSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIA 179
           VRPVKSV+GT DRPVDM+IVRENTEDLYIK EKTY+D+ TGTRVAEA KRISE AT  IA
Sbjct: 121 VRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIA 180

Query: 180 KIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIV 239
            IAL+I+LQRLK NG ATLTVTHKSNVLSQSDGLFRE+CK+VYESNK++YG + YNEQIV
Sbjct: 181 TIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIV 240

Query: 240 DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPCHGSA 299
           DSMVYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVG + ++GEPCHGSA
Sbjct: 241 DSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSA 300

Query: 300 PDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQQ 359
           PDIAGKGISNPIATIRST LMLEF+G+ + AQDI++AVD N+RE+++KTPDLGG STTQQ
Sbjct: 301 PDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTTQQ 360

Query: 360 VVDDILSKM 368
           VV+DILSK+
Sbjct: 361 VVEDILSKL 369

>CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094c LYS12 homo-isocitrate dehydrogenase
          Length = 372

 Score =  614 bits (1583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/372 (79%), Positives = 332/372 (89%), Gaps = 4/372 (1%)

Query: 1   MLRSTVSQF-ARRSYAS---AAKPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNF 56
           MLR + ++  A R ++S   A K LTIGLIPGDGIGKEVIPAGK +LE +  K +L F F
Sbjct: 1   MLRGSATRLTAMRGFSSTRLAQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKF 60

Query: 57  IDLQAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGL 116
           IDL AGW+TF +TGKALPDET+E+L+ DCQGALFGAVQSPT KVEGYSSPIVALRK +GL
Sbjct: 61  IDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGL 120

Query: 117 YANVRPVKSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATT 176
           +ANVRPVK+V+GTNDRPVDM+IVRENTEDLYIK EKTY D  TGTRVAEA KRISE AT 
Sbjct: 121 FANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATR 180

Query: 177 DIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNE 236
            IA IAL+I+LQRL++ G ATLTVTHKSNVLSQSDGLFRE+CK+VYESNK++YG I YNE
Sbjct: 181 RIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNE 240

Query: 237 QIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPCH 296
           QIVDSMVYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVG + ++GEPCH
Sbjct: 241 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300

Query: 297 GSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKST 356
           GSAPDIAG+GI+NPIATIRSTALMLEF+GY EAAQ I+KAVD+NIRENQIKTPDLGGKST
Sbjct: 301 GSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKST 360

Query: 357 TQQVVDDILSKM 368
           TQQVVDDILSK+
Sbjct: 361 TQQVVDDILSKI 372

>Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  612 bits (1579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/371 (79%), Positives = 334/371 (90%), Gaps = 3/371 (0%)

Query: 1   MLRSTVSQF-ARRSYAS--AAKPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFI 57
           M RS  ++  A R  AS  A K LTIGLIPGDGIGKEVIPAGK +LENL+SKH L FNFI
Sbjct: 1   MFRSVATRISACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFI 60

Query: 58  DLQAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117
           DL AG+QTF +TGKALPDETI++LK  CQGALFGAVQSPT KVEGYSSPIVALR+++GLY
Sbjct: 61  DLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLY 120

Query: 118 ANVRPVKSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTD 177
           ANVRPVKSV+GT D+P+DM+IVRENTEDLYIK EKTYID+ TGTRVA+AIKRISE AT  
Sbjct: 121 ANVRPVKSVEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRR 180

Query: 178 IAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQ 237
           IAKIAL+I+LQRL+  G+ATLTVTHKSNVLSQSDGLFRE+CK+VYESNK++YG I YNEQ
Sbjct: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQ 240

Query: 238 IVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPCHG 297
           IVDSMVYRLFREP+CFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG D ++GEPCHG
Sbjct: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPCHG 300

Query: 298 SAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTT 357
           SAPDIAGKGI+NPIATIRSTALMLEF+G+ +AAQDI+KAVD N+RE  I TPDLGGK++T
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKAST 360

Query: 358 QQVVDDILSKM 368
           QQVVDD+LS++
Sbjct: 361 QQVVDDVLSRL 371

>NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.287
           YIL094C
          Length = 372

 Score =  612 bits (1578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/372 (79%), Positives = 336/372 (90%), Gaps = 4/372 (1%)

Query: 1   MLRSTVSQFAR-RSYASAA--KPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFI 57
           MLR+T S+ A  R YA+ A  K LTIGLIPGDGIGKEVIPAGK VL+NL+SKH L F+FI
Sbjct: 1   MLRTTASRLATCRGYATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFI 60

Query: 58  DLQAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117
           DLQAG+QTFLDTGKALPDETI++LK+ CQGALFGAVQSPT KVEGYSSPIVALRK++GLY
Sbjct: 61  DLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLY 120

Query: 118 ANVRPVKSVQGTNDRPVDMIIVRENTEDLY-IKTEKTYIDEKTGTRVAEAIKRISETATT 176
           ANVRPVKSV+GT D+PVDM+IVRENT     IK E+TYID  TGTRVAEA KRISE AT 
Sbjct: 121 ANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATR 180

Query: 177 DIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNE 236
            IA IAL+I+LQRLK NGKATLTVTHKSNVLSQSDGLFRE+CK+VYESNK++YG I YNE
Sbjct: 181 RIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNE 240

Query: 237 QIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPCH 296
           QIVDSMVYR+FREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVG + ++GEPCH
Sbjct: 241 QIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300

Query: 297 GSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKST 356
           GSAPDIAGKGISNPIATIRSTALMLEF+G+ EAAQDIH+AV+ N++EN++KTPDLGGKST
Sbjct: 301 GSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKST 360

Query: 357 TQQVVDDILSKM 368
           TQ+V +D+L+++
Sbjct: 361 TQEVTEDVLARL 372

>KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 369

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/368 (78%), Positives = 328/368 (89%)

Query: 1   MLRSTVSQFARRSYASAAKPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQ 60
           M+R+   Q +RR+YAS AK LTIGLIPGDGIGKEVIPAGK +LE+L+ K+ L F FIDLQ
Sbjct: 1   MMRTRFIQLSRRAYASNAKNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQ 60

Query: 61  AGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120
           AGW+TF +TGKALPDETI+ILK+ C+GALFGAVQSPT KVEGYSSPIVALRK LGL+ANV
Sbjct: 61  AGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANV 120

Query: 121 RPVKSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAK 180
           RPVKSV GT DR VD++IVRENTEDLYIK EK+YIDE TGTRVA+A KRI+E AT +IA 
Sbjct: 121 RPVKSVDGTKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIAT 180

Query: 181 IALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVD 240
           IAL+I+ QRL+ NG ATLTVTHKSNVLSQSDGLFREVC+  YE+NK++YG + YNEQIVD
Sbjct: 181 IALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVD 240

Query: 241 SMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPCHGSAP 300
           SMVYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVG + ++GEPCHGSAP
Sbjct: 241 SMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPCHGSAP 300

Query: 301 DIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQQV 360
           DIAGKGISNPIATIRSTALMLEF+GY E A+DIHKAVD NIRE +  TPDLGG STTQQV
Sbjct: 301 DIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQV 360

Query: 361 VDDILSKM 368
           ++D+LSK+
Sbjct: 361 LEDVLSKL 368

>ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/368 (78%), Positives = 325/368 (88%)

Query: 1   MLRSTVSQFARRSYASAAKPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQ 60
           M RS+V++ A R   SA K + IGLIPGDGIGKEVIPAGK VLE L SKH L+F+FIDL+
Sbjct: 1   MFRSSVAKVAARRAYSAPKSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLK 60

Query: 61  AGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120
           AGW+ F   GKALPD+T+++LK  CQGALFGAVQSPT KV GYSSPIVALRK+LGLYANV
Sbjct: 61  AGWEAFQQQGKALPDDTVKVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANV 120

Query: 121 RPVKSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAK 180
           RPVKSV+  NDR VDMIIVRENTEDLYIKTEKTY+DE TGTRVAEAIKRISE AT  IA 
Sbjct: 121 RPVKSVEKGNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIAT 180

Query: 181 IALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVD 240
           IAL+ISLQRLK+ G ATLTVTHKSNVLSQSDGLFRE+CK+VYE NK++YG + YNEQIVD
Sbjct: 181 IALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVD 240

Query: 241 SMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPCHGSAP 300
           SMVYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVG + ++GEPCHGSAP
Sbjct: 241 SMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAP 300

Query: 301 DIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQQV 360
           DIAGKGISNPIATIRSTALMLEF+G+ E AQDI+KAVD N+ +  + TPDLGGK+TTQQV
Sbjct: 301 DIAGKGISNPIATIRSTALMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQV 360

Query: 361 VDDILSKM 368
           VDDILSK+
Sbjct: 361 VDDILSKI 368

>KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/371 (78%), Positives = 330/371 (88%), Gaps = 3/371 (0%)

Query: 1   MLRSTVSQFAR-RSYAS--AAKPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFI 57
           MLRS  ++ A  R  A+  A K LTIGLIPGDGIGKEVIPAGK VL++L+ KH L F+FI
Sbjct: 2   MLRSAANKLAGCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLQSLNPKHGLNFDFI 61

Query: 58  DLQAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117
           DLQAG+QTF DTGKALPDET++ILK  CQGALFGAVQSPT KVEGYSSPIVALRK +GLY
Sbjct: 62  DLQAGFQTFQDTGKALPDETVQILKEKCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLY 121

Query: 118 ANVRPVKSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTD 177
           AN+RPVKSV+G+N+RPVDMIIVRENTEDLYIK EKTYID+ TGTRVAEA KRISE AT  
Sbjct: 122 ANIRPVKSVEGSNERPVDMIIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATQR 181

Query: 178 IAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQ 237
           IA IAL+I+LQRL+ NGKATLTVTHKSNVLSQSDGLFREVC+ +YE+NK++Y  I YNEQ
Sbjct: 182 IATIALDIALQRLQNNGKATLTVTHKSNVLSQSDGLFREVCREMYEANKDKYAGITYNEQ 241

Query: 238 IVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPCHG 297
           IVDSMVYR+FREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG + ++GEPCHG
Sbjct: 242 IVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 301

Query: 298 SAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTT 357
           SAPDIAGKGI+NPIATIRSTALMLEF+G+ EAAQDIHKAVD N+R+  +KT DLGG +TT
Sbjct: 302 SAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIHKAVDANLRDGLVKTADLGGNATT 361

Query: 358 QQVVDDILSKM 368
           Q VVDDIL+++
Sbjct: 362 QNVVDDILARL 372

>YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}
           LYS12Homo-isocitrate dehydrogenase, an NAD-linked
           mitochondrial enzyme required for the fourth step in the
           biosynthesis of lysine, in which homo-isocitrate is
           oxidatively decarboxylated to alpha-ketoadipate
          Length = 371

 Score =  603 bits (1554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/371 (78%), Positives = 330/371 (88%), Gaps = 3/371 (0%)

Query: 1   MLRSTVSQF-ARRSYAS--AAKPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFI 57
           M RS  ++  A R  AS  A K LTIGLIPGDGIGKEVIPAGK VLENL+SKH L FNFI
Sbjct: 1   MFRSVATRLSACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60

Query: 58  DLQAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117
           DL AG+QTF +TGKALPDET+++LK  CQGALFGAVQSPT KVEGYSSPIVALR+++GL+
Sbjct: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120

Query: 118 ANVRPVKSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTD 177
           ANVRPVKSV+G   +P+DM+IVRENTEDLYIK EKTYID+ TGTRVA+A KRISE AT  
Sbjct: 121 ANVRPVKSVEGEKGKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180

Query: 178 IAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQ 237
           IA IAL+I+L+RL+  G+ATLTVTHKSNVLSQSDGLFRE+CK VYESNK++YG I YNEQ
Sbjct: 181 IATIALDIALKRLQTRGQATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240

Query: 238 IVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPCHG 297
           IVDSMVYRLFREP+CFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG + ++GEPCHG
Sbjct: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300

Query: 298 SAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTT 357
           SAPDIAGKGI+NPIATIRSTALMLEF+G+ EAAQDI+KAVD N+RE  IKTPDLGGK++T
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIYKAVDANLREGSIKTPDLGGKAST 360

Query: 358 QQVVDDILSKM 368
           QQVVDD+LS++
Sbjct: 361 QQVVDDVLSRL 371

>Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {ON}
           complement(96083..97195) [1113 nt, 371 aa]
          Length = 370

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/370 (78%), Positives = 325/370 (87%), Gaps = 2/370 (0%)

Query: 1   MLRSTVSQ-FARRSYASAAKP-LTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFID 58
           MLR+ V +  ARR+  + A+  LTIGLIPGDGIGKEVIPAGK VLE +  K+++ F FID
Sbjct: 1   MLRNGVYRACARRTVVNGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFID 60

Query: 59  LQAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYA 118
           L AGWQTFLDTGKALPDET+ ILK  CQGALFGAVQSPT KVEGYSSPIVALRK+LGLYA
Sbjct: 61  LHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYA 120

Query: 119 NVRPVKSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDI 178
           N+RPVKSV GTNDRPVDM+IVRENTEDLYIK E+TYIDE TGT+VAEA KRISE AT  I
Sbjct: 121 NIRPVKSVSGTNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKI 180

Query: 179 AKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQI 238
           AKIAL+I+LQRLK  GKATLTVTHKSNVLSQSDGLFREVC++VYE NK+ YG + YNEQI
Sbjct: 181 AKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQI 240

Query: 239 VDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPCHGS 298
           VDSMVYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVG D I+GEPCHGS
Sbjct: 241 VDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPCHGS 300

Query: 299 APDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQ 358
           APDI+G+GISNP+ATIRS ALML+F+GY EAA+DI  AVD NIR  +IKTPDLGG S+T 
Sbjct: 301 APDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTT 360

Query: 359 QVVDDILSKM 368
           +V DDILSK+
Sbjct: 361 EVTDDILSKL 370

>Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/371 (77%), Positives = 331/371 (89%), Gaps = 3/371 (0%)

Query: 1   MLRSTVSQFAR-RSYAS--AAKPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFI 57
           MLRS  ++ +  R  A+  A K LTIGLIPGDGIGKEVIPAGK VLENL+SKH L FNFI
Sbjct: 1   MLRSVATRLSTCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60

Query: 58  DLQAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117
           DL AG+QTF +TGKALPDET+++LK  CQGALFGAVQSPT KVEGYSSPIVALR+++GL+
Sbjct: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120

Query: 118 ANVRPVKSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTD 177
           ANVRPVKSV+G  D+P+DM+IVRENTEDLYIK EKTYID+ TGTRVA+A KRISE AT  
Sbjct: 121 ANVRPVKSVEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180

Query: 178 IAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQ 237
           IA IA++I+L+RL+  G+ATLTVTHKSNVLSQSDGLFRE+CK VYESNK++YG I YNEQ
Sbjct: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240

Query: 238 IVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPCHG 297
           IVDSMVYRLFREP+CFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG + ++GEPCHG
Sbjct: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300

Query: 298 SAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTT 357
           SAPDIAGKGI+NPIATIRSTALMLEF+G+  AAQDI+KAVD N+RE  IKTPDLGGK++T
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAST 360

Query: 358 QQVVDDILSKM 368
           QQVV+D+LS++
Sbjct: 361 QQVVEDVLSRL 371

>Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/371 (77%), Positives = 329/371 (88%), Gaps = 3/371 (0%)

Query: 1   MLRSTVSQF-ARRSYAS--AAKPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFI 57
           M RS  ++  A R  A+  A K LTIGLIPGDGIGKEVIPAGK VLENL+SKH L FNFI
Sbjct: 1   MFRSVATRVSACRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60

Query: 58  DLQAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117
           DL AG+QTF +TGKALPDET+ +LK  CQGALFGAVQSPT KVEGYSSPIVALR+++GL+
Sbjct: 61  DLYAGFQTFQETGKALPDETVNVLKKQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120

Query: 118 ANVRPVKSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTD 177
           ANVRPVKSV+G+ ++P+DM+IVRENTEDLYIK EKTYID+ TGTRVA+A KRISE AT  
Sbjct: 121 ANVRPVKSVEGSRNKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180

Query: 178 IAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQ 237
           IA IAL+I+L+RL+  G+ATLTVTHKSNVLSQ+DGLFRE+CK VYESNK++YG I YNEQ
Sbjct: 181 IATIALDIALKRLQTRGEATLTVTHKSNVLSQTDGLFREICKEVYESNKDKYGQIKYNEQ 240

Query: 238 IVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPCHG 297
           IVDSMVYRLFREP+CFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG + ++GEPCHG
Sbjct: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300

Query: 298 SAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTT 357
           SAPDIAGKGI+NPIATIRSTALMLEF+G+  AAQDI+KAVD N+RE  I TPDLGGK++T
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNGAAQDIYKAVDANLREGAITTPDLGGKAST 360

Query: 358 QQVVDDILSKM 368
           QQVVDD+LS++
Sbjct: 361 QQVVDDVLSRL 371

>TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa]
           {ON} Anc_2.287 YIL094C
          Length = 369

 Score =  594 bits (1531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/369 (77%), Positives = 325/369 (88%), Gaps = 1/369 (0%)

Query: 1   MLRSTVSQFARRSY-ASAAKPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDL 59
           MLR++V QF+  +  AS+ K LTIGLIPGDGIGKEVIPAGK VL+NL+ KH L F FIDL
Sbjct: 1   MLRTSVRQFSVSARNASSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDL 60

Query: 60  QAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYAN 119
           QAG+QTFLDTG ALP +T++ILK+ CQGALFGAVQSPT KVEGYSSPIV LRK+LGL+AN
Sbjct: 61  QAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFAN 120

Query: 120 VRPVKSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIA 179
           VRPVK+V+GT+ +P+D++IVRENTEDLYIK EKTY D K G+R+AEA KRI+ETAT  IA
Sbjct: 121 VRPVKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIA 180

Query: 180 KIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIV 239
           K AL+I+LQRLK  G ATLTVTHKSNVLSQSDGLFREVCK VYESNK  Y  + YNEQIV
Sbjct: 181 KTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIV 240

Query: 240 DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPCHGSA 299
           DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLG+VPSANVG + ++GEPCHGSA
Sbjct: 241 DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEPCHGSA 300

Query: 300 PDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQQ 359
           PDIAGKGI+NPIATIRSTA MLE++GY+  AQDI+KAVD NIR+N+IKT DLGG STTQQ
Sbjct: 301 PDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQ 360

Query: 360 VVDDILSKM 368
           V+DDIL K+
Sbjct: 361 VIDDILGKL 369

>KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2.287
           YIL094C
          Length = 373

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/372 (76%), Positives = 327/372 (87%), Gaps = 5/372 (1%)

Query: 1   MLRSTVSQFARRSYASAA---KPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFI 57
           MLRS V++ A   + S     K LTIGLIPGDGIGKEVIPAGK VL+NLSS+H L FNFI
Sbjct: 1   MLRSVVTKSATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFI 60

Query: 58  DLQAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117
           DL+AG+QTFLDTGKALPDET+++LK  CQG LFGAVQSPT +V+ YSSPIVALRK+L LY
Sbjct: 61  DLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLY 120

Query: 118 ANVRPVKSVQGTND-RPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATT 176
           AN+RPVKSV G +  +PVDM+IVRENTEDLYIK EK+Y D+  G RVAEA KRI+E AT 
Sbjct: 121 ANIRPVKSVAGAHSGKPVDMVIVRENTEDLYIKIEKSYKDQ-NGMRVAEATKRITEVATR 179

Query: 177 DIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNE 236
            IAKIAL+++LQRLK NGKATLTVTHKSNVLSQSDGLFRE+CK+VY++NK++Y  I YNE
Sbjct: 180 KIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNE 239

Query: 237 QIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPCH 296
           QI+DSMVYR+FREPE FDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG D ++GEPCH
Sbjct: 240 QIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEPCH 299

Query: 297 GSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKST 356
           GSAPDIAGKGI+NPIATIRSTALMLEF+G+ EAAQDIHKAV++N+REN+IKTPDLGG S+
Sbjct: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSS 359

Query: 357 TQQVVDDILSKM 368
           TQ VVDD+L K+
Sbjct: 360 TQNVVDDVLEKL 371

>TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {ON}
           Anc_2.287 YIL094C
          Length = 371

 Score =  578 bits (1491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/371 (76%), Positives = 318/371 (85%), Gaps = 3/371 (0%)

Query: 1   MLRSTV--SQFARR-SYASAAKPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFI 57
           MLR +V   QF R     S    LTIGLIPGDGIGKEVIP+G+ VLE +  KH L FNFI
Sbjct: 1   MLRRSVYNRQFQRTIGNISKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFI 60

Query: 58  DLQAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117
           DLQAGWQTFLDTGKALP ET++ L+ +C GALFGAVQSPT KVEGYSSPIVALRK+LGLY
Sbjct: 61  DLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLY 120

Query: 118 ANVRPVKSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTD 177
           AN+RPVKSV    ++ VDM+IVRENTEDLYIK EKTYIDEKTGTRVA+A KRISE AT  
Sbjct: 121 ANIRPVKSVDTPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRR 180

Query: 178 IAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQ 237
           IAKIAL+I+LQRLK NG   LTVTHKSNVLSQSDGLFREVCK V+ESNK  Y  I YNEQ
Sbjct: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQ 240

Query: 238 IVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPCHG 297
           I+DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG   ++GEPCHG
Sbjct: 241 IIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEPCHG 300

Query: 298 SAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTT 357
           SAPDIAGKGISNPIATIRSTALMLEF+G+++AAQDI  AVD+N+RE++IKTPDLGGK++T
Sbjct: 301 SAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNST 360

Query: 358 QQVVDDILSKM 368
             VV+D++ ++
Sbjct: 361 SDVVNDVIRRL 371

>Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii ADL214C
          Length = 366

 Score =  572 bits (1473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/368 (74%), Positives = 319/368 (86%), Gaps = 2/368 (0%)

Query: 1   MLRSTVSQFARRSYASAAKPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQ 60
           MLR    Q + R+Y ++ K  TIGLIPGDGIGKEVIP G+ VLE +  K+ + F +IDLQ
Sbjct: 1   MLRVGRGQLSTRTYVTS-KSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQ 59

Query: 61  AGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120
           AGWQTFLDTGKALPD+T+E L+++CQGALFGAVQSPT KV+GYSSPIVALRK LGLYAN+
Sbjct: 60  AGWQTFLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANI 119

Query: 121 RPVKSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAK 180
           RPVKSV GT DRPVD++I RENTEDLYIK+E+TYID++TG RVAEAIKRISE AT +IA 
Sbjct: 120 RPVKSVDGTGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIAN 179

Query: 181 IALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVD 240
           IALEI+LQRLK  G ATLTVTHKSNVLSQSDGLFRE+CK+VY+SNK ++  + YNEQIVD
Sbjct: 180 IALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNK-KFANVQYNEQIVD 238

Query: 241 SMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPCHGSAP 300
           SMVYRLF+EP+CFDVIVAPNLYGDILSDGAAALVGSLGVVPS NVG + ++GEPCHGSAP
Sbjct: 239 SMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPCHGSAP 298

Query: 301 DIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQQV 360
           DI G+GI+NPIATIRS AL+LEF+G  EAA+ I K VD NIREN+IKTPDLGG ST +QV
Sbjct: 299 DIVGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQV 358

Query: 361 VDDILSKM 368
            +DILS++
Sbjct: 359 ANDILSRI 366

>ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL094C
           (LYS12)
          Length = 367

 Score =  543 bits (1398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/368 (68%), Positives = 313/368 (85%), Gaps = 1/368 (0%)

Query: 1   MLRSTVSQFARRSYASAAKPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQ 60
           M RS+ +    ++  + +K LTIGLIPGDGIGKEVIPAG+ VLE +  KH+++F++  L 
Sbjct: 1   MHRSSATSLIHKATYATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLD 60

Query: 61  AGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120
           AGWQTFL+TG ALP  T+E L+  CQGALFGAVQSPT KVEGYSSPIVALR++LGLYAN+
Sbjct: 61  AGWQTFLETGNALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANI 120

Query: 121 RPVKSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAK 180
           RPVKSV GT  +PVD++IVRENTEDLY++ E+TY+D  TG RVAEAIKRISE AT  IA+
Sbjct: 121 RPVKSVSGTG-QPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAE 179

Query: 181 IALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVD 240
           I+L ++LQR +  G+  LTVTHKSNVLSQ+DGLF+EVC+ VYE+NK+ YG+I YNEQIVD
Sbjct: 180 ISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVD 239

Query: 241 SMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPCHGSAP 300
           SMVYRLF+EP CFDV+VAPNLYGD+LSDGAAALVGSLG+VPS NVG++ I+GEPCHGSAP
Sbjct: 240 SMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCHGSAP 299

Query: 301 DIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQQV 360
           DIAG+GI+NPIATIRS +LML+F+G  EAA DI +AV  N+++ Q+ +PDLGGK+TTQ+V
Sbjct: 300 DIAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEV 359

Query: 361 VDDILSKM 368
           +DDIL+++
Sbjct: 360 LDDILARI 367

>KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  190 bits (482), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 124/353 (35%), Positives = 197/353 (55%), Gaps = 27/353 (7%)

Query: 22  TIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQAGWQTFLDTGKALPDETIEIL 81
           T+  I GDG+G E+  + K +    ++K  +++   D+      F++    +PD  +  +
Sbjct: 37  TVSFIEGDGVGPEISKSVKAIFS--AAKVPIEWESCDVSP---IFVNGLTTIPDPAVASI 91

Query: 82  KSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVQG--TNDRPVDMIIV 139
             +   AL G + +P  K  G+ S  + LRK  GL+ANVRP KS++G  T    V+++++
Sbjct: 92  NKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYENVNLVLI 148

Query: 140 RENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEISLQRLKANGKATLT 199
           RENTE  Y     + I+      V ++IK I++ A+  + + A E +    +A  ++ + 
Sbjct: 149 RENTEGEY-----SGIEHVVAPGVVQSIKLITQDASERVIRYAFEYA----RAVDRSKVL 199

Query: 200 VTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMVYRLFREPECFD--VIV 257
           V HKS +   +DGLF +V K +       Y  I    +++D+ V +  + PE +D  V+V
Sbjct: 200 VVHKSTIQRLADGLFVDVAKKL----SSEYPDIELQTELLDNTVLKTVQHPEAYDDVVVV 255

Query: 258 APNLYGDILSDGAAAL-VGSLGVVPSANVGHDFIVGEPCHGSAPDIAGKGISNPIATIRS 316
            PNLYGDILSD  + L  GSLG+ PSAN+GH   + E  HGSAPDIAG+  +NP A + S
Sbjct: 256 CPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLS 315

Query: 317 TALMLEFMGYTEAAQDIHKAVDTNIREN-QIKTPDLGGKSTTQQVVDDILSKM 368
           + +ML  MG TE A  I KAV T I  + + +T DLGG ++T    D ++ ++
Sbjct: 316 SVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368

>ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL037C (IDH1)
          Length = 362

 Score =  186 bits (472), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 127/380 (33%), Positives = 201/380 (52%), Gaps = 33/380 (8%)

Query: 1   MLRSTVSQFARRSYASAAKPL---------TIGLIPGDGIGKEVIPAGKLVLENLSSKHN 51
           M R+T+S   +R YA+  + L         T+ LIPGDGIGKEV  +   + E  +    
Sbjct: 1   MFRNTLSHITKRGYAAGREQLLPKKYGGRYTVTLIPGDGIGKEVTDSVVQIFE--AENVP 58

Query: 52  LKFNFIDLQAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALR 111
           + +  ++L A     L+       + +E LK +  G L G   +P ++  G+ S  VA R
Sbjct: 59  VDWESVELSA-----LEENHEGVQKAVESLKRNKVG-LKGIWHTPADQT-GHGSLNVAFR 111

Query: 112 KKLGLYANVRPVKSVQG--TNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKR 169
           K+L ++ANV   KS  G  T  + VD++I+RENTE  Y     + ++ ++   V E++K 
Sbjct: 112 KQLDIFANVALFKSFPGVKTKLQDVDLVIIRENTEGEY-----SGLEHESVPGVVESLKI 166

Query: 170 ISETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERY 229
           +++  +  IA+ A + +L+    N +  +   HK+N++   DGLFR     V E   + Y
Sbjct: 167 MTKAKSERIARFAFDFALK----NNRKAVCAVHKANIMKLGDGLFR---NTVSEIGAKEY 219

Query: 230 GAIGYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDF 289
             +  +  IVD+   +   +P  FDV+V PNLYG IL +  AAL+G  G+VP AN G ++
Sbjct: 220 PEVNVSSIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGANFGREY 279

Query: 290 IVGEP-CHGSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKT 348
            V EP C     DI G+ ++NP A I S+ LML  +G  E A  I +A    I E +  T
Sbjct: 280 AVFEPGCRHVGLDIKGQDVANPTAMILSSTLMLRHLGLNEYADRISRATYETIAEGKRTT 339

Query: 349 PDLGGKSTTQQVVDDILSKM 368
            D+GG +TT +  + ++ K+
Sbjct: 340 KDIGGTATTTEFTNAVIDKL 359

>CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2 isocitrate dehydrogenase
          Length = 368

 Score =  185 bits (469), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 131/376 (34%), Positives = 193/376 (51%), Gaps = 40/376 (10%)

Query: 5   TVSQFARRSYASAAKPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQAGWQ 64
           ++ +F  +   S  K  T+  I GDGIG E+           SS     F   D+   W+
Sbjct: 21  SIGRFTGKPNPSTGK-FTVSFIEGDGIGPEI-----------SSSVKRIFQAADVPVEWE 68

Query: 65  T------FLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYA 118
           T      F++    +PD  ++ +  +   AL G + +P  K  G+ S  + LRK   L+A
Sbjct: 69  TCDVTPIFVNGLTTIPDPAVQSINKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFNLFA 125

Query: 119 NVRPVKSVQG--TNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATT 176
           NVRP KS++G  T    VD++++RENTE  Y     + I+      V ++IK I+  A+ 
Sbjct: 126 NVRPAKSIEGFKTTYENVDLVLIRENTEGEY-----SGIEHLVSPGVVQSIKLITRDASE 180

Query: 177 DIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNE 236
            + + A E +    +A G+  L V HKS +   +DGLF  V K +       Y  I    
Sbjct: 181 RVIRYAYEYA----RAIGRPRLIVVHKSTIQRLADGLFVNVAKEL----AAEYPDIQLET 232

Query: 237 QIVDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGHDFIVGE 293
           +++D+    +   P  +   V V PNLYGDILSD  + L  GSLG+ PSAN+GH   + E
Sbjct: 233 ELIDNTCLNVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFE 292

Query: 294 PCHGSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIR-ENQIKTPDLG 352
             HGSAPDIAG+  +NP A + S+ +ML  MG TE A  I KAV   I   ++ +T DLG
Sbjct: 293 AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGMTEHADRIEKAVLGTIAGGSEYRTGDLG 352

Query: 353 GKSTTQQVVDDILSKM 368
           G ++T    D I+ K+
Sbjct: 353 GSASTTSFTDAIIKKL 368

>KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]
           {ON} highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136W IDH2 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 368

 Score =  183 bits (465), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 125/353 (35%), Positives = 193/353 (54%), Gaps = 27/353 (7%)

Query: 22  TIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQAGWQTFLDTGKALPDETIEIL 81
           T+  I GDG+G E+  A K +    ++K  +++   D+      F++    +P    + +
Sbjct: 37  TVSFIEGDGVGPEISKAVKDIFA--AAKAPIQWESCDVSP---LFINGLTTIPQPAQDSI 91

Query: 82  KSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVQG--TNDRPVDMIIV 139
             +   AL G + +P  K  G+ S  + LRK  GL+ANVRP KSVQG  T    VD++++
Sbjct: 92  NKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVQGYKTAYDNVDLVLI 148

Query: 140 RENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEISLQRLKANGKATLT 199
           RENTE  Y     + I+      V ++IK I++ A+  + + A E +    +A  +  + 
Sbjct: 149 RENTEGEY-----SGIEHVVSPGVVQSIKLITQDASERVIRYAFEYA----RAVERPKVV 199

Query: 200 VTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMVYRLFREPECFD--VIV 257
           V HKS +   +DGLF  V + +     + Y  I    +++D+ V    R+P  +   V+V
Sbjct: 200 VVHKSTIQRLADGLFVSVAEQL----SKEYPDIELQTELIDNTVLHTVRDPTKYSDVVVV 255

Query: 258 APNLYGDILSDGAAAL-VGSLGVVPSANVGHDFIVGEPCHGSAPDIAGKGISNPIATIRS 316
            PNLYGDILSD  + L  GSLG+ PSAN+GH   + E  HGSAPDIAG+  +NP A + S
Sbjct: 256 CPNLYGDILSDMNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLS 315

Query: 317 TALMLEFMGYTEAAQDIHKAVDTNIREN-QIKTPDLGGKSTTQQVVDDILSKM 368
           + +ML  MG TE A  I KAV T I    + +T DLGG ++T    + ++S++
Sbjct: 316 SVMMLNHMGLTEHADKIEKAVFTTIAAGPESRTGDLGGSASTSSFAEAVISRL 368

>Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  183 bits (464), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 131/375 (34%), Positives = 198/375 (52%), Gaps = 31/375 (8%)

Query: 4   STVSQFARRSYASAAKP----LTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDL 59
           STV Q +   Y     P     T+  I GDGIG E+  + K +    ++   + + F D+
Sbjct: 16  STVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS--AADVPINWEFCDV 73

Query: 60  QAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYAN 119
                 F++    +PD  ++ +  +   AL G + +P  K  G+ S  + LRK  GL+AN
Sbjct: 74  NP---IFVNGLTTIPDPAVQSITKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFAN 127

Query: 120 VRPVKSVQG--TNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTD 177
           VRP KS++G  T    VD++++RENTE  Y     + I+      V ++IK I+  A+  
Sbjct: 128 VRPAKSIEGFKTTYENVDLVLIRENTEGEY-----SGIEHIVCPGVVQSIKLITREASER 182

Query: 178 IAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQ 237
           + + A E +    +A G+  + V HKS +   +DGLF  V K   E +KE Y  I +  +
Sbjct: 183 VIRYAFEYA----RAIGRPRIIVVHKSTIQRLADGLFVNVAK---ELSKE-YPDITFETE 234

Query: 238 IVDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGHDFIVGEP 294
           ++D+ V  +   P  +   V V PNLYGDILSD  + L  GSLG+ PSAN+GH   + E 
Sbjct: 235 LIDNKVLNVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEA 294

Query: 295 CHGSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIREN-QIKTPDLGG 353
            HGSAPDIAGK  +NP A + S+ +ML  MG T  A  I  AV + I    + +T DL G
Sbjct: 295 VHGSAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAG 354

Query: 354 KSTTQQVVDDILSKM 368
            +TT    + ++ ++
Sbjct: 355 TATTSSFTEAVIKRL 369

>Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}
           similar to Ashbya gossypii AFR137C
          Length = 370

 Score =  182 bits (463), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 129/391 (32%), Positives = 205/391 (52%), Gaps = 44/391 (11%)

Query: 1   MLRSTVSQFARRSYASAA-----------KP------LTIGLIPGDGIGKEVIPAGKLVL 43
           M + ++ + +RR  ASA+           KP       T+  I GDGIG E+  + K + 
Sbjct: 1   MFKQSIFKGSRRYLASASRKQPSIGRFTGKPNPKTGKYTVSFIEGDGIGPEISQSVKDIF 60

Query: 44  ENLSSKHNLKFNFIDLQAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGY 103
              ++K  +++ + D+      F++    +PD  ++ +  +   AL G + +P  K  G+
Sbjct: 61  S--AAKVPVEWEYCDVTP---IFINGLTTIPDPAVQSINKNLV-ALKGPLATPIGK--GH 112

Query: 104 SSPIVALRKKLGLYANVRPVKSVQG--TNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGT 161
            S  + LRK  GL+ANVRP KS++G  T    VD++++RENTE  Y     + I+     
Sbjct: 113 RSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEY-----SGIEHVVSP 167

Query: 162 RVAEAIKRISETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNV 221
            V ++IK I+  A+  + + A E +    +A G+  + V HKS +   +DGLF  V + V
Sbjct: 168 GVVQSIKLITRDASERVIRYAFEYA----RAVGRPKVVVVHKSTIQRLADGLFVNVAQEV 223

Query: 222 YESNKERYGAIGYNEQIVDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL-VGSLG 278
                + Y  I    +++D+ V  +  +PE +   V V PNLYGDILSD  + L  GSLG
Sbjct: 224 ----GKEYPDIELQPELIDNTVLNVVSKPEKYSDSVAVCPNLYGDILSDLNSGLSAGSLG 279

Query: 279 VVPSANVGHDFIVGEPCHGSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVD 338
           + PSAN+GH   + E  HGSAPDIAG+  +NP A + S+ +ML  MG  E A  I  AV 
Sbjct: 280 LTPSANIGHTVSIFEAVHGSAPDIAGQNCANPTALLLSSVMMLNHMGLHEHADQIESAVL 339

Query: 339 TNI-RENQIKTPDLGGKSTTQQVVDDILSKM 368
             +  + + +T DL G +TT      ++ ++
Sbjct: 340 ATVASDKKNRTADLAGTATTSSFTKAVIERL 370

>NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473
          Length = 422

 Score =  183 bits (464), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 127/359 (35%), Positives = 192/359 (53%), Gaps = 39/359 (10%)

Query: 22  TIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQAGWQT------FLDTGKALPD 75
           T+  I GDGIG E+  + K +           F+   +   W+T      F+D    +P+
Sbjct: 91  TVSFIEGDGIGPEISNSVKQI-----------FSAAKVPIEWETCDVTPLFIDGLTTIPE 139

Query: 76  ETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVQG--TNDRP 133
             ++ +  +   AL G + +P  K  G+ S  + LRK  GL+ANVRP +SV+G  T    
Sbjct: 140 PAVQSINKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSVKGFKTTYPN 196

Query: 134 VDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEISLQRLKAN 193
           VD++++RENTE  Y     + I+      V ++IK I+  A+  + + A E      +A 
Sbjct: 197 VDLVLIRENTEGEY-----SGIEHVVTPGVVQSIKLITREASERVIRYAFEY----CRAI 247

Query: 194 GKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMVYRLFREPECF 253
           G+  L V HKS +   SDGLF  V K   E +KE Y  I +  +++D+ V ++   P  +
Sbjct: 248 GRPRLVVVHKSTIQRLSDGLFVNVAK---ELSKE-YPDIQFETELIDNTVLKVVSNPSSY 303

Query: 254 D--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGHDFIVGEPCHGSAPDIAGKGISNP 310
              V V PNLYGDILSD  + L  GSLG+ PS N+G++  + E  HGSAPDIAGK ++NP
Sbjct: 304 TDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGNEISIFEAVHGSAPDIAGKNMANP 363

Query: 311 IATIRSTALMLEFMGYTEAAQDIHKAVDTNIREN-QIKTPDLGGKSTTQQVVDDILSKM 368
            A + S+ +ML  MG ++ A  I  AV + I    + +T DL G +TT    D ++ K+
Sbjct: 364 TALLLSSVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422

>AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR136W
           (IDH2)
          Length = 367

 Score =  181 bits (460), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 132/390 (33%), Positives = 202/390 (51%), Gaps = 45/390 (11%)

Query: 1   MLRSTVSQFARRSYASAAKP--------------LTIGLIPGDGIGKEVIPAGKLVLENL 46
           MLR  + Q +RR  AS  +P               T+  I GDG+G E+  + K +    
Sbjct: 1   MLRQKLFQGSRRWLASVRQPSIGRYAGKPNAAGKYTVSFIEGDGVGPEISQSVKDIFSAA 60

Query: 47  SSKHNLKFNFIDLQAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSP 106
           S    +++ + D+       L T   +P+  +  +  +   AL G + +P  K  G+ S 
Sbjct: 61  SVP--VEWEYCDVTPLLVNGLTT---IPEPAVASINKNLV-ALKGPLATPIGK--GHRSL 112

Query: 107 IVALRKKLGLYANVRPVKSVQG--TNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVA 164
            + LRK  GL+ANVRP KS++G  T    VD++++RENTE  Y     + I+      V 
Sbjct: 113 NLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEY-----SGIEHVVSPGVV 167

Query: 165 EAIKRISETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYES 224
           ++IK I+  A+  + + A E +    +  G+  + V HKS +   +DGLF     NV + 
Sbjct: 168 QSIKLITREASERVIRYAFEYA----RTVGRPKVVVVHKSTIQRLADGLF----VNVAQE 219

Query: 225 NKERYGAIGYNEQIVDSMVYRLFREPECFDVIVA--PNLYGDILSDGAAAL-VGSLGVVP 281
               Y  I    +++D+ V  +  +PE +  +VA  PNLYGDILSD  + L  GSLG+ P
Sbjct: 220 LGREYPDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDILSDLNSGLSAGSLGLTP 279

Query: 282 SANVGHDFIVGEPCHGSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNI 341
           SAN+GH   + E  HGSAPDIAG+  +NP A + S+ +ML  MG  E A  I KAV + I
Sbjct: 280 SANIGHQVSIFEAVHGSAPDIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTI 339

Query: 342 ---RENQIKTPDLGGKSTTQQVVDDILSKM 368
              REN  +T DL G ++T    + ++ ++
Sbjct: 340 ASSREN--RTADLAGTASTSSFTNAVIERL 367

>Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  181 bits (459), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 133/390 (34%), Positives = 204/390 (52%), Gaps = 43/390 (11%)

Query: 1   MLRSTV-SQFARRSYASAAKP---------------LTIGLIPGDGIGKEVIPAGKLVLE 44
           MLR+T     +RR  A+  +P                T+  I GDGIG E+  + K +  
Sbjct: 1   MLRNTFFRNTSRRFLATVKQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 45  NLSSKHNLKFNFIDLQAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYS 104
             ++   +++ F D+      F++    +PD  ++ +  +   AL G + +P  K  G+ 
Sbjct: 61  --AANVPIEWEFCDVNP---IFVNGLTTIPDPAVQSITKNLV-ALKGPLATPIGK--GHR 112

Query: 105 SPIVALRKKLGLYANVRPVKSVQG--TNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTR 162
           S  + LRK  GL+ANVRP KSV+G  T    VD++++RENTE  Y     + I+      
Sbjct: 113 SLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEY-----SGIEHIVCPG 167

Query: 163 VAEAIKRISETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVY 222
           V ++IK I+  A+  + + A E +    +A G+  + V HKS +   +DGLF  V K   
Sbjct: 168 VVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVNVAK--- 220

Query: 223 ESNKERYGAIGYNEQIVDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL-VGSLGV 279
           E +KE Y  I    +++D+ V ++   P  +   V V PNLYGDILSD  + L  GSLG+
Sbjct: 221 ELSKE-YPDITLETELIDNSVLKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGL 279

Query: 280 VPSANVGHDFIVGEPCHGSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDT 339
            PSAN+GH   + E  HGSAPDIAG+  +NP A + S+ +ML  MG T  A  I  AV +
Sbjct: 280 TPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNYADQIQNAVLS 339

Query: 340 NIREN-QIKTPDLGGKSTTQQVVDDILSKM 368
            I    + +T DL G +TT    + ++ ++
Sbjct: 340 TIASGPENRTGDLAGAATTSSFTEAVIKRL 369

>NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {ON}
           Anc_5.473
          Length = 369

 Score =  181 bits (459), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 126/372 (33%), Positives = 200/372 (53%), Gaps = 28/372 (7%)

Query: 3   RSTVSQFARRSYASAAKPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQAG 62
           + ++ +F  +   S  K  T+  I GDGIG E+  + K + +  ++K  + +   D+   
Sbjct: 20  QPSIGKFTGKPNPSTGK-FTVSFIEGDGIGPEISQSVKQIFD--AAKVPIDWEPCDVSP- 75

Query: 63  WQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRP 122
              F++    +P+  ++ +  +   AL G + +P  K  G+ S  + LRK  GL+ANVRP
Sbjct: 76  --LFINGLTTIPEPAVQSINKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRP 130

Query: 123 VKSVQG--TNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAK 180
            KS++G  T    VD++I+RENTE  Y     + I+      V ++IK I+  A+  + +
Sbjct: 131 AKSIEGFKTIYDNVDLVIIRENTEGEY-----SGIEHVVTPGVVQSIKLITRDASERVIR 185

Query: 181 IALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVD 240
            A E +    +A G+  + V HKS +   +DGLF +V K +     + Y  I    +++D
Sbjct: 186 YAYEYA----RAIGRPRVIVVHKSTIQRLADGLFVDVAKEL----SQEYPDIQLETELID 237

Query: 241 SMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGHDFIVGEPCHG 297
           + V  +   P  +   V V PNLYGDILSD  + L  GSLG+ PSAN+GH+  + E  HG
Sbjct: 238 NTVLNVVSNPSSYSNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHEVSIFEAVHG 297

Query: 298 SAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIREN-QIKTPDLGGKST 356
           SAPDIAG+  +NP A + S+ +ML  MG    A  I KAV + I    + +T DL GK+T
Sbjct: 298 SAPDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKAT 357

Query: 357 TQQVVDDILSKM 368
           T    D ++ ++
Sbjct: 358 TSSFTDAVIGRL 369

>Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar to
           Ashbya gossypii ADL223W
          Length = 362

 Score =  181 bits (458), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 129/380 (33%), Positives = 202/380 (53%), Gaps = 33/380 (8%)

Query: 1   MLRSTVSQFARRSYASAAKPL---------TIGLIPGDGIGKEVIPAGKLVLENLSSKHN 51
           MLR+T  Q ++R +A A+  L         T+ LIPGDG+GKEV  +    + N+    N
Sbjct: 1   MLRNTFVQISKRRFALASGQLLPKKYGGRYTVTLIPGDGVGKEVTDS----VVNIFEAEN 56

Query: 52  LKFNFIDLQAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALR 111
           +    ID ++   + L+       + +E LK +  G L G   +P ++  G+ S  VA R
Sbjct: 57  VP---IDWESVELSGLEENMEGVQKAVESLKRNKVG-LKGIWSTPADQT-GHGSLNVAFR 111

Query: 112 KKLGLYANVRPVKSVQG--TNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKR 169
           K+L ++ANV   KS  G  T  + VD++I+RENTE  Y     + ++ ++   V E++K 
Sbjct: 112 KQLDIFANVALFKSFPGVKTKLKDVDLVIIRENTEGEY-----SGLEHESVPGVVESLKI 166

Query: 170 ISETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERY 229
           +++  +  IA+ A + +L+    N + ++   HK+N++   DGLFR     V E   + Y
Sbjct: 167 MTKAKSERIARFAFDFALK----NNRRSVCAVHKANIMKLGDGLFRNT---VNEIGAKEY 219

Query: 230 GAIGYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDF 289
             +     IVD+   +   +P  FDV+V PNLYG IL +  AAL+GS G+VP AN G ++
Sbjct: 220 PELEVKSIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNVGAALIGSPGLVPGANFGREY 279

Query: 290 IVGEP-CHGSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKT 348
            V EP       DI G+ ++NP A I S+ LML  +G  + A  I KA    I E +  T
Sbjct: 280 AVFEPGSRHVGLDIKGQDVANPTAMILSSTLMLRHLGLNDYADRISKATYEVIAEGKHTT 339

Query: 349 PDLGGKSTTQQVVDDILSKM 368
            D+GG ++T Q    I+ K+
Sbjct: 340 KDIGGHASTTQFTKAIVDKL 359

>Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037C
           (REAL)
          Length = 360

 Score =  181 bits (458), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 130/382 (34%), Positives = 206/382 (53%), Gaps = 39/382 (10%)

Query: 1   MLRSTVSQFARRSYASAAKP-----------LTIGLIPGDGIGKEVIPAGKLVLENLSSK 49
           ML  T+   A+R+ A+AA+             T+ LIPGDG+GKE+  + K + E  + K
Sbjct: 1   MLNRTI---AKRTLATAAQAERALPKKYGGRFTVTLIPGDGVGKEITDSVKTIFE--AEK 55

Query: 50  HNLKFNFIDLQAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVA 109
             + +  ++++   QT    G     E +E LK +  G L G   +P ++  G+ S  VA
Sbjct: 56  IPVDWETVNIK---QTDHKEGVY---EAVESLKRNKIG-LKGLWHTPADQT-GHGSLNVA 107

Query: 110 LRKKLGLYANVRPVKSVQGTNDR--PVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAI 167
           LRK+L +YANV   KS++G   R   +D+I++RENTE      E + ++ ++   V E++
Sbjct: 108 LRKQLDIYANVALFKSLKGVKTRIPDIDLIVIRENTEG-----EFSGLEHESVPGVVESL 162

Query: 168 KRISETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKE 227
           K ++   T  IA+ A + +    K   +  +T  HK+N++   DGLFR +   + E  ++
Sbjct: 163 KIMTRPKTERIARFAFDFA----KKYNRKAVTAVHKANIMKLGDGLFRNI---ITEIGQK 215

Query: 228 RYGAIGYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGH 287
            Y  I  +  IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G 
Sbjct: 216 EYPDIDVSSIIVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGR 275

Query: 288 DFIVGEP-CHGSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQI 346
           D+ V EP       DI G+ ++NP A I S+ LML  +G  E A  I KAV   I E + 
Sbjct: 276 DYAVFEPGSRHVGLDIKGQNVANPTAMILSSVLMLNHLGLNEYATRISKAVHETIAEGKH 335

Query: 347 KTPDLGGKSTTQQVVDDILSKM 368
            T D+GG S+T    ++I++K+
Sbjct: 336 TTKDIGGSSSTTDFTNEIINKL 357

>Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  181 bits (458), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 134/396 (33%), Positives = 204/396 (51%), Gaps = 55/396 (13%)

Query: 1   MLRSTV-SQFARRSYASAAKP---------------LTIGLIPGDGIGKEVIPAGKLVLE 44
           MLRS +    +RR  A+  +P                T+  I GDGIG E+  + K +  
Sbjct: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKI-- 58

Query: 45  NLSSKHNLKFNFIDLQAGWQT------FLDTGKALPDETIEILKSDCQGALFGAVQSPTN 98
                    FN  ++   W++      F++    +PD  ++ + ++   AL G + +P  
Sbjct: 59  ---------FNAANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLI-ALKGPLATPIG 108

Query: 99  KVEGYSSPIVALRKKLGLYANVRPVKSVQG--TNDRPVDMIIVRENTEDLYIKTEKTYID 156
           K  G+ S  + LRK  GL+ANVRP KSV+G  T    VD++++RENTE  Y     + I+
Sbjct: 109 K--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEY-----SGIE 161

Query: 157 EKTGTRVAEAIKRISETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFRE 216
                 V ++IK I+  A+  + + A E +    +A G+  + V HKS +   +DGLF  
Sbjct: 162 HIVCPGVVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVN 217

Query: 217 VCKNVYESNKERYGAIGYNEQIVDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL- 273
           V K   E +KE Y  I    +++D+ V ++   P  +   V V PNLYGDILSD  + L 
Sbjct: 218 VAK---ELSKE-YPDIILETELIDNSVLKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLS 273

Query: 274 VGSLGVVPSANVGHDFIVGEPCHGSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDI 333
            GSLG+ PSAN+GH   + E  HGSAPDIAG+  +NP A + S+ +ML  MG T  A  I
Sbjct: 274 AGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQI 333

Query: 334 HKAVDTNIREN-QIKTPDLGGKSTTQQVVDDILSKM 368
             AV + I    + +T DL G +TT    + ++ ++
Sbjct: 334 QNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {ON}
           YOR136W (IDH2) - NAD+-dependent isocitrate dehydrogenase
           [contig 130] FULL
          Length = 368

 Score =  180 bits (456), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 128/389 (32%), Positives = 203/389 (52%), Gaps = 42/389 (10%)

Query: 1   MLRSTVSQFARRSYASAAKP---------------LTIGLIPGDGIGKEVIPAGKLVLEN 45
           M RS   +   R +A+  +P                T+  I GDG+G E+  A K +   
Sbjct: 1   MFRSQFGRNTLRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFA- 59

Query: 46  LSSKHNLKFNFIDLQAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSS 105
            ++K  +++   D+      F++    +P    + +  +   AL G + +P  K  G+ S
Sbjct: 60  -AAKAPIQWETCDVTP---LFINGLTTIPQPAQDSINKNLI-ALKGPLATPIGK--GHRS 112

Query: 106 PIVALRKKLGLYANVRPVKSVQG--TNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRV 163
             + LRK  GL+ANVRP KS+QG  T    VD++++RENTE  Y     + I+      V
Sbjct: 113 LNLTLRKTFGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEY-----SGIEHVVAPGV 167

Query: 164 AEAIKRISETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYE 223
            ++IK I++ A+  + + A E +    +A  +  + V HKS +   +DGLF  V + +  
Sbjct: 168 VQSIKLITQDASERVIRYAFEYA----RAVERPKVLVVHKSTIQRLADGLFVSVAEKL-- 221

Query: 224 SNKERYGAIGYNEQIVDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL-VGSLGVV 280
              + Y  I    +++D+ V    R+P  +   V+V PNLYGDILSD  + L  GSLG+ 
Sbjct: 222 --AKEYPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLT 279

Query: 281 PSANVGHDFIVGEPCHGSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTN 340
           PSAN+GH+  + E  HGSAPDIAG+  +NP A + S+ +ML  MG TE A  I KAV + 
Sbjct: 280 PSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFST 339

Query: 341 IREN-QIKTPDLGGKSTTQQVVDDILSKM 368
           I    + +T DL G ++T    + ++S++
Sbjct: 340 IASGPENRTGDLAGSASTSSFAEAVISRL 368

>SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 369

 Score =  179 bits (455), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 131/396 (33%), Positives = 199/396 (50%), Gaps = 55/396 (13%)

Query: 1   MLRSTV-SQFARRSYASAAKP---------------LTIGLIPGDGIGKEVIPAGKLVLE 44
           MLRS V  Q  RR  +S  +P                T+  I GDG+G E+  + K +  
Sbjct: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDI-- 58

Query: 45  NLSSKHNLKFNFIDLQAGWQT------FLDTGKALPDETIEILKSDCQGALFGAVQSPTN 98
                    F   ++   W++      F++    +P   ++ +  +   AL G + +P  
Sbjct: 59  ---------FAAAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLI-ALKGPLATPIG 108

Query: 99  KVEGYSSPIVALRKKLGLYANVRPVKSVQG--TNDRPVDMIIVRENTEDLYIKTEKTYID 156
           K  G+ S  + LRK  GL+ANVRP KSV+G  T    VD++++RENTE  Y     + I+
Sbjct: 109 K--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEY-----SGIE 161

Query: 157 EKTGTRVAEAIKRISETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFRE 216
                 V ++IK I+  A+  + + A E +    +A G+  + V HKS +   +DGLF +
Sbjct: 162 HVVSPGVVQSIKLITRDASERVIRYAFEYA----RAVGRPKVMVVHKSTIQRLADGLFVD 217

Query: 217 VCKNVYESNKERYGAIGYNEQIVDSMVYRLFREPECF--DVIVAPNLYGDILSDGAAAL- 273
           V K +       Y  I    Q++D+ V  +   P  +   V V PNLYGDILSD  + L 
Sbjct: 218 VAKEL----SSEYPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDILSDLNSGLS 273

Query: 274 VGSLGVVPSANVGHDFIVGEPCHGSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDI 333
            GSLG+ PSAN+GH   + E  HGSAPDIAG+  +NP A + S+ +ML  MG  E A  I
Sbjct: 274 AGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLYEKADSI 333

Query: 334 HKAVDTNIREN-QIKTPDLGGKSTTQQVVDDILSKM 368
            KAV + I    + +T DL G ++T    + ++ ++
Sbjct: 334 EKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369

>YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON}
           IDH1Subunit of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  179 bits (454), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 129/386 (33%), Positives = 205/386 (53%), Gaps = 47/386 (12%)

Query: 1   MLRSTVSQFARRSYASAAKP-----------LTIGLIPGDGIGKEVIPAGKLVLENLSSK 49
           ML  T+   A+R+ A+AA+             T+ LIPGDG+GKE+  + + + E     
Sbjct: 1   MLNRTI---AKRTLATAAQAERTLPKKYGGRFTVTLIPGDGVGKEITDSVRTIFE----A 53

Query: 50  HNLKFNFIDLQAGWQTF----LDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSS 105
            N+  +       W+T      D  + +  E +E LK +  G L G   +P ++  G+ S
Sbjct: 54  ENIPID-------WETINIKQTDHKEGVY-EAVESLKRNKIG-LKGLWHTPADQT-GHGS 103

Query: 106 PIVALRKKLGLYANVRPVKSVQGTNDR--PVDMIIVRENTEDLYIKTEKTYIDEKTGTRV 163
             VALRK+L +YANV   KS++G   R   +D+I++RENTE      E + ++ ++   V
Sbjct: 104 LNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIVIRENTEG-----EFSGLEHESVPGV 158

Query: 164 AEAIKRISETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYE 223
            E++K ++   T  IA+ A + +    K   + ++T  HK+N++   DGLFR +   + E
Sbjct: 159 VESLKVMTRPKTERIARFAFDFA----KKYNRKSVTAVHKANIMKLGDGLFRNI---ITE 211

Query: 224 SNKERYGAIGYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSA 283
             ++ Y  I  +  IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  A
Sbjct: 212 IGQKEYPDIDVSSIIVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGA 271

Query: 284 NVGHDFIVGEP-CHGSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIR 342
           N G D+ V EP       DI G+ ++NP A I S+ LML  +G  E A  I KAV   I 
Sbjct: 272 NFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSSTLMLNHLGLNEYATRISKAVHETIA 331

Query: 343 ENQIKTPDLGGKSTTQQVVDDILSKM 368
           E +  T D+GG S+T    ++I++K+
Sbjct: 332 EGKHTTRDIGGSSSTTDFTNEIINKL 357

>Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037C
           (REAL)
          Length = 361

 Score =  178 bits (452), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 128/382 (33%), Positives = 206/382 (53%), Gaps = 39/382 (10%)

Query: 1   MLRSTVSQFARRSYASAAKP-----------LTIGLIPGDGIGKEVIPAGKLVLENLSSK 49
           ML  T+   A+R+ A+AA+             T+ LIPGDG+GKE+  + + + E  + +
Sbjct: 1   MLNRTI---AKRTLATAAQAERTLPKKYGGRFTVTLIPGDGVGKEITDSVRTIFE--AER 55

Query: 50  HNLKFNFIDLQAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVA 109
             + +  I+++   QT    G     E +E LK +  G L G   +P ++  G+ S  VA
Sbjct: 56  IPVDWETINIK---QTDHKEGVY---EAVESLKRNKIG-LKGLWHTPADQT-GHGSLNVA 107

Query: 110 LRKKLGLYANVRPVKSVQGTNDR--PVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAI 167
           LRK+L +YANV   KS++G   R   +D+I++RENTE      E + ++ ++   V E++
Sbjct: 108 LRKQLDIYANVALFKSLKGVKTRIPDIDLIVIRENTEG-----EFSGLEHESVPGVVESL 162

Query: 168 KRISETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKE 227
           K +++  T  IA+ A + +    K   +  +T  HK+N++   DGLFR +   + E  + 
Sbjct: 163 KVMTKPKTERIARFAFDFA----KKYNRKAVTAVHKANIMKLGDGLFRNI---ITEIGQT 215

Query: 228 RYGAIGYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGH 287
            Y  I  +  IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G 
Sbjct: 216 EYPDIDVSSIIVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGR 275

Query: 288 DFIVGEP-CHGSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQI 346
           D+ V EP       DI G+ ++NP A I S+ LML  +G  E A  I KAV   I E + 
Sbjct: 276 DYAVFEPGSRHVGLDIKGQNVANPTAMILSSVLMLNHLGLNENATRISKAVHETIAEGKH 335

Query: 347 KTPDLGGKSTTQQVVDDILSKM 368
            T D+GG S+T    +++++K+
Sbjct: 336 TTRDIGGSSSTTDFTNEVINKL 357

>KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  178 bits (451), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 124/352 (35%), Positives = 192/352 (54%), Gaps = 27/352 (7%)

Query: 23  IGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQAGWQTFLDTGKALPDETIEILK 82
           +  I GDGIG E+  + K + +  +++  + + F D+      F++    +PD  +  + 
Sbjct: 43  VSFIEGDGIGPEISQSVKDIFK--AAEVPINWEFCDVT---PIFVNGLTTIPDPAVASIN 97

Query: 83  SDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVQG--TNDRPVDMIIVR 140
            +   AL G + +P  K  G+ S  + LRK   L+ANVRP KS++G  T    VD++++R
Sbjct: 98  KNLI-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIR 154

Query: 141 ENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEISLQRLKANGKATLTV 200
           ENTE  Y     + I+      V ++IK I+  A+  + + A E +    KA G+  + V
Sbjct: 155 ENTEGEY-----SGIEHVVAPGVVQSIKLITRDASERVIRYAFEYA----KAIGRPRVVV 205

Query: 201 THKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMVYRLFREPECFD--VIVA 258
            HKS +   +DGLF  V K   E +KE Y  I    +++D+ V  +   P  +   V V 
Sbjct: 206 VHKSTIQRLADGLFVNVAK---ELSKE-YPEIKLETELIDNTVLNVVSNPAGYTDAVSVC 261

Query: 259 PNLYGDILSDGAAAL-VGSLGVVPSANVGHDFIVGEPCHGSAPDIAGKGISNPIATIRST 317
           PNLYGDILSD  + L  GSLG+ PSAN+G++  + E  HGSAPDIAG+  +NP A + S+
Sbjct: 262 PNLYGDILSDLNSGLSAGSLGLTPSANIGNEISIFEAVHGSAPDIAGQNKANPTALLLSS 321

Query: 318 ALMLEFMGYTEAAQDIHKAVDTNI-RENQIKTPDLGGKSTTQQVVDDILSKM 368
            +ML  MG  + A  I +AV T I   ++ +T DLGG +TT    D ++  +
Sbjct: 322 VMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373

>YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subunit
           of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle;
           phosphorylated
          Length = 369

 Score =  177 bits (449), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 131/396 (33%), Positives = 203/396 (51%), Gaps = 55/396 (13%)

Query: 1   MLRSTV-SQFARRSYASAAKP---------------LTIGLIPGDGIGKEVIPAGKLVLE 44
           MLR+T     +RR  A+  +P                T+  I GDGIG E+  + K +  
Sbjct: 1   MLRNTFFRNTSRRFLATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKI-- 58

Query: 45  NLSSKHNLKFNFIDLQAGWQT------FLDTGKALPDETIEILKSDCQGALFGAVQSPTN 98
                    F+  ++   W++      F++    +PD  ++ +  +   AL G + +P  
Sbjct: 59  ---------FSAANVPIEWESCDVSPIFVNGLTTIPDPAVQSITKNLV-ALKGPLATPIG 108

Query: 99  KVEGYSSPIVALRKKLGLYANVRPVKSVQG--TNDRPVDMIIVRENTEDLYIKTEKTYID 156
           K  G+ S  + LRK  GL+ANVRP KS++G  T    VD++++RENTE  Y     + I+
Sbjct: 109 K--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEY-----SGIE 161

Query: 157 EKTGTRVAEAIKRISETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFRE 216
                 V ++IK I+  A+  + + A E +    +A G+  + V HKS +   +DGLF  
Sbjct: 162 HIVCPGVVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVN 217

Query: 217 VCKNVYESNKERYGAIGYNEQIVDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL- 273
           V K   E +KE Y  +    +++D+ V ++   P  +   V V PNLYGDILSD  + L 
Sbjct: 218 VAK---ELSKE-YPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYGDILSDLNSGLS 273

Query: 274 VGSLGVVPSANVGHDFIVGEPCHGSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDI 333
            GSLG+ PSAN+GH   + E  HGSAPDIAG+  +NP A + S+ +ML  MG T  A  I
Sbjct: 274 AGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQI 333

Query: 334 HKAVDTNIREN-QIKTPDLGGKSTTQQVVDDILSKM 368
             AV + I    + +T DL G +TT    + ++ ++
Sbjct: 334 QNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C
           (IDH1) - alpha-4-beta-4 subunit of mitochondrial
           isocitrate dehydrogenase 1 [contig 7] FULL
          Length = 361

 Score =  176 bits (447), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 132/385 (34%), Positives = 207/385 (53%), Gaps = 44/385 (11%)

Query: 1   MLRSTVSQFARRSYAS-AAKPL---------TIGLIPGDGIGKEVIPAGKLVLENLSSKH 50
           MLRS +   ++RS A+ AA+ L         T+ LIPGDG+GKEV  +   + E+     
Sbjct: 1   MLRSGLG-VSKRSLATMAAEQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFES----E 55

Query: 51  NLKFNFIDLQAGWQTF----LDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSP 106
           N+  +       W+T     LD  + +  + +E LK +  G L G   +P+++  G+ S 
Sbjct: 56  NIPID-------WETVEISGLDNQEGV-QKAVESLKRNKVG-LKGIWHTPSDQT-GHGSL 105

Query: 107 IVALRKKLGLYANVRPVKSVQGTNDRP--VDMIIVRENTEDLYIKTEKTYIDEKTGTRVA 164
            VALRK+L ++ANV   KSV G   R   VDM+++RENTE  Y     + ++ ++   V 
Sbjct: 106 NVALRKQLDIFANVALFKSVPGVPSRHSNVDMVVIRENTEGEY-----SGLEHESVPGVV 160

Query: 165 EAIKRISETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYES 224
           E++K +++  +  I + A + +++    N + ++   HK+N++   DGLFR  C N  E 
Sbjct: 161 ESLKIMTKAKSERIGRFAFDFAVK----NNRKSVCAVHKANIMKLGDGLFRN-CIN--EV 213

Query: 225 NKERYGAIGYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSAN 284
             + Y  I     IVD+   +   +P  FDV+V PNLYG IL +  AAL+G  G+VP AN
Sbjct: 214 GAKEYPEIDVKNIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGAN 273

Query: 285 VGHDFIVGEP-CHGSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRE 343
            G ++ V EP       DI G+ ++NP A I S++LML  +G    A  I KA    I E
Sbjct: 274 FGREYAVFEPGSRHVGLDIKGQNVANPTAMILSSSLMLRHLGLNAYADRISKATYDVIAE 333

Query: 344 NQIKTPDLGGKSTTQQVVDDILSKM 368
            +  T D+GG ++T +  + I+SK+
Sbjct: 334 AKTTTQDIGGSASTTEFTEAIISKL 358

>TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {ON}
           Anc_2.278 YNL037C
          Length = 360

 Score =  175 bits (444), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 132/385 (34%), Positives = 202/385 (52%), Gaps = 45/385 (11%)

Query: 1   MLRSTVSQFARRSYASAAKP-----------LTIGLIPGDGIGKEVIPAGKLVLENLSSK 49
           MLR  VS   +RS AS  K             T+ LIPGDGIGKEV  +   V++  +S+
Sbjct: 1   MLRQVVS---KRSIASFTKNHNIVPKKYGGRYTVTLIPGDGIGKEVTDS---VVKIFASQ 54

Query: 50  HNLKFNFIDLQAGWQTFLDTGKALPDET---IEILKSDCQGALFGAVQSPTNKVEGYSSP 106
                    L   W+     G +  +E    +E LK +  G L G   +  ++  GY S 
Sbjct: 55  --------GLPIDWERIDVPGMSNENEVKKAVESLKRNKIG-LKGIWHTSADQT-GYGSL 104

Query: 107 IVALRKKLGLYANVRPVKSVQGTNDR--PVDMIIVRENTEDLYIKTEKTYIDEKTGTRVA 164
            VALRK+L ++ANV   KS++G   +   VD++++RENTE  Y     + ++ ++   V 
Sbjct: 105 NVALRKQLDIFANVAIFKSLKGVKTKIPDVDLVVIRENTEGEY-----SGLEHESVPGVV 159

Query: 165 EAIKRISETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYES 224
           E++K I++  T  IA+ A + +L+    N ++T+T  HK+N++  SDGLF+     V E 
Sbjct: 160 ESLKIITKPKTERIARFAFDFALE----NNRSTVTAVHKANIMKLSDGLFKNTVAEVGE- 214

Query: 225 NKERYGAIGYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSAN 284
             + Y  I  N  IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G++P AN
Sbjct: 215 --KEYPDIKVNTIIVDNASMQAVAKPHQFDVMVTPSMYGTILGNIGAALIGGPGLIPGAN 272

Query: 285 VGHDFIVGEP-CHGSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRE 343
            G +  V EP       DI  + I+NP A I S  LML  +G  E ++ I  AV   I E
Sbjct: 273 YGREHAVFEPGSRHVGLDIENQNIANPTAMILSATLMLNQLGLREESKRISNAVYAVIEE 332

Query: 344 NQIKTPDLGGKSTTQQVVDDILSKM 368
            +  T D+GG ++T +  D ++ K+
Sbjct: 333 GKTTTKDIGGNASTTEFTDAVIDKL 357

>Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa]
           {ON} complement(108102..109181) [1080 nt, 360 aa]
          Length = 359

 Score =  175 bits (443), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 126/381 (33%), Positives = 201/381 (52%), Gaps = 38/381 (9%)

Query: 1   MLRSTVSQFARRSYASAAKPL--------TIGLIPGDGIGKEVIPAGKLVLENLSSKHNL 52
           M R+ +S+ A  S AS    +        T+ L+PGDG+G+E+  +   + E      NL
Sbjct: 1   MFRNLISKRAFTSIASRENIIPKKYGGRYTVTLLPGDGVGREITDSVVSIFE----AENL 56

Query: 53  KFNFIDLQAGWQTFLDTGKALPD--ETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVAL 110
             +       W+    +G    D    +E LK +  G L G   +  +  +G++S  VAL
Sbjct: 57  PID-------WERVELSGLEQEDVHTAVESLKRNKIG-LKGIWHTSADH-DGHTSWNVAL 107

Query: 111 RKKLGLYANVRPVKSVQGTNDR--PVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIK 168
           RK+L +YANV   KS +G + R   VD++I+RENTE  Y     + ++ ++   V E++K
Sbjct: 108 RKELDIYANVAIFKSFKGVDTRIPDVDLVIIRENTEGEY-----SGLEHESVPGVVESLK 162

Query: 169 RISETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKER 228
            ++   T  IA+ A + +++      + ++T  HK+N++   DGLFR +   V E   + 
Sbjct: 163 IMTAQKTERIARFAFDYAMKY----NRKSVTAVHKANIMKLGDGLFRNL---VTEIGAKE 215

Query: 229 YGAIGYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD 288
           Y  +G +  IVD+   +   +P  FDV+VAP++YG IL +  AAL+G  G+VP AN G D
Sbjct: 216 YPEVGVSSIIVDNASMQAVAKPHQFDVMVAPSMYGTILGNIGAALIGGPGLVPGANYGRD 275

Query: 289 FIVGEP-CHGSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIK 347
           + V EP       DI  + I+NP A I S  LML  +G+   A  I KAV   I E +  
Sbjct: 276 YAVFEPGSRHVGLDIENQNIANPTAMILSATLMLNHLGFRNDAARISKAVHEVIAEGKTT 335

Query: 348 TPDLGGKSTTQQVVDDILSKM 368
           T D+GG +TT +  + +++K+
Sbjct: 336 TRDIGGSATTTEFTNAVIAKL 356

>KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa]
           {ON} Anc_5.473 YOR136W
          Length = 378

 Score =  174 bits (440), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 126/360 (35%), Positives = 187/360 (51%), Gaps = 39/360 (10%)

Query: 22  TIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQAGWQT------FLDTGKALPD 75
           T+  I GDGIG E+  + K + +  S           +   W+T       +D    +PD
Sbjct: 45  TVSFIEGDGIGPEISRSVKDIFQAAS-----------VPITWETCDVSPILVDGLTTIPD 93

Query: 76  ETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVQG--TNDRP 133
           E ++ +  +  G L G + +P  K  G+ S  + LRK   L+ANVRP KSV+G  T    
Sbjct: 94  EAVKSINKNLVG-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYDN 150

Query: 134 VDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEISLQRLKAN 193
           VD++++RENTE  Y     + I+      V ++IK I+  A+  + + A E +    KA 
Sbjct: 151 VDLVLIRENTEGEY-----SGIEHVVTPGVVQSIKLITRDASERVIRYAFEYA----KAI 201

Query: 194 GKATLTVTHKSNVLSQSDGLFREVCKNVYESNKER-YGAIGYNEQIVDSMVYRLFREPEC 252
           G+  + V HKS +   SDGLF  V K   E  KE+ +  I  + +++D+ V  +   P  
Sbjct: 202 GRPKVIVVHKSTIQRLSDGLFVNVAK---ELQKEKNFQNIELDTELIDNTVLNVVMNPSK 258

Query: 253 FD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGHDFIVGEPCHGSAPDIAGKGISN 309
           +   V V PNLYGDILSD  + L  GSLG+ PSAN+G    + E  HGSAPDIAG+  +N
Sbjct: 259 YSDAVFVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKISIFEAVHGSAPDIAGQNKAN 318

Query: 310 PIATIRSTALMLEFMGYTEAAQDIHKAVDTNI-RENQIKTPDLGGKSTTQQVVDDILSKM 368
           P A + S+ +ML  MG  E    I  AV   I   ++ +T DLGG +TT    + ++  +
Sbjct: 319 PTALLLSSVMMLHHMGLNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378

>TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.473
           YOR136W
          Length = 371

 Score =  172 bits (437), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 121/359 (33%), Positives = 184/359 (51%), Gaps = 39/359 (10%)

Query: 22  TIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQAGWQT------FLDTGKALPD 75
           T+  I GDG+G E+  + K +           F    +   W++       ++    +P+
Sbjct: 40  TVSFIEGDGVGPEISKSVKDI-----------FAAAKVPIVWESCPVTPLLVNGVTTIPE 88

Query: 76  ETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVQG--TNDRP 133
           +  E +  +   AL G + +P  K  G+ S  + LRK  GL+ANVRP KSV+G  T    
Sbjct: 89  QAQESINRNLV-ALKGPLATPIGK--GHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYED 145

Query: 134 VDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEISLQRLKAN 193
           VD++++RENTE  Y   E   +       V ++IK I+  A+  + + A E +    +A 
Sbjct: 146 VDLVLIRENTEGEYAGIEHVIVPG-----VVQSIKLITREASERVIRYAYEYA----RAV 196

Query: 194 GKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMVYRLFREPECF 253
           G+  L V HKS +   +DGLF  V K +       +  I    +++D+ V  +   P  +
Sbjct: 197 GRPKLVVVHKSTIQRLADGLFVTVAKEL----AHEFPDIQLQTELIDNTVLNVVSNPSKY 252

Query: 254 D--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGHDFIVGEPCHGSAPDIAGKGISNP 310
              V V PNLYGDILSD  + L  GSLG+ PS N+GH   + E  HGSAPDIAG+  +NP
Sbjct: 253 SDVVYVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAPDIAGQNKANP 312

Query: 311 IATIRSTALMLEFMGYTEAAQDIHKAVDTNIREN-QIKTPDLGGKSTTQQVVDDILSKM 368
            A + S+ +ML  MG  E A  I KAV T I    + +T DL G ++T    + ++S++
Sbjct: 313 TALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371

>KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|P28834 Saccharomyces cerevisiae
           YNL037C IDH1 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  172 bits (436), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 129/384 (33%), Positives = 202/384 (52%), Gaps = 43/384 (11%)

Query: 1   MLRSTVSQFARRSYASAAKPL---------TIGLIPGDGIGKEVIPAGKLVLENLSSKHN 51
           MLR+     ++RS A+ A+ L         T+ LIPGDG+GKEV  +   + E+     N
Sbjct: 1   MLRNGFG-ISKRSLATVAEQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFES----EN 55

Query: 52  LKFNFIDLQAGWQTF----LDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPI 107
           +  +       W+T     LD  + +  + ++ LK +  G L G   +P+++  G+ S  
Sbjct: 56  VPID-------WETVEISGLDNEEGV-QKAVDSLKRNKVG-LKGIWHTPSDQT-GHGSLN 105

Query: 108 VALRKKLGLYANVRPVKSVQGTNDRP--VDMIIVRENTEDLYIKTEKTYIDEKTGTRVAE 165
           VALRK+L ++ANV   K+V G   R   VD++++RENTE  Y     + ++ ++   V E
Sbjct: 106 VALRKQLDIFANVALFKTVPGVPSRHSNVDLVVIRENTEGEY-----SGLEHESVPGVVE 160

Query: 166 AIKRISETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESN 225
           ++K +++  +  I + A + +L+    N + ++   HK+N++   DGLFR  C N  E  
Sbjct: 161 SLKIMTKAKSDRIGRFAFDFALK----NNRKSVCAVHKANIMKLGDGLFRN-CIN--EIG 213

Query: 226 KERYGAIGYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANV 285
            + Y  I     IVD+   +   +P  FDV+V PNLYG IL +  AAL+G  G+VP AN 
Sbjct: 214 AKEYPEIEVKNIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGANF 273

Query: 286 GHDFIVGEP-CHGSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIREN 344
           G +F V EP       DI G+ ++NP A I S+ALML  +G    A  I KA    I E 
Sbjct: 274 GREFAVFEPGSRHVGLDIKGQNVANPTAMILSSALMLRHLGLNSYADRISKATYDVIAEA 333

Query: 345 QIKTPDLGGKSTTQQVVDDILSKM 368
           +  T D+GG ++T      I+ K+
Sbjct: 334 KNTTKDIGGSASTTDFTQAIIEKL 357

>KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON}
           uniprot|O94229 Kluyveromyces lactis KLLA0F04103g IDH1
           Isocitrate dehydrogenase subunit 1
          Length = 361

 Score =  172 bits (436), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 127/383 (33%), Positives = 204/383 (53%), Gaps = 40/383 (10%)

Query: 1   MLRSTVSQFARRSYAS-AAKPL---------TIGLIPGDGIGKEVIPAGKLVLENLSSKH 50
           MLR  ++   ++S+A+ AA+ L         T+ LIPGDG+GKEV  +   + EN     
Sbjct: 1   MLRQGIAA-QKKSFATLAAEQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVKIFEN----E 55

Query: 51  NLKFNF--IDLQAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIV 108
           N+  ++  ID+ +G +   +  +A     +E LK +  G L G   +P ++  G+ S  V
Sbjct: 56  NIPIDWETIDI-SGLENTENVQRA-----VESLKRNKVG-LKGIWHTPADQT-GHGSLNV 107

Query: 109 ALRKKLGLYANVRPVKSVQGTNDR--PVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEA 166
           ALRK+L ++ANV   KS+ G   R   +DM+I+RENTE  Y     + ++ ++   V E+
Sbjct: 108 ALRKQLDIFANVALFKSIPGVKTRLNNIDMVIIRENTEGEY-----SGLEHESVPGVVES 162

Query: 167 IKRISETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNK 226
           +K ++   +  IA+ A + +L+    N + ++   HK+N++   DGLFR     V E   
Sbjct: 163 LKIMTRAKSERIARFAFDFALK----NNRKSVCAVHKANIMKLGDGLFRNT---VNEIGA 215

Query: 227 ERYGAIGYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG 286
             Y  +     IVD+   +   +P  FDV+V PNLYG IL +  +AL+G  G+VP AN G
Sbjct: 216 NEYPELDVKNIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGSALIGGPGLVPGANFG 275

Query: 287 HDFIVGEP-CHGSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQ 345
            ++ V EP       DI G+ ++NP A I S+ LML  +G    A  I KA    I E +
Sbjct: 276 REYAVFEPGSRHVGLDIKGQNVANPTAMILSSTLMLRHLGLNAYADRISKATYDVISEGK 335

Query: 346 IKTPDLGGKSTTQQVVDDILSKM 368
             T D+GG ++T +  + ++ K+
Sbjct: 336 STTRDIGGSASTSEFTNAVIEKL 358

>Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON}
           (21411..22517) [1107 nt, 369 aa]
          Length = 368

 Score =  171 bits (432), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 117/354 (33%), Positives = 186/354 (52%), Gaps = 27/354 (7%)

Query: 21  LTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQAGWQTFLDTGKALPDETIEI 80
            T+  I GDG+G E+  + K +     S   +   ++    G   F++    +P+  +E+
Sbjct: 36  FTVPFIEGDGVGPEISESVKKIF----SAAKVPIEWVPCDVG-PIFVNGQTTIPEPAVEL 90

Query: 81  LKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVQG--TNDRPVDMII 138
           +      AL G + +P  K  G+ S  + LRK   L+ANVRP +S+    +    VD+++
Sbjct: 91  INKHLI-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPARSIPNYKSTYENVDLVL 147

Query: 139 VRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEISLQRLKANGKATL 198
           +RENTE  Y     + I+      V ++IK I+  AT  + + A E +    +A G+  L
Sbjct: 148 IRENTEGEY-----SGIEHVITPGVIQSIKLITREATERVVRYAFEYT----QAIGRPRL 198

Query: 199 TVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMVYRLFREPECFD--VI 256
            V HKS +   +DGLF +V + +       Y  I    +I+D  +  +  +PE +   V 
Sbjct: 199 LVIHKSTIQRMADGLFVKVAEEL----ASEYPDIKLETEIIDKSILNVVSKPELYSDAVS 254

Query: 257 VAPNLYGDILSDGAAAL-VGSLGVVPSANVGHDFIVGEPCHGSAPDIAGKGISNPIATIR 315
           V PNLYGDILSD  + L  GSLG+ PSAN+G    + E  HGSAPDIAG+  +NP A + 
Sbjct: 255 VCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPTALLL 314

Query: 316 STALMLEFMGYTEAAQDIHKAVDTNIRE-NQIKTPDLGGKSTTQQVVDDILSKM 368
           S+ +ML+ MG  E A  I  AV T I   ++ +T DL G ++T    ++++ ++
Sbjct: 315 SSVMMLKHMGLDEHANKIENAVLTTIASGSENRTADLSGTASTSSFTEEVIQRL 368

>TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2.278
           YNL037C
          Length = 376

 Score =  171 bits (432), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 123/372 (33%), Positives = 194/372 (52%), Gaps = 29/372 (7%)

Query: 3   RSTVSQFARRSYASAAKPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQAG 62
           + T+ +F  ++ +S     T+  I GDG+G E+  +    ++++ S  N+   +     G
Sbjct: 28  QPTIGRFTGKTNSSGT--YTVPFIEGDGVGPEISKS----VKDIFSAANVPIQWQPCDVG 81

Query: 63  WQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRP 122
              F++    +P+  ++ +K     AL G + +P  K  G+ S  + LRK   L+ANVRP
Sbjct: 82  -PIFVNGLTTIPEPAVKAIKESLV-ALKGPLATPVGK--GHRSLNLTLRKTFDLFANVRP 137

Query: 123 VKSVQG--TNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAK 180
            KSV    +    VD++++RENTE  Y     + I+      V ++IK I+  A+  + +
Sbjct: 138 AKSVPNYKSTYENVDLVLIRENTEGEY-----SGIEHIVTPGVVQSIKLITREASEKVIR 192

Query: 181 IALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVD 240
            A E ++    A G+  L V HKS +    DGLF ++   +    +  Y +I    QI+D
Sbjct: 193 YAYEYAI----AVGRPRLIVVHKSTIQRLGDGLFVQIANEL----QSEYPSIKLETQILD 244

Query: 241 SMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGHDFIVGEPCHG 297
           + V  +   P  +   V V PNLYGDILSD  + L  GSLG+ PSAN+G    + E  HG
Sbjct: 245 NTVLNVVSNPTLYKDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHG 304

Query: 298 SAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIREN-QIKTPDLGGKST 356
           SAPDIAG+  +NP A + S+ +ML  MG  E A  I  AV + I    + +T DLGG +T
Sbjct: 305 SAPDIAGQNKANPTALLLSSVMMLNHMGLEEHASRIENAVLSTIASGPESRTGDLGGSAT 364

Query: 357 TQQVVDDILSKM 368
           T    + ++ K+
Sbjct: 365 TSSFTECVIKKL 376

>TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {ON}
           Anc_2.278 YNL037C
          Length = 361

 Score =  170 bits (431), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 129/386 (33%), Positives = 194/386 (50%), Gaps = 46/386 (11%)

Query: 1   MLRSTVSQFARRSYASAAKPL--------TIGLIPGDGIGKEVIPAGKLVLENLSSKHNL 52
           MLRS V +    S A+A K L         + LIPGDG+GKEV  +   + E      NL
Sbjct: 1   MLRSAVGKRMFASVAAAEKVLPKKYGGRFVVTLIPGDGVGKEVTDSVVSIFE----AENL 56

Query: 53  KFNF-------IDLQAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSS 105
             ++       +D + G Q  +D+           LK +  G L G   +      G  S
Sbjct: 57  PIDWDRVDISGLDHEEGVQAAVDS-----------LKRNKIG-LKGIWHTSAADQAGKGS 104

Query: 106 PIVALRKKLGLYANVRPVKSVQGTNDR--PVDMIIVRENTEDLYIKTEKTYIDEKTGTRV 163
             VALRK+L +YANV   KSV G   +   VD++++RENTE  Y     + ++ ++   V
Sbjct: 105 LNVALRKELDIYANVALFKSVPGVKTKIPNVDLVVIRENTEGEY-----SGLEHESVPGV 159

Query: 164 AEAIKRISETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYE 223
            E++K ++E  T  IA+ A + +    K   +  +T  HK+N++   DGLFR V   V E
Sbjct: 160 VESLKIMTEDKTERIARFAFDFA----KKYNRHAVTAVHKANIMKLGDGLFRNVVTRVGE 215

Query: 224 SNKERYGAIGYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSA 283
              + Y  +     IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  A
Sbjct: 216 ---QEYPDVKVGSIIVDNASMQTVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGA 272

Query: 284 NVGHDFIVGEP-CHGSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIR 342
           N G ++ V EP       DI  K I+NP A I S +LML+ +G + +A  I  AV   I 
Sbjct: 273 NYGREYAVFEPGSRHVGLDIKDKNIANPTAMILSASLMLDHLGLSTSATKISNAVHQVIA 332

Query: 343 ENQIKTPDLGGKSTTQQVVDDILSKM 368
           E +  TPD+GG ++T +    ++ K+
Sbjct: 333 EGKSTTPDIGGSASTTEFTQAVIEKL 358

>SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037C IDH1 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 361

 Score =  169 bits (429), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 126/384 (32%), Positives = 196/384 (51%), Gaps = 42/384 (10%)

Query: 1   MLRSTVSQFARRSYASAAKP----------LTIGLIPGDGIGKEVIPAGKLVLENLSSKH 50
           M R+T +  ++RS A+ A             T+ LIPGDG+GKEV  +   + E      
Sbjct: 1   MFRNTFA-VSKRSLATVATEQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFE----AE 55

Query: 51  NLKFNFIDLQAGWQTFLDTGKALPD---ETIEILKSDCQGALFGAVQSPTNKVEGYSSPI 107
           N+  +       W+T   TG    +   + +E LK +  G L G   +P ++  G+ S  
Sbjct: 56  NVPID-------WETINITGVDSEEGVQKAVESLKRNKIG-LKGIWHTPADQT-GHGSLN 106

Query: 108 VALRKKLGLYANVRPVKSVQGTNDR--PVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAE 165
           VA RK+L ++ANV   K+V G   +   +D++++RENTE  Y     + ++ ++   V E
Sbjct: 107 VAFRKQLDIFANVALFKNVPGVKTKLSNIDLVVIRENTEGEY-----SGLEHESVPGVVE 161

Query: 166 AIKRISETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESN 225
           ++K I++  +  IA+ A + +L+    N + ++   HK+N++   DGLFR     V  S 
Sbjct: 162 SLKIITKAKSERIARFAFDFALK----NNRKSVCAVHKANIMKLGDGLFRNTVNEVGAS- 216

Query: 226 KERYGAIGYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANV 285
              Y  I     IVD+   +   +P  FDV+V PNLYG IL +  AAL+G  G+VP AN 
Sbjct: 217 --EYPEIDVKNIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGANF 274

Query: 286 GHDFIVGEP-CHGSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIREN 344
           G ++ V EP       DI GK ++NP A I S+ LML  +G    A  I KA    I E 
Sbjct: 275 GREYAVFEPGSRHVGLDIKGKDLANPTAMILSSTLMLRHLGLNGYADRISKATYDVIAEG 334

Query: 345 QIKTPDLGGKSTTQQVVDDILSKM 368
           +  T D+GG S+T +    ++ K+
Sbjct: 335 KHTTKDIGGSSSTTEFTKSVIDKL 358

>TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  169 bits (429), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 114/354 (32%), Positives = 191/354 (53%), Gaps = 27/354 (7%)

Query: 21  LTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQAGWQTFLDTGKALPDETIEI 80
            T+  I GDG+G E+  + K + +  +++  + + + D+       L T   +P+  ++ 
Sbjct: 41  FTVPFIEGDGVGPEISKSVKDIFK--AAQVPVDWEYCDVSPLLINGLTT---IPEPAVQQ 95

Query: 81  LKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVQG--TNDRPVDMII 138
           +    + AL G + +P  K  G+ S  + LRK  GL+ANVRP +S++G  T  + VD+++
Sbjct: 96  INKH-KIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVL 152

Query: 139 VRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEISLQRLKANGKATL 198
           +RENTE  Y     + I+      V ++IK I+  A+  + + A E +    +A G+  L
Sbjct: 153 IRENTEGEY-----SGIEHVVAPGVVQSIKLITRDASERVIRYAYEYA----RAIGRPRL 203

Query: 199 TVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMVYRLFREPECFD--VI 256
            V HKS +   +DGLF  + K +       +  I    +++D+ V  + R+P  +   V 
Sbjct: 204 VVVHKSTIQKLADGLFVNIAKEL----APEFPDIKLETELIDNTVLNVVRDPPSYTDAVT 259

Query: 257 VAPNLYGDILSDGAAAL-VGSLGVVPSANVGHDFIVGEPCHGSAPDIAGKGISNPIATIR 315
           V PNLYGDILSD  + L  GSLG+ PSAN+G++  + E  HGSAPDIAG+  +NP A + 
Sbjct: 260 VCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEVSIFEAVHGSAPDIAGQNKANPTALLL 319

Query: 316 STALMLEFMGYTEAAQDIHKAVDTNIRE-NQIKTPDLGGKSTTQQVVDDILSKM 368
           S+ +ML +MG    +  I  A+   I   ++ +T DL G +TT    + ++  +
Sbjct: 320 SSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373

>NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {ON}
           Anc_2.278
          Length = 359

 Score =  168 bits (426), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 113/355 (31%), Positives = 193/355 (54%), Gaps = 33/355 (9%)

Query: 21  LTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQAGWQTF----LDTGKALPDE 76
            T+ L+PGDG+GKE+  +    + ++    N+  +       W+T     LD  + +   
Sbjct: 28  FTVTLLPGDGVGKEITDS----VVSIFKSENVPID-------WETVDISGLDHTEGV-KA 75

Query: 77  TIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVQGTNDR--PV 134
            ++ LK +  G L G   +P ++V G+ S  VA RK+L +YANV   KS++G   +   V
Sbjct: 76  AVDSLKRNKIG-LKGIWHTPADQV-GHGSLNVAFRKQLDIYANVAIFKSIEGVKTKIPNV 133

Query: 135 DMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEISLQRLKANG 194
           D++++RENTE  Y     + ++ ++   V E++K I+++ +  IA+ A + +    K N 
Sbjct: 134 DLVVIRENTEGEY-----SGLEHESVPGVVESLKIITKSKSERIARFAFDFA----KRNN 184

Query: 195 KATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMVYRLFREPECFD 254
           + ++T  HK+N++  SDGLFR     + E   E Y  I  +  IVD+   +   +P  FD
Sbjct: 185 RKSVTAVHKANIMKLSDGLFRNTVSKIGE---EEYPEIQTSSIIVDNASMQAVAKPHQFD 241

Query: 255 VIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEP-CHGSAPDIAGKGISNPIAT 313
           V+V P++YG I+ +  AAL+G  G+VP  N G D+ V EP       DI G+ ++NP A 
Sbjct: 242 VMVTPSMYGTIVGNIGAALIGGPGLVPGVNYGRDYAVFEPGSRHVGLDIKGQNVANPTAM 301

Query: 314 IRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQQVVDDILSKM 368
           + S  L+L+ +G  ++A  I  AV   I E +  T D+GG ++T +    +++K+
Sbjct: 302 LLSATLLLDHLGLEKSANRIKSAVYDVIAEGKATTQDIGGSASTTEFTQAVINKL 356

>Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON}
           (32084..33190) [1107 nt, 369 aa]
          Length = 368

 Score =  168 bits (426), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 126/389 (32%), Positives = 201/389 (51%), Gaps = 42/389 (10%)

Query: 1   MLRSTVSQ--FARR---------SYASAAKPLT----IGLIPGDGIGKEVIPAGKLVLEN 45
           MLR+T+ +  FAR           +     P+T    +  I GDG+G E+  + K +   
Sbjct: 1   MLRNTIYRGSFARMMTTGQPNIGRFTGKPNPVTGKYTVPFIEGDGVGPEISKSVKDIFA- 59

Query: 46  LSSKHNLKFNFIDLQAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSS 105
            ++K  +++   D+      F++    +PD  ++ +      AL G + +P  K  G+ S
Sbjct: 60  -AAKVPIEWEPCDV---GPIFVNGLTTIPDAAVQSINKHLV-ALKGPLATPIGK--GHRS 112

Query: 106 PIVALRKKLGLYANVRPVKSVQG--TNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRV 163
             + LRK   L+ANVRP +SV    T  + VD++++RENTE  Y     + I+      V
Sbjct: 113 LNLTLRKTFNLFANVRPARSVPNYKTTYQNVDLVLIRENTEGEY-----SGIEHVISPGV 167

Query: 164 AEAIKRISETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYE 223
            ++IK I++ A+  + + A E +    +A G+  L V HKS +   +DGLF  V K +  
Sbjct: 168 IQSIKLITKDASERVIRYAFEYT----RAIGRPRLVVVHKSTIQRMADGLFVNVAKEL-- 221

Query: 224 SNKERYGAIGYNEQIVDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL-VGSLGVV 280
                Y  I    +++D+ +  +   PE +   V V PNLYGDILSD  + L  GSLG+ 
Sbjct: 222 --ASEYPDIELQTELIDNTILNVVTHPESYTDAVSVCPNLYGDILSDLNSGLSAGSLGLT 279

Query: 281 PSANVGHDFIVGEPCHGSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTN 340
           PSAN+G    + E  HGSAPDIAG+  +NP A + S+ +ML  MG  E A  I  A+ + 
Sbjct: 280 PSANIGDKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLNEHATKIENAILST 339

Query: 341 IRE-NQIKTPDLGGKSTTQQVVDDILSKM 368
           I   ++ +T DL G +TT    + +++K+
Sbjct: 340 IASGSENRTGDLAGTATTSSFTEAVINKL 368

>ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  168 bits (425), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 120/352 (34%), Positives = 188/352 (53%), Gaps = 27/352 (7%)

Query: 23  IGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQAGWQTFLDTGKALPDETIEILK 82
           +  I GDGIG E+  + K +    ++K  + F  + ++      ++   ++P+E  + + 
Sbjct: 38  VSFIEGDGIGPEISKSVKDIFA--AAKVPVDFESVVVKP---ILVNGVTSIPEEAQKSIN 92

Query: 83  SDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVQG--TNDRPVDMIIVR 140
           ++   AL G + +P  K  G+ S  + LRK  GL+AN+RP KSV+G  T    V+++++R
Sbjct: 93  TNLV-ALKGPLATPVGK--GHRSMNLTLRKTFGLFANLRPAKSVEGFKTIYDNVNLVLIR 149

Query: 141 ENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEISLQRLKANGKATLTV 200
           ENTE  Y   E   +       V ++IK I+  A+  + + A E +    +A  +  L V
Sbjct: 150 ENTEGEYAGIEHAIV-----PGVVQSIKLITREASERVIRFAYEYA----RAAERPRLIV 200

Query: 201 THKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMVYRLFREPECFD--VIVA 258
            HKS +   SDGLF +V K +    +  +  I    +++D+ V     +P  +   V V 
Sbjct: 201 VHKSTIQRLSDGLFVDVAKEL----QSEFPDIKLETELIDNAVLNTVTDPTKYSDAVSVC 256

Query: 259 PNLYGDILSDGAAAL-VGSLGVVPSANVGHDFIVGEPCHGSAPDIAGKGISNPIATIRST 317
           PNLYGDILSD  + L  GSLG+ PS N+GH   + E  HGSAPDIAGK  +NP A + S+
Sbjct: 257 PNLYGDILSDMNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSS 316

Query: 318 ALMLEFMGYTEAAQDIHKAVDTNIREN-QIKTPDLGGKSTTQQVVDDILSKM 368
            +ML  MG  E A  I KAV T I    + +T DL G ++T    + ++ K+
Sbjct: 317 VMMLHHMGLHEHASQIEKAVLTTIAAGPESRTGDLKGSASTSSFTEAVIKKL 368

>NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa]
           {ON} Anc_2.278
          Length = 359

 Score =  164 bits (416), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 114/355 (32%), Positives = 191/355 (53%), Gaps = 34/355 (9%)

Query: 21  LTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQAGWQTF----LDTGKALPDE 76
           +T+ L+PGDG+GKE+  +    + ++    N+  +       W+T     LD    + + 
Sbjct: 29  MTVTLLPGDGVGKEITDS----VVSIFQAENVPID-------WETVDISQLDHEDGV-NA 76

Query: 77  TIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVQGTNDR--PV 134
            +E LK +  G L G   +  ++V G+ S  VA RK+L +YANV   KS+ G   +   V
Sbjct: 77  AVESLKRNKIG-LKGIWHTSADQV-GHGSLNVAFRKQLDIYANVAFCKSIPGVKTKIPNV 134

Query: 135 DMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEISLQRLKANG 194
           D++I+RENTE  Y     + ++ ++   V E++K +++  +  IAK A + +++    + 
Sbjct: 135 DLVIIRENTEGEY-----SGLEHESVPGVVESLKIVTKVNSERIAKFAFDFAMR----HD 185

Query: 195 KATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMVYRLFREPECFD 254
           +  +T  HK+N++  SDGLFR     V E+    Y  I  +  IVD+   +   +P  FD
Sbjct: 186 RKMVTAVHKANIMKLSDGLFRNTVARVGEA----YPQIKNDSIIVDNASMQAVAKPHQFD 241

Query: 255 VIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEP-CHGSAPDIAGKGISNPIAT 313
           V+V P++YG IL +  AAL+G  G+VP  N G ++ V EP       DI G+ ++NP A 
Sbjct: 242 VMVTPSMYGTILGNIGAALIGGPGLVPGVNYGREYAVFEPGSRHVGLDIKGQNVANPTAM 301

Query: 314 IRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQQVVDDILSKM 368
           I S+ L+L+ +G  + A  I KAV   I+E    T D+GG ++T +    ++ K+
Sbjct: 302 ILSSTLLLQHLGLNDTASRISKAVYDVIKEGNATTKDIGGNASTTEFTKAVIDKL 356

>KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {ON}
           Anc_2.278 YNL037C
          Length = 350

 Score =  161 bits (407), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 119/377 (31%), Positives = 193/377 (51%), Gaps = 45/377 (11%)

Query: 1   MLRSTVSQFARRSYASAAKPLTIGLIPGDGIGKEVIPAGKLVL--ENLSSKHNLKFNFID 58
           +LR ++S  + + Y        I LIPG+GIGKEV  + + +   ENL     + +  ++
Sbjct: 6   LLRRSISTISPKKYGGR---FQITLIPGNGIGKEVTDSVRSIFQAENLP----IDWEIVN 58

Query: 59  LQA---GWQTFLDTGKALPDETIEILKSD-CQGALFGAVQSPTNKVEGYSSPIVALRKKL 114
           +++   G +T +D+ K        I  SD   G+L                  VALRK+L
Sbjct: 59  IESHRDGIKTAVDSIKRNKIALKGIWSSDPIDGSLN-----------------VALRKQL 101

Query: 115 GLYANVRPVKSVQGTNDR--PVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISE 172
            ++ANV   KS    N R   VD++++RENTE  +   E   +D      V E++K +++
Sbjct: 102 DIFANVAIFKSFDNVNTRIPNVDLVVIRENTEGEFSGLEHESVDG-----VVESLKIVTK 156

Query: 173 TATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAI 232
             T  IA+ A + +    K + +  +T  HK+N++   DGLF+ +  ++   N E Y  I
Sbjct: 157 PKTERIARFAFDFA----KKHNRNHVTAVHKANIMKLGDGLFKNIVAHI--GNNE-YPEI 209

Query: 233 GYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVG 292
             +  IVD+   +   +P  FDV+V+P++YG IL +  AAL+G  G+VP AN G D+ V 
Sbjct: 210 KNSSIIVDNASMQAVAKPHQFDVLVSPSMYGTILGNIGAALIGGPGLVPGANFGRDYAVF 269

Query: 293 EP-CHGSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDL 351
           EP       DI G+ ++NP A I S   ML  +G T  A+ I  AV   I +    T D+
Sbjct: 270 EPGSRHVGLDIKGQNVANPTAMILSATWMLRHLGLTSPAERITNAVKHVIAQGTTVTKDI 329

Query: 352 GGKSTTQQVVDDILSKM 368
           GG ++T +  D +++++
Sbjct: 330 GGTASTTEFTDAVINEL 346

>TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {ON}
           Anc_5.473 YOR136W
          Length = 377

 Score =  160 bits (406), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 112/353 (31%), Positives = 187/353 (52%), Gaps = 28/353 (7%)

Query: 22  TIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQAGWQTFLDTGKALPDETIEIL 81
           T+  I GDG+G E+  + + + +       +  ++++   G    ++    +P   ++ +
Sbjct: 46  TVPFIEGDGVGPEISKSVRTIFK----AAKVPIDWVNCDIG-PLLINGETTIPQTAVDQI 100

Query: 82  KSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVQ--GTNDRPVDMIIV 139
            +    AL G + +P    +G+ S  + LRK  GL+ANVRP KS+    +    VD+I++
Sbjct: 101 NNSLI-ALKGPLATPVG--QGHRSINLTLRKTFGLFANVRPAKSIPNLASTYENVDLIVI 157

Query: 140 RENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEISLQRLKANGKATLT 199
           RENTE  Y     + I+ +    V ++IK I+  A+  + K A E +    ++ G++ L 
Sbjct: 158 RENTEGEY-----SGIEHEIVPGVVQSIKLITRKASEKVIKYAFEYT----RSIGRSNLI 208

Query: 200 VTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMVYRLFREPECF--DVIV 257
           V HK+ +  + DGLF +  + +     ++Y  +    +++D+ V      PE +   V V
Sbjct: 209 VVHKATIQRRGDGLFVQTAQEM----ADKYPDVNLKLELIDNTVLNCIMNPEKYADSVSV 264

Query: 258 APNLYGDILSDGAAAL-VGSLGVVPSANVGHDFIVGEPCHGSAPDIAGKGISNPIATIRS 316
            PNLYGDILSD  + L  GSLG+ PSAN+G + ++ E  HGSAPDIAG+  +NP A + S
Sbjct: 265 CPNLYGDILSDLNSGLSTGSLGLTPSANIG-ETVLYEAVHGSAPDIAGQDKANPTALLLS 323

Query: 317 TALMLEFMGYTEAAQDIHKAVDTNIRE-NQIKTPDLGGKSTTQQVVDDILSKM 368
           + +ML  MG  + A  I  AV T I    + +T DLGG +TT      ++  +
Sbjct: 324 SVMMLNHMGLQKYADMIETAVLTTITSGKEFRTADLGGSATTTSFTKAVIENL 376

>CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037c IDH1 or uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2
          Length = 358

 Score =  159 bits (403), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 116/374 (31%), Positives = 190/374 (50%), Gaps = 41/374 (10%)

Query: 11  RRSYASAAKPL----------TIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQ 60
           RR  AS AK L          T+ LIPGDG+GKE+  +   + E             ++ 
Sbjct: 7   RRGMASMAKELVLPKKYGGRYTVTLIPGDGVGKEITDSVVSIFEAE-----------NIP 55

Query: 61  AGWQTF-LDTGKALPD--ETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117
             W+   + T   + D  + +E LK +  G     +   +  +  + S  VALRK+L ++
Sbjct: 56  VDWERVDISTSDNIQDVSQAVESLKRNKIG--LKGIWHTSADIADHGSFNVALRKQLDMF 113

Query: 118 ANVRPVKSVQGTNDR--PVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETAT 175
           A+V   KSV G   +   VD++++RENTE  Y     + ++ ++   V E++K I++  +
Sbjct: 114 AHVAFFKSVPGVKTKIPNVDLVVIRENTEGEY-----SGLEHESVPGVVESLKIITKAKS 168

Query: 176 TDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYN 235
             IA+ A + +    K   + ++   HK+N++   DGLFR     V E     Y  I  +
Sbjct: 169 ERIARFAFDFA----KKYNRKSVCAVHKANIMKMGDGLFR---NTVTEIGANEYPDIQTS 221

Query: 236 EQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEP- 294
             IVD+   +   +P  FDV+V P++YG I+ +  AAL+G  G+V  A+ G +  V EP 
Sbjct: 222 SIIVDNASMQAVAKPHQFDVMVTPSMYGTIIGNIGAALIGGPGLVAGAHYGREHAVFEPG 281

Query: 295 CHGSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGK 354
                 DI GK ++NP A I S+ LML+ +G TE+A+ I KA    I   Q+ T D+GG 
Sbjct: 282 SQHVGLDIKGKNVANPTAMILSSTLMLQHLGLTESAKRIAKATHDVISLGQVTTKDIGGS 341

Query: 355 STTQQVVDDILSKM 368
           ++T +  + I+ ++
Sbjct: 342 ASTTEFTEAIIKRL 355

>KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score =  159 bits (403), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 120/383 (31%), Positives = 191/383 (49%), Gaps = 42/383 (10%)

Query: 1   MLRSTVSQFARRSYASAAKPL---------TIGLIPGDGIGKEVIPAGKLVLENLSSKHN 51
           MLR  VS   +RS A+  + L         T+ L+PGDG+GKE   +   V         
Sbjct: 1   MLRRLVS---KRSLATLPETLFPNKYGGRYTVTLLPGDGVGKECTDSVVSV--------- 48

Query: 52  LKFNFIDLQAGWQTFLDTG---KALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIV 108
             FN  ++   W+    +G   K      ++ L+ +  G L G   +      G+ S  V
Sbjct: 49  --FNAENIPIDWEIVNISGLDHKEGVAAAVQSLRRNKIG-LKGLWHTSNADQSGHGSLNV 105

Query: 109 ALRKKLGLYANVRPVKSVQGTNDR--PVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEA 166
           A RK+L +YANV   KS++G       VD++++RENTE  +   E   ++      V E+
Sbjct: 106 AFRKQLDIYANVAVFKSLKGVKTMIPDVDLVVIRENTEGEFSGLEHESVEG-----VVES 160

Query: 167 IKRISETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNK 226
           +K  +   T  IA+ A   +    + NG+  +   HK+N++   DGLFR    ++ E   
Sbjct: 161 LKVTTLPKTERIARFAFNYA----QKNGRKAVCAVHKANIMKLGDGLFRNTVTSIGE--- 213

Query: 227 ERYGAIGYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG 286
           + Y  I  +  IVD+   +   +P  FDV+V P++YG I+ +  AAL+G  G+V  AN G
Sbjct: 214 KEYPDIETSSIIVDNASMQAVAKPHQFDVLVTPSMYGTIIGNIGAALIGGPGLVAGANFG 273

Query: 287 HDFIVGEP-CHGSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQ 345
            ++ V EP       DI G+ I+NP A + S+ALML  +G T++ + I  AV   I E  
Sbjct: 274 REYAVFEPGSRHVGLDIKGQNIANPTAMLLSSALMLNHLGLTKSGKRISDAVREVIAEGD 333

Query: 346 IKTPDLGGKSTTQQVVDDILSKM 368
           ++T D+GG +TT +    ++ K+
Sbjct: 334 VRTKDIGGDATTTEFTQAVIEKL 356

>TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score =  158 bits (399), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 116/354 (32%), Positives = 187/354 (52%), Gaps = 33/354 (9%)

Query: 22  TIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQAGWQTFLDTGKALPDETIEI- 80
           T+ LIPGDG+GKEV  +   +           FN  +L   W+  +D      +E +E  
Sbjct: 35  TVTLIPGDGVGKEVTDSVVSI-----------FNAENLPIDWER-VDISGLDHEEGVEAA 82

Query: 81  ---LKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVQGTNDR--PVD 135
              LK +  G L G   +   + + + S  VALRK+L +YANV   K++ G   R   VD
Sbjct: 83  VNSLKRNKIG-LKGIWHTSAGQSD-HGSLNVALRKQLDIYANVAHFKTLPGVKTRIPDVD 140

Query: 136 MIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEISLQRLKANGK 195
           ++I+RENTE  Y     + ++ ++   V E++K I++  +  IA+ A + +    K   +
Sbjct: 141 LVIIRENTEGEY-----SGLEHESVPGVVESLKIITKEKSERIARFAFDFA----KRFDR 191

Query: 196 ATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMVYRLFREPECFDV 255
             +T  HK+N++   DGLFR    ++ E+    Y  I  +  IVD+   +   +P  FDV
Sbjct: 192 KLVTAVHKANIMKLGDGLFRNSVTSIGET---EYPDIKVSSIIVDNASMQSVAKPHQFDV 248

Query: 256 IVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEP-CHGSAPDIAGKGISNPIATI 314
           +V P++YG IL +  AAL+G  G+VP AN G +  V EP       DI G+ ++NP A I
Sbjct: 249 LVTPSMYGTILGNIGAALIGGPGLVPGANYGTECAVFEPGSRHVGLDIKGQNVANPTAMI 308

Query: 315 RSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQQVVDDILSKM 368
            S+ L+L+ +G    A+ I  AV   I E ++ T D+GG ++T +  ++I+ K+
Sbjct: 309 LSSTLLLKHLGLNNEAKKIEDAVYKTIAEGKVTTRDIGGSASTTEFTNEIIKKL 362

>ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} similar
           to uniprot|P28834 Saccharomyces cerevisiae YNL037C IDH1
           Subunit of mitochondrial NAD( )-dependent isocitrate
           dehydrogenase which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 361

 Score =  154 bits (388), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 118/381 (30%), Positives = 196/381 (51%), Gaps = 36/381 (9%)

Query: 1   MLRSTVSQFARRSYASAAKPL--------TIGLIPGDGIGKEVIPAGKLVL--ENLSSKH 50
           M R ++++    + A+  K L        T+ LIPGDG+GKEV  +   +   EN+    
Sbjct: 1   MFRHSLTKRTLATVATTEKMLPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFKAENVP--- 57

Query: 51  NLKFNFIDLQAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVAL 110
            + ++ +D+ +G     D   A     +E LK +  G L G   +      G+ S  VAL
Sbjct: 58  -VDWDRVDI-SGVDRAEDVKSA-----VESLKRNRIG-LKGIWHTSPADQAGHGSLNVAL 109

Query: 111 RKKLGLYANVRPVKSVQGTNDR--PVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIK 168
           RK+L +YANV   KS+ G   +   VD++++RENTE      E + ++ ++   V E++K
Sbjct: 110 RKELDIYANVARFKSIPGVQVKIPDVDLVVIRENTEG-----EFSGLEHESVPGVVESLK 164

Query: 169 RISETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKER 228
            +++     IA+ A + +    K N +  +   HK+N++   DGLF+ + + V E   + 
Sbjct: 165 IMTQDNIERIARFAFDYA----KKNDRKQVVAVHKANIMKMGDGLFKNLVQEVGE---KE 217

Query: 229 YGAIGYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD 288
           Y  +     IVD+   +    P  FDV+V P++YG IL +  AAL+G  G+V  AN G D
Sbjct: 218 YPELQVGNIIVDNASMQTVANPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANYGRD 277

Query: 289 FIVGEP-CHGSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIK 347
             + EP       DI G+ ++NP A I S+ L+L  +G   +A  I KAV   I E +  
Sbjct: 278 VALFEPGSRHVGLDIKGQNVANPTAMILSSVLLLNHLGLNTSADRISKAVHAVIAEGKSV 337

Query: 348 TPDLGGKSTTQQVVDDILSKM 368
           T D+GG ++T +  + +++K+
Sbjct: 338 TRDIGGTASTTEFTEAVINKL 358

>TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON}
           Anc_1.402 YCL018W
          Length = 362

 Score =  151 bits (382), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 122/364 (33%), Positives = 186/364 (51%), Gaps = 37/364 (10%)

Query: 23  IGLIPGDGIGKEVIPAGKLVLENLSS-KHNLKFNFIDLQAGWQTFLDTGKALPDETIEIL 81
           I ++PGD +G+E+      VL+ +S  + N  FNF     G      TG  LPDE +E  
Sbjct: 5   IVVLPGDHVGQEITEEAIKVLKAISEVRPNATFNFQHHLIGGAAIDATGVPLPDEALEAS 64

Query: 82  KSDCQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRP----------VKSVQG 128
           K      L GAV  P     G   P   ++ +RK+L LYAN+RP          +  ++ 
Sbjct: 65  KK-ADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASDSLLELSPLKA 122

Query: 129 TNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEISLQ 188
              +  D ++VRE    +Y    K    E  G  VA   ++ S      I ++A  ++LQ
Sbjct: 123 QYAQGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEQYSVPEVQRITRMAAFLALQ 178

Query: 189 RLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMVYRLFR 248
               N    +    K+NVL+ S  L+R   K V ++ KE +  +  N Q++DS    L +
Sbjct: 179 H---NPPLPIWSLDKANVLASSR-LWR---KTVEKTIKEEFPTLSVNHQLIDSAAMILVK 231

Query: 249 EPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGH------DFIVGEPCHGSAPD 301
            P   + +I+  N++GDI+SD A+ + GSLG++PSA++         F + EPCHGSAPD
Sbjct: 232 NPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPD 291

Query: 302 IAGKGISNPIATIRSTALMLEF-MGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQQV 360
           +A KG  NP+ATI S A+ML+  +   E    I KAV   + ++ I+T DLGG ++T +V
Sbjct: 292 LA-KGKVNPVATILSAAMMLKLSLNMVEEGVAIEKAV-KKVLDDGIRTGDLGGSNSTSEV 349

Query: 361 VDDI 364
            D +
Sbjct: 350 GDAV 353

>TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score =  150 bits (379), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 118/369 (31%), Positives = 187/369 (50%), Gaps = 38/369 (10%)

Query: 22  TIGLIPGDGIGKEVIPAGKLVLENLSSK-HNLKFNFIDLQAGWQTFLDTGKALPDETIEI 80
            I ++PGD +G+E++     VL+ +  K H +KFNF     G      TG  LPDET+E 
Sbjct: 6   NIVVLPGDHVGQEIVEEAVKVLKIVEEKRHGVKFNFQYHLIGGDAIDKTGDPLPDETLEA 65

Query: 81  LKSDCQGALFGAVQSP---TNKVEGYSSPIVALRKKLGLYANVRPVKSVQ----GTND-- 131
            K      L GAV  P   T KV      ++ +RK+LGLY N+RP K +     G +   
Sbjct: 66  AKQ-SDAVLLGAVGGPKWGTGKVRPEQG-LLKIRKELGLYGNLRPCKFISDKLIGLSPLK 123

Query: 132 ----RPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEISL 187
               +  D ++VRE    +Y    +    E  G+ VA   ++ S      I K+A  +SL
Sbjct: 124 EEVCKGTDFVVVRELVGGIYFGERQ----EDDGSGVAWDSEKYSIEEVKRITKMAAFLSL 179

Query: 188 QRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMVYRLF 247
           Q    +    +    K+NVL+ S      + +   +     +  +    Q++DS    L 
Sbjct: 180 QN---DPPLPIWSLDKANVLASS-----RLWRAAVDETIAEFPNLKVQHQLIDSAAMMLV 231

Query: 248 REPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG------HDFIVGEPCHGSAP 300
           + P   + +I+  N++GDI+SD A+ + GSLG++PSA++         F + EPCHGSAP
Sbjct: 232 KNPTQLNGIILTNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNKAFGLYEPCHGSAP 291

Query: 301 DIAGKGISNPIATIRSTALMLEF-MGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQQ 359
           D+A +G  NP+ATI S A+ML+  +   +  + I +AV   + +  I+T DLGG STT +
Sbjct: 292 DLA-RGKVNPVATILSAAMMLKLSLDMVQEGEAIERAVSV-VLDRGIRTADLGGNSTTSE 349

Query: 360 VVDDILSKM 368
           + D +  ++
Sbjct: 350 LGDAVAQEL 358

>KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 362

 Score =  148 bits (374), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 120/364 (32%), Positives = 185/364 (50%), Gaps = 37/364 (10%)

Query: 23  IGLIPGDGIGKEVIPAGKLVLENLSS-KHNLKFNFIDLQAGWQTFLDTGKALPDETIEIL 81
           I ++PGD +GKEV      VL  ++  +  +KFNF     G      TG  LPDE +E  
Sbjct: 5   IVVLPGDHVGKEVTDEAIKVLNAIAEVRPEIKFNFQHHLIGGAAIDATGTPLPDEALEAS 64

Query: 82  KSDCQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRP----------VKSVQG 128
           K      L GAV  P     G   P   ++ +RK+LGLYAN+RP          +  ++ 
Sbjct: 65  KK-ADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASDSLLDLSPLKP 122

Query: 129 TNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEISLQ 188
              +  D ++VRE    +Y    K    E  G  VA   ++ S      I ++A  ++LQ
Sbjct: 123 EYAKGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMAAFLALQ 178

Query: 189 RLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMVYRLFR 248
           +   N    +    K+NVL+ S  L+R   K V E+ K  +  +    Q++DS    L +
Sbjct: 179 Q---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKTEFPQLTVQHQLIDSAAMILVK 231

Query: 249 EPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG------HDFIVGEPCHGSAPD 301
            P   + V++  N++GDI+SD A+ + GSLG++PSA++         F + EPCHGSAPD
Sbjct: 232 SPTKLNGVVITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNKAFGLYEPCHGSAPD 291

Query: 302 IAGKGISNPIATIRSTALMLEF-MGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQQV 360
           +    + NPIATI S A+ML+  +   E  + + +AV  N+ +  ++T DLGG ++T +V
Sbjct: 292 LPANKV-NPIATILSAAMMLKLSLDLVEEGRALEEAV-RNVLDAGVRTGDLGGSNSTTEV 349

Query: 361 VDDI 364
            D I
Sbjct: 350 GDAI 353

>Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar to
           Ashbya gossypii AAL012C
          Length = 363

 Score =  148 bits (373), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 122/362 (33%), Positives = 190/362 (52%), Gaps = 37/362 (10%)

Query: 25  LIPGDGIGKEVIPAGKLVLENLS-SKHNLKFNFIDLQAGWQTFLDTGKALPDETIEILKS 83
           ++PGD IG+EVI     VL  +  ++ ++ F F     G      TG  L D+TIE  K+
Sbjct: 9   VLPGDYIGQEVIAETIKVLNAIQEARPSINFEFEYHLIGGAAINATGAPLSDKTIEAAKA 68

Query: 84  DCQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRPV----KSVQGTND-RP-- 133
                L GAV  P     G   P   ++A+RK+LGLYAN+RP     KS+ G +  +P  
Sbjct: 69  -ADAVLLGAVGGPEWD-SGAVRPEQGLLAIRKELGLYANLRPCSFISKSLLGLSPLKPEI 126

Query: 134 ---VDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEISLQRL 190
               D +I+RE    +Y    K    E  G  VA   ++ + +    I ++   ++LQ  
Sbjct: 127 AQGTDFVILRELVGGIYFGERK----EDDGDGVAWDSEKYTVSEVERITRMGAFLALQH- 181

Query: 191 KANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMVYRLFREP 250
             +    L    K+NVL+ S  L+R   + V E+ K  +  +    Q++DS    + + P
Sbjct: 182 --DPPLPLWSFDKANVLASSR-LWR---RTVNETIKREFPQLSVQHQLIDSAAMIMIKNP 235

Query: 251 ECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD------FIVGEPCHGSAPDIA 303
             F+ +++  N++GDI+SD A+ + GSLG++PSA++  +      F + EPCHGSAPD+ 
Sbjct: 236 RKFNGIVITSNIFGDIISDAASVIPGSLGLLPSASLASEPDKNNAFGLYEPCHGSAPDLE 295

Query: 304 GKGISNPIATIRSTALMLEF-MGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQQVVD 362
            KG +NPIA I S A+ML+  +   +  + I  AV   I E+ I+T DLGG +TT +V D
Sbjct: 296 -KGQANPIACILSAAMMLKLSLNMVDEGKAIENAVKQVI-ESGIRTGDLGGNNTTTEVGD 353

Query: 363 DI 364
            +
Sbjct: 354 AV 355

>KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 364

 Score =  147 bits (372), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 120/367 (32%), Positives = 187/367 (50%), Gaps = 37/367 (10%)

Query: 20  PLTIGLIPGDGIGKEVIPAGKLVLENLSS-KHNLKFNFIDLQAGWQTFLDTGKALPDETI 78
           P  I ++PGD +G+E+      VL+ +S  + ++KF F     G      TG+ LPD ++
Sbjct: 4   PKKIVVLPGDHVGQEITDEAIKVLKAISEVRSSVKFEFQQHLIGGAAIDATGEPLPDASL 63

Query: 79  EILKSDCQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRP----------VKS 125
           E  K      L GAV  P     G   P   ++ +RK+L LYAN+RP          +  
Sbjct: 64  EAAKK-ADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSP 121

Query: 126 VQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEI 185
           ++  + R  D ++VRE    +Y    K    E  G  VA   ++ S      I ++A  +
Sbjct: 122 LKAEHARGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMAAFL 177

Query: 186 SLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMVYR 245
           +LQ    N    +    K+NVL+ S  L+R   K V E+ K  +  +    Q++DS    
Sbjct: 178 ALQH---NPPLPVWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMI 230

Query: 246 LFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGH------DFIVGEPCHGS 298
           + + P   + VI+  N++GDI+SD A+ + GSLG++PSA++         F + EPCHGS
Sbjct: 231 MVKNPTQLNGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGS 290

Query: 299 APDIAGKGISNPIATIRSTALMLEF-MGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTT 357
           APD+  KG  NPIATI S A+MLE  +   E    + +AV   + ++ I+T DL G ++T
Sbjct: 291 APDLE-KGKVNPIATILSAAMMLELSLDMFEEGTAVEEAV-RRVLDSGIRTGDLRGSNST 348

Query: 358 QQVVDDI 364
           Q+V D +
Sbjct: 349 QEVGDAV 355

>Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C
           (REAL)
          Length = 300

 Score =  142 bits (358), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 108/327 (33%), Positives = 171/327 (52%), Gaps = 45/327 (13%)

Query: 1   MLRSTVSQFARRSYASAAK-----------PLTIGLIPGDGIGKEVIPAGKLVLENLSSK 49
           ML  T+   A+RS A+AA+             T+ LIPGDG+GKEV  + K + E     
Sbjct: 1   MLNRTI---AKRSLATAAQVEHILPKKYGGRFTVTLIPGDGVGKEVTDSVKTIFE----A 53

Query: 50  HNLKFNFIDLQAGWQTF---LDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSP 106
            N+  +       W+T        K   +E +E L+ +  G L G   +P ++  G+ S 
Sbjct: 54  ENIPID-------WETINIKQTDHKEGVNEAVESLRRNKIG-LKGLWHTPADQT-GHGSL 104

Query: 107 IVALRKKLGLYANVRPVKSVQGTNDR--PVDMIIVRENTEDLYIKTEKTYIDEKTGTRVA 164
            VALRK+L +YANV   KS++G   R   +D+I++RENTE      E + ++ ++   V 
Sbjct: 105 NVALRKQLDIYANVALFKSLKGVKTRIPDIDLIVIRENTEG-----EFSGLEHESVPGVV 159

Query: 165 EAIKRISETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYES 224
           E++K +++  T  IA+ A + +    K   +  +T  HK+N++   DGLFR +   + E 
Sbjct: 160 ESLKIMTKPKTERIARFAFDFA----KKYNRKAVTAVHKANIMKLGDGLFRNI---ITEI 212

Query: 225 NKERYGAIGYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSAN 284
            ++ Y  I  +  IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN
Sbjct: 213 GQKEYPDIDVSSIIVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGAN 272

Query: 285 VGHDFIVGEP-CHGSAPDIAGKGISNP 310
            G D+ V EP       DI G+ ++NP
Sbjct: 273 FGRDYAVFEPGSRHVGLDIKGQNVANP 299

>NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa]
           {ON} Anc_1.402
          Length = 363

 Score =  144 bits (362), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 123/364 (33%), Positives = 187/364 (51%), Gaps = 37/364 (10%)

Query: 23  IGLIPGDGIGKEVIPAGKLVLENLSSKHN-LKFNFIDLQAGWQTFLDTGKALPDETIEIL 81
           I ++PGD +G+E+      VL+ ++   N + F+F     G      TG  LPDE +E  
Sbjct: 6   IVVLPGDHVGEEITAEAVKVLKAIAEVDNSINFDFQYHLIGGAAIDATGVPLPDEALEAS 65

Query: 82  KSDCQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRPV----KSVQGTND-RP 133
           K +    L GAV  P     G   P   ++ +RK+LGLYAN+RP     +S+ G +  RP
Sbjct: 66  K-NSDAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASESLLGLSPLRP 123

Query: 134 -----VDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEISLQ 188
                 D ++VRE    +Y    K    E  G  VA   ++ S      I ++A  ++LQ
Sbjct: 124 EIAKGTDFMVVRELVGGIYFGKRK----EDEGDGVAWDSEQYSVPEVQRITRMAAFLALQ 179

Query: 189 RLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMVYRLFR 248
               N    +    K+NVL+ S  L+R   K V E+ K  +  +    Q++DS    L +
Sbjct: 180 H---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQNQLIDSAAMILVK 232

Query: 249 EPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGH------DFIVGEPCHGSAPD 301
            P   + +I+  N++GDI+SD A+ + GSLG++PSA++         F + EPCHGSAPD
Sbjct: 233 NPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPD 292

Query: 302 IAGKGISNPIATIRSTALMLEF-MGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQQV 360
           +  KG  NPIATI S A+ML+  +   +    I +AV   + +  I+T DLGG ++T +V
Sbjct: 293 LP-KGKVNPIATILSAAMMLKLSLNLVKQGDAIEEAV-KKVLDAGIRTGDLGGSNSTTEV 350

Query: 361 VDDI 364
            D I
Sbjct: 351 GDAI 354

>KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {ON}
           Anc_1.402 YCL018W
          Length = 447

 Score =  145 bits (365), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 124/369 (33%), Positives = 187/369 (50%), Gaps = 47/369 (12%)

Query: 23  IGLIPGDGIGKEVIPAGKLVLENLSS-KHNLKFNFIDLQAGWQTFLDTGKALPDETIEIL 81
           I ++PGD +G+E+      VL  +SS + N+ F+F     G      TG  LPDE +E  
Sbjct: 90  IVVLPGDHVGQEITEEAIKVLNAISSVRPNVNFDFQHHLIGGAAIDATGVPLPDEALEAS 149

Query: 82  KSDCQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRPV--------------- 123
           K      L GAV  P     G   P   ++ +RK+L LYAN+RP                
Sbjct: 150 KK-ADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPLKP 207

Query: 124 KSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIAL 183
           + V+GT     D+ IVRE    +Y    K    E  G  VA   ++ S +    I ++A 
Sbjct: 208 EIVKGT-----DICIVRELVGGIYFGERK----EDEGDGVAWDSEKYSVSEVQRITRMAG 258

Query: 184 EISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMV 243
            ++LQ    N    +    K+NVL+ S  L+R   K V E+ K  +  +    Q++DS  
Sbjct: 259 FLALQH---NPPLPVWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAA 311

Query: 244 YRLFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGH------DFIVGEPCH 296
             L + P   + V++A N++GDI+SD A+ + GSLG++PSA++         F + EPCH
Sbjct: 312 MILVKNPTHLNGVVIANNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCH 371

Query: 297 GSAPDIAGKGISNPIATIRSTALMLEF-MGYTEAAQDIHKAVDTNIRENQIKTPDLGGKS 355
           GSAPD+  KG  NP+ATI S A+ML+  +  TE    + KAV   + ++ ++T DL G +
Sbjct: 372 GSAPDLP-KGKVNPVATILSVAMMLKLSLNMTEEGIAVEKAVK-QVLDSGVRTADLRGSN 429

Query: 356 TTQQVVDDI 364
           +T +V D I
Sbjct: 430 STSEVGDAI 438

>Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  142 bits (357), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 117/367 (31%), Positives = 184/367 (50%), Gaps = 37/367 (10%)

Query: 20  PLTIGLIPGDGIGKEVIPAGKLVLENLSS-KHNLKFNFIDLQAGWQTFLDTGKALPDETI 78
           P  I ++PGD +G+E+      VL+ +S  + N+KF+F +   G      TG  LPDE +
Sbjct: 4   PKKIVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEAL 63

Query: 79  EILKSDCQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRP----------VKS 125
           E  K      L GAV  P     G   P   ++ +RK+L LYAN+RP          +  
Sbjct: 64  EASKK-ADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSP 121

Query: 126 VQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEI 185
           ++    +  D ++VRE    +Y    K    E  G  VA   ++ +      I ++A  +
Sbjct: 122 IKPQFAKGTDFVVVRELVGGIYFGERK----EDDGDGVAWDCEQYTVPEVQRITRMAAFM 177

Query: 186 SLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMVYR 245
           +LQ         +    K+NVL+ S  L+R   K V E+ K  +  +    Q++DS    
Sbjct: 178 ALQH---EPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMI 230

Query: 246 LFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGH------DFIVGEPCHGS 298
           L + P   + +I+  N++GDI+SD A+ + GSLG++PSA++         F + EPCHGS
Sbjct: 231 LVKNPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGS 290

Query: 299 APDIAGKGISNPIATIRSTALMLEF-MGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTT 357
           APD+  K   NP+ATI S A+ML+  +   E  + I  AV   + +  I+T DLGG ++T
Sbjct: 291 APDLP-KNKVNPVATILSAAMMLKLSLNLPEEGKAIEDAV-KRVLDAGIRTGDLGGSNST 348

Query: 358 QQVVDDI 364
            +V D +
Sbjct: 349 TEVGDAV 355

>YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}
           LEU2Beta-isopropylmalate dehydrogenase (IMDH), catalyzes
           the third step in the leucine biosynthesis pathway
          Length = 364

 Score =  142 bits (357), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 118/367 (32%), Positives = 184/367 (50%), Gaps = 37/367 (10%)

Query: 20  PLTIGLIPGDGIGKEVIPAGKLVLENLSS-KHNLKFNFIDLQAGWQTFLDTGKALPDETI 78
           P  I ++PGD +G+E+      VL+ +S  + N+KF+F +   G      TG  LPDE +
Sbjct: 4   PKKIVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEAL 63

Query: 79  EILKSDCQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRP----------VKS 125
           E  K      L GAV  P     G   P   ++ +RK+L LYAN+RP          +  
Sbjct: 64  EASKK-ADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSP 121

Query: 126 VQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEI 185
           ++    +  D ++VRE    +Y    K    E  G  VA   ++ +      I ++A  +
Sbjct: 122 IKPQFAKGTDFVVVRELVGGIYFGKRK----EDDGDGVAWDSEQYTVPEVQRITRMAAFM 177

Query: 186 SLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMVYR 245
           +LQ         +    K+NVL+ S  L+R   K V E+ K  +  +    Q++DS    
Sbjct: 178 ALQH---EPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMI 230

Query: 246 LFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGH------DFIVGEPCHGS 298
           L + P   + +I+  N++GDI+SD A+ + GSLG++PSA++         F + EPCHGS
Sbjct: 231 LVKNPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGS 290

Query: 299 APDIAGKGISNPIATIRSTALMLEF-MGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTT 357
           APD+  K   NPIATI S A+ML+  +   E  + I  AV   + +  I+T DLGG ++T
Sbjct: 291 APDLP-KNKVNPIATILSAAMMLKLSLNLPEEGKAIEDAV-KKVLDAGIRTGDLGGSNST 348

Query: 358 QQVVDDI 364
            +V D +
Sbjct: 349 TEVGDAV 355

>AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL018W
           (LEU2)
          Length = 372

 Score =  138 bits (348), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 120/368 (32%), Positives = 187/368 (50%), Gaps = 45/368 (12%)

Query: 23  IGLIPGDGIGKEVIPAGKLVL----ENLSSKHNLKFNFIDLQAGWQTFLDTGKALPDETI 78
           I ++PGD IG+EV+     VL    ++LS  H   F+F     G      TG ALPDE +
Sbjct: 7   IVVLPGDHIGREVVEEAVKVLGAVEQSLSDVH---FDFQYHLVGGAAIDATGSALPDEAL 63

Query: 79  EILKSDCQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRP----------VKS 125
              K +    L GAV  P  +  G   P   ++ LR++LG+YAN+RP          +  
Sbjct: 64  GAAK-EADAVLLGAVGGPKWQ-GGAVRPEQGLLKLRQELGVYANLRPCNFAADSLLELSP 121

Query: 126 VQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEI 185
           ++    R  D+++VRE     Y         E  G  VA    + +      IA++A  +
Sbjct: 122 LRPEIARDTDIMVVRELLGGSYFGERH----EDEGDGVAWDTDKYTVKEVQRIARMAGFL 177

Query: 186 SLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMVYR 245
           +LQ    +    +    K+NVL+ S  L+R   K V E+ +  +  +    Q++DS    
Sbjct: 178 ALQH---DPPLPVWSLDKANVLASSR-LWR---KTVEETFQSEFPNVQLQHQLIDSAAMI 230

Query: 246 LFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG------HDFIVGEPCHGS 298
           L + P  F+ V+V  N++GDI+SD A+ + GSLG++PSA++         F + EPCHGS
Sbjct: 231 LVKNPRAFNGVVVTSNMFGDIISDEASVIPGSLGLLPSASLASLPDSKSAFGLYEPCHGS 290

Query: 299 APDI-AGKGISNPIATIRSTALMLEF-MGYTEAAQDIHKAVDTNIRENQIKTPDLGGKST 356
           APD+ AGK  +NPI  I S A+ML+  +    A + + +AV   + ++ ++T DL G S+
Sbjct: 291 APDLPAGK--ANPIGCILSAAMMLKLSLNMVAAGEAVEQAVQ-EVLDSGVRTGDLLGSSS 347

Query: 357 TQQVVDDI 364
           T +V D I
Sbjct: 348 TSEVGDAI 355

>Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  138 bits (347), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 116/367 (31%), Positives = 183/367 (49%), Gaps = 37/367 (10%)

Query: 20  PLTIGLIPGDGIGKEVIPAGKLVLENLSS-KHNLKFNFIDLQAGWQTFLDTGKALPDETI 78
           P  I ++PGD +G+E+      VL+ +S  + ++ F+F +   G      TG  LPDE +
Sbjct: 4   PKKIVVLPGDHVGQEITAEAIKVLKAISEVRSDVNFDFENHLIGGAAIDATGVPLPDEAL 63

Query: 79  EILKSDCQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRP----------VKS 125
           E  K      L GAV  P     G   P   ++ +RK+L LYAN+RP          +  
Sbjct: 64  EASKK-ADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSP 121

Query: 126 VQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEI 185
           ++    +  D ++VRE    +Y    K    E  G  VA   ++ +      I ++A  +
Sbjct: 122 IKPQFAKGTDFVVVRELVGGIYFGKRK----EDDGDGVAWDSEQYTVPEVQRITRMAAFM 177

Query: 186 SLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMVYR 245
           +LQ         +    K+NVL+ S  L+R   K V E+ K  +  +    Q++DS    
Sbjct: 178 ALQH---EPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMI 230

Query: 246 LFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGH------DFIVGEPCHGS 298
           L + P   + +I+  N++GDI+SD A+ + GSLG++PSA++         F + EPCHGS
Sbjct: 231 LVKNPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGS 290

Query: 299 APDIAGKGISNPIATIRSTALMLEF-MGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTT 357
           APD+  K   NPIATI S A+ML+  +   E  + I  AV   + +  I+T DLGG ++T
Sbjct: 291 APDLP-KNKVNPIATILSAAMMLKLSLNLPEEGKAIEDAV-KKVLDAGIRTGDLGGSNST 348

Query: 358 QQVVDDI 364
            +V D +
Sbjct: 349 TEVGDAV 355

>Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W
           (LEU2) - beta-IPM (isopropylmalate) dehydrogenase
           [contig 82] FULL
          Length = 364

 Score =  138 bits (347), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 118/368 (32%), Positives = 185/368 (50%), Gaps = 37/368 (10%)

Query: 23  IGLIPGDGIGKEVIPAGKLVLENLSS-KHNLKFNFIDLQAGWQTFLDTGKALPDETIEIL 81
           I ++PGD +G+E+      VL+ +S  +   +F F     G      TG+ LPD ++E  
Sbjct: 7   IVVLPGDHVGQEITEEAVKVLKAISEVRPEKQFEFQYHLIGGAAIDATGEPLPDASLEAA 66

Query: 82  KSDCQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRP----------VKSVQG 128
           K      L GAV  P     G   P   ++ +RK+L LYAN+RP          +  ++ 
Sbjct: 67  KK-SDAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPLKP 124

Query: 129 TNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEISLQ 188
              R  D ++VRE    +Y    K    E TG  VA   ++ S      I ++A  ++LQ
Sbjct: 125 ECARGTDFVVVRELVGGIYFGERK----EDTGDGVAWDSEQYSVPEVQRITRMAAFLALQ 180

Query: 189 RLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMVYRLFR 248
                   +L    K+NVL+ S  L+R   K V E+ K  +  +    Q++DS    L +
Sbjct: 181 HSPPLPVWSL---DKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMILVK 233

Query: 249 EPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGH------DFIVGEPCHGSAPD 301
            P   + VI+  N++GDI+SD A+ + GSLG++PSA++         F + EPCHGSAPD
Sbjct: 234 NPTQLNGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPD 293

Query: 302 IAGKGISNPIATIRSTALMLEF-MGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQQV 360
           +  KG  NPIATI S A+ML+  +   E    + +AV   + ++ ++T DL G STT +V
Sbjct: 294 LP-KGKVNPIATILSAAMMLKLSLDMFEEGAAVEEAV-RKVLDSGVRTADLKGTSTTSEV 351

Query: 361 VDDILSKM 368
            + ++  +
Sbjct: 352 GEAVVKAL 359

>Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  137 bits (344), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 118/364 (32%), Positives = 181/364 (49%), Gaps = 37/364 (10%)

Query: 23  IGLIPGDGIGKEVIPAGKLVLENLSS-KHNLKFNFIDLQAGWQTFLDTGKALPDETIEIL 81
           I ++PGD +G+E+      VL+ +S  + N+KF+F     G      TG  L DE +E  
Sbjct: 7   IVVLPGDHVGQEITEEAIKVLKAISEVRPNVKFDFEYHLIGGAAIDATGVPLTDEALEAS 66

Query: 82  KSDCQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRP----------VKSVQG 128
           K      L GAV  P     G   P   ++ +RK+L LYAN+RP          +  ++ 
Sbjct: 67  KK-ADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLELSPIKP 124

Query: 129 TNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEISLQ 188
              R  D ++VRE    +Y    K    E  G  VA   ++ +      I ++A  ++LQ
Sbjct: 125 QFARGTDFVVVRELVGGIYFGKRK----EDDGDGVAWDSEQYTVPEVQRITRMAAFMALQ 180

Query: 189 RLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMVYRLFR 248
                    +    K+NVL+ S  L+R   K V E+ K  +  +    Q++DS    L +
Sbjct: 181 H---QPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILVK 233

Query: 249 EPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGH------DFIVGEPCHGSAPD 301
            P   + +I+  N++GDI+SD A+ + GSLG++PSA++         F + EPCHGSAPD
Sbjct: 234 NPTQLNGIIITSNMFGDIISDEASCIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPD 293

Query: 302 IAGKGISNPIATIRSTALMLEF-MGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQQV 360
           +  K   NPIATI S A+ML+  +  T   Q I  AV   + +  I+T DLGG ++T +V
Sbjct: 294 LP-KNKVNPIATILSAAMMLKLSLNMTAEGQAIEDAV-KKVLDAGIRTGDLGGSNSTIEV 351

Query: 361 VDDI 364
            D +
Sbjct: 352 GDAV 355

>CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}
          Length = 365

 Score =  136 bits (343), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 117/366 (31%), Positives = 180/366 (49%), Gaps = 38/366 (10%)

Query: 22  TIGLIPGDGIGKEVIPAGKLVLENLSS--KHNLKFNFIDLQAGWQTFLDTGKALPDETIE 79
           TI ++PGD +G+E+      VL  +       + F F     G      TG  LPDE +E
Sbjct: 6   TIVVLPGDHVGQEITEEAIKVLNAIQECRPDKVNFKFDHHLIGGAAIDATGVPLPDEALE 65

Query: 80  ILKSDCQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRP----------VKSV 126
             K      L GAV  P     G   P   ++ +RK+L LYAN+RP          +  +
Sbjct: 66  ASKK-ADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPL 123

Query: 127 QGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEIS 186
           +    R  D ++VRE    +Y    K    E  G  VA   ++ S      I ++A  ++
Sbjct: 124 KPEIARGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMAAFMA 179

Query: 187 LQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMVYRL 246
           LQ    N    +    K+NVL+ S  L+R   K V E+ K  +  +    Q++DS    L
Sbjct: 180 LQH---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPQLTVQHQLIDSAAMIL 232

Query: 247 FREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGH------DFIVGEPCHGSA 299
            + P   + +I+  N++GDI+SD A+ + GSLG++PSA++         F + EPCHGSA
Sbjct: 233 VKNPTHLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSA 292

Query: 300 PDIAGKGISNPIATIRSTALMLEF-MGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQ 358
           PD+  KG  NP+ATI S A+ML+  +   E  + I +AV   + ++ I+T DL G ++T 
Sbjct: 293 PDLP-KGKVNPVATILSAAMMLKLSLDLFEEGEIIEQAV-KKVLDSGIRTADLKGTNSTT 350

Query: 359 QVVDDI 364
           +V D +
Sbjct: 351 EVGDAV 356

>ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON}
           uniprot|Q96WI0 Zygosaccharomyces rouxii LEU2 3-
           isopropylmalate dehydrogenase
          Length = 362

 Score =  135 bits (341), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 116/364 (31%), Positives = 184/364 (50%), Gaps = 37/364 (10%)

Query: 23  IGLIPGDGIGKEVIPAGKLVLENLSS-KHNLKFNFIDLQAGWQTFLDTGKALPDETIEIL 81
           I ++PGD  G+E+      VLE +S      KFNF     G      TG  LPD+ +   
Sbjct: 5   IVVLPGDHAGQEIAQEAIKVLEAISEVSPEAKFNFQHHLIGGAAIDATGSPLPDDALAAA 64

Query: 82  KSDCQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRP----------VKSVQG 128
           K      L GAV  P     G   P   ++ +RK+L LYAN+RP          +  ++ 
Sbjct: 65  KKADA-VLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPLKP 122

Query: 129 TNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEISLQ 188
            + +  D ++VRE    +Y    K    E  G  VA   ++ ++     + ++A  ++LQ
Sbjct: 123 QHAKGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYTKPEVQRLTRMAAFLALQ 178

Query: 189 RLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMVYRLFR 248
               N    +    K+NVL+ S  L+R   K V E+ K  +  +  N Q++DS    L +
Sbjct: 179 H---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPQLKLNHQLIDSAAMILVK 231

Query: 249 EPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG------HDFIVGEPCHGSAPD 301
            P   + +++  NL+GDI+SD A+ + GSLG++PSA++         F + EPCHGSAPD
Sbjct: 232 SPTQLNGIVLTSNLFGDIISDEASVIPGSLGLLPSASLASLPDTNEAFGLYEPCHGSAPD 291

Query: 302 IAGKGISNPIATIRSTALMLEF-MGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQQV 360
           +  KG  NPIA I S A+ML+  +  ++  + + KAV   + ++ ++T DLGG ++T +V
Sbjct: 292 LP-KGKVNPIAMILSAAMMLKLSLNLSKEGEAVEKAV-KQVLDSGVRTGDLGGSNSTSEV 349

Query: 361 VDDI 364
            D I
Sbjct: 350 GDAI 353

>Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON}
           (182096..183190) [1095 nt, 365 aa]
          Length = 364

 Score =  135 bits (339), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 117/365 (32%), Positives = 183/365 (50%), Gaps = 38/365 (10%)

Query: 23  IGLIPGDGIGKEVIPAGKLVLENL--SSKHNLKFNFIDLQAGWQTFLDTGKALPDETIEI 80
           I ++PGD +G+E++     VLE +  SS   +KF F     G  +   TG  LPDE ++ 
Sbjct: 6   IVVLPGDHVGEEIVDEAIKVLEAVASSSSKGIKFEFQRHLIGGASIDATGTPLPDEALDA 65

Query: 81  LKSDCQGALFGAVQSP---TNKVEGYSSPIVALRKKLGLYANVRPVK----SVQGTND-- 131
            K +    L GAV  P   T  V      ++ +RK+L LYAN+RP      S+ G +   
Sbjct: 66  AK-NSDAVLLGAVGGPKWGTGDVRPEQG-LLKIRKELQLYANLRPCNFVSDSLLGLSPLK 123

Query: 132 ----RPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEISL 187
               +  D  +VRE    +Y    K    E  G   A   ++ +      I ++A  ++L
Sbjct: 124 EEIAKGTDFTVVRELVGGIYFGDRK----EDDGDGSAWDCEKYTIPEVQRITRMAAFLAL 179

Query: 188 QRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMVYRLF 247
           Q    +    +    K+NVL+ S  L+R   K V E+ K  +  +    Q++DS    L 
Sbjct: 180 QH---DPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPNLKVQHQLIDSAAMILV 232

Query: 248 REPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGH------DFIVGEPCHGSAP 300
           + P   + +I+  N++GDI+SD A+ + GSLG++PSA++         F + EPCHGSAP
Sbjct: 233 KSPRQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAP 292

Query: 301 DIAGKGISNPIATIRSTALMLEF-MGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQQ 359
           D+  KG  NPIATI S A+ML+  +   +    I +AV   + +  I+T DL G ++T +
Sbjct: 293 DLP-KGKVNPIATILSAAMMLKLSLNLVDEGIAIEQAV-KQVLDAGIRTADLKGSNSTSE 350

Query: 360 VVDDI 364
           V D +
Sbjct: 351 VGDAV 355

>KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.402
           YCL018W
          Length = 365

 Score =  134 bits (336), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 118/360 (32%), Positives = 184/360 (51%), Gaps = 37/360 (10%)

Query: 23  IGLIPGDGIGKEVIPAGKLVLENLSS-KHNLKFNFIDLQAGWQTFLDTGKALPDETIEIL 81
           I + PGD IG E++     VL+ ++    N+ F +     G      TG+ L DE +++ 
Sbjct: 7   ITVFPGDHIGTEIVRETVKVLDAIAEVSPNVSFKYNYQLIGGAAIDATGEPLTDEALQVA 66

Query: 82  KSDCQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRPVKSVQGT--NDRPV-- 134
           K +    L GAV  P     G   P   ++ +RK+LG+YAN+RP + V  T  +  P+  
Sbjct: 67  K-NSDAILLGAVGGPKWG-HGLVRPEQGLLKIRKELGVYANLRPCQFVSETLLDLSPLKR 124

Query: 135 ------DMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEISLQ 188
                 D +IVRE    +Y    +   D+     VA   +  S      I ++A  ++LQ
Sbjct: 125 EIVQGTDFVIVRELVGGIYFGERQEAGDDG----VAWDKESYSVPEIQRITRMAAFLALQ 180

Query: 189 RLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMVYRLFR 248
               N    +    K+NVL+ S  L+R   K V E+ K  +  +  N  ++DS    L +
Sbjct: 181 H---NPPLPVWSLDKANVLATSR-LWR---KTVEETIKNEFPTLTINHHLIDSAAMTLVQ 233

Query: 249 EPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG-----HDFI-VGEPCHGSAPD 301
            P   + V++  N++GDI+SD A+ + GSLG++PSA++      +D + + EPCHGSAPD
Sbjct: 234 NPTKLNGVVITTNMFGDIISDEASVIPGSLGLLPSASLASLPDKNDALGLYEPCHGSAPD 293

Query: 302 IAGKGISNPIATIRSTALMLEF-MGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQQV 360
           +     +NPIATI S A+M +  +  T+    I +AV   I +  IKT DLGGK+TT +V
Sbjct: 294 LPADH-ANPIATILSAAMMCKLSLNLTKEGNAIEEAVKRTI-DAGIKTGDLGGKNTTTEV 351

>SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {ON}
           highly similar to uniprot|P04173 Saccharomyces
           cerevisiae YCL018W LEU2 Beta-isopropylmalate
           dehydrogenase catalyzes the third step in the leucine
           biosynthesis pathway
          Length = 364

 Score =  132 bits (333), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 114/368 (30%), Positives = 187/368 (50%), Gaps = 37/368 (10%)

Query: 20  PLTIGLIPGDGIGKEVIPAGKLVLENLSS-KHNLKFNFIDLQAGWQTFLDTGKALPDETI 78
           P  I ++PGD +G+E+      VL+ +S  + ++KF++     G      TG  LPDE +
Sbjct: 4   PKKIVVLPGDHVGQEITAEAIRVLDAISEVRPDVKFDYQYHLIGGAAIDATGVPLPDEAL 63

Query: 79  EILKSDCQGALFGAVQSP---TNKVEGYSSPIVALRKKLGLYANVRP----------VKS 125
           +  K      L GAV  P   T +V      ++ +RK+L LYAN+RP          +  
Sbjct: 64  DAAKKADA-VLLGAVGGPKWGTGQVRPEQG-LLKIRKELQLYANLRPCNFASDSLLDLSP 121

Query: 126 VQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEI 185
           ++    +  D ++VRE    +Y    K    E  G  VA   ++ S      I ++A  +
Sbjct: 122 LKPEYAKGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMAAFL 177

Query: 186 SLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMVYR 245
           +LQ+   N    +    K+NVL+ S  L+R   K V E+ K  +  +    Q++DS    
Sbjct: 178 ALQQ---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMI 230

Query: 246 LFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGH------DFIVGEPCHGS 298
           L + P   + +++  N++GDI+SD A+ + GSLG++PSA++         F + EPCHGS
Sbjct: 231 LVKSPTKLNGIVITSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGS 290

Query: 299 APDIAGKGISNPIATIRSTALMLEF-MGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTT 357
           APD+  K   NPIATI S A+ML+  +   E    + +AV   + +  I+T DL G+++T
Sbjct: 291 APDLP-KNKVNPIATILSAAMMLKLSLNLVEEGNAVEEAV-RRVLDAGIRTADLRGENST 348

Query: 358 QQVVDDIL 365
            +V D ++
Sbjct: 349 SEVGDAVV 356

>NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {ON}
           Anc_1.402
          Length = 365

 Score =  130 bits (328), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 116/365 (31%), Positives = 181/365 (49%), Gaps = 38/365 (10%)

Query: 23  IGLIPGDGIGKEVIPAGKLVLENLSS--KHNLKFNFIDLQAGWQTFLDTGKALPDETIEI 80
           I ++PGD +G E+      VL+ +       +KF+F     G       G  L DE +E 
Sbjct: 7   IVVLPGDHVGGEITEEAIKVLKAIEQVESSKVKFDFQYHLIGGAAIDAAGVPLTDEALEA 66

Query: 81  LKSDCQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRPV----KSVQGTND-R 132
            K      L GAV  P     G   P   ++ +RK+LGLYAN+RP     + + G +  R
Sbjct: 67  SKK-ADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASEPLLGLSPLR 124

Query: 133 P-----VDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEISL 187
           P      D ++VRE    +Y    K    E  G  VA   ++ S      I ++A  ++L
Sbjct: 125 PEIAKGTDFMVVRELVGGIYFGERK----EDDGDGVAWDSEKYSVPEVERITRMAAFLAL 180

Query: 188 QRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMVYRLF 247
           Q    N    +    K+NVL+ S  L+R   K V  + K  +  +    Q++DS    L 
Sbjct: 181 QH---NPPLPIWSLDKANVLASSR-LWR---KTVEATIKNEFPTLTVQNQLIDSAAMILV 233

Query: 248 REPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGH------DFIVGEPCHGSAP 300
           + P   + +I+  N++GDI+SD A+ + GSLG++PSA++         F + EPCHGSAP
Sbjct: 234 KNPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAP 293

Query: 301 DIAGKGISNPIATIRSTALMLEF-MGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQQ 359
           D+  K   NP+ATI S A+ML+  +   +  + + +AV   + +  ++T DLGG ++TQ+
Sbjct: 294 DLP-KNKVNPVATILSAAMMLKLSLNMVKEGEAVEEAV-RRVLDAGVRTGDLGGSNSTQE 351

Query: 360 VVDDI 364
           V D I
Sbjct: 352 VGDAI 356

>TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score =  123 bits (308), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 117/373 (31%), Positives = 177/373 (47%), Gaps = 52/373 (13%)

Query: 22  TIGLIPGDGIGKEVIPAGKLVLENLSSKHN--LKFNFIDLQAGWQTFLDTGKALPDETIE 79
            I ++PGD +G EV      +L+ +    N  +KFNF     G      TG  LPDE++E
Sbjct: 6   NIVVLPGDHVGGEVTEEAVKILKAIEEVRNNKVKFNFEYHLIGGAAIDATGNPLPDESLE 65

Query: 80  ILKSDCQGALFGAVQSPTNKVEGYSSP---IVALRKKLGLYANVRPV------------- 123
             K      L GAV  P     G   P   ++ +RK+L LYAN+RP              
Sbjct: 66  ASKR-ADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPL 123

Query: 124 --KSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKI 181
             K  +GT     D  +VRE    +Y    K    E  G  VA   ++ S      I ++
Sbjct: 124 KEKYAKGT-----DFTVVRELVGGIYFGKRK----EDDGDGVAWDSEQYSVPEVQRITRM 174

Query: 182 ALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDS 241
           A  +++Q    N    +    K+NVL+ S  L+R   K V E+ +  + ++  + Q++DS
Sbjct: 175 AAFLAMQH---NPPLPIWSLDKANVLASSR-LWR---KTVEETIQNEFPSLKVSHQLIDS 227

Query: 242 MVYRLFREPECFD-VIVAPNLYGDILSDGAAALVG--------SLGVVPSANVGHDFIVG 292
               L + P   + +I+  N++GDI+SD A+ + G        SL  +P  N    F + 
Sbjct: 228 AAMILVKNPTQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLSSLPDTNSA--FGLY 285

Query: 293 EPCHGSAPDIAGKGISNPIATIRSTALMLEF-MGYTEAAQDIHKAVDTNIRENQIKTPDL 351
           EPCHGSAPD+  KG  NPI TI S A+ML+  +   E    + +AV   + +N I+T DL
Sbjct: 286 EPCHGSAPDLP-KGKVNPIGTILSVAMMLKLSLNLKEEGIAVEEAV-RRVLDNNIRTADL 343

Query: 352 GGKSTTQQVVDDI 364
           GG ++T  + D +
Sbjct: 344 GGSNSTSDIGDAV 356

>AAL022W Chr1 (302946..304193) [1248 bp, 415 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR174W (IDP2) and
           YNL009W (IDP3)
          Length = 415

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 92/196 (46%), Gaps = 24/196 (12%)

Query: 174 ATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESN-KERYGAI 232
           + T  AK + E++LQR     K  L  T K+ +L + DG F+++ + +Y +  KE++ A 
Sbjct: 190 SITGFAKSSFELALQR-----KMPLYSTTKNTILKKYDGKFKDIFEGMYAAEYKEKFEAA 244

Query: 233 G--YNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD-- 288
           G  Y  +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  V  D  
Sbjct: 245 GIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVSPDGK 303

Query: 289 FIVGEPCHGSA-----PDIAGKGIS-NPIATIRSTALMLEFMGYTEAAQDI-------HK 335
               E  HG+          GK  S N IA+I +    +   G  +   D+        K
Sbjct: 304 TFESEAAHGTVTRHYRQHQQGKETSTNSIASIFAWTRGIIHRGKVDGTPDVVKFGELLEK 363

Query: 336 AVDTNIRENQIKTPDL 351
           +    ++E+ I T DL
Sbjct: 364 STLDTVQEDNIMTKDL 379

>Ecym_1306 Chr1 complement(619565..620812) [1248 bp, 415 aa] {ON}
           similar to Ashbya gossypii AAL022W
          Length = 415

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 69/130 (53%), Gaps = 11/130 (8%)

Query: 174 ATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESN-KERYGAI 232
           + T  AK + E++L+R     K  L  T K+ +L + DG F+++ + +YE   K+++ A+
Sbjct: 190 SITGFAKSSFELALER-----KMPLYSTTKNTILKKYDGQFKDIFEGMYEREYKQKFEAV 244

Query: 233 G--YNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD-- 288
           G  Y  +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  V  D  
Sbjct: 245 GIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVSPDGK 303

Query: 289 FIVGEPCHGS 298
               E  HG+
Sbjct: 304 TFESEAAHGT 313

>KAFR0H03160 Chr8 complement(602807..604072) [1266 bp, 421 aa] {ON}
           Anc_1.396 YLR174W
          Length = 421

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 67/127 (52%), Gaps = 11/127 (8%)

Query: 178 IAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESN-KERYGAIG--Y 234
            A+ + E++L+R     K  L  T K+ VL + DG F+++ + +YES+ K ++  IG  Y
Sbjct: 195 FARASFEMALKR-----KMPLFFTTKNTVLKRYDGKFKDIFQEMYESDYKVQFDEIGILY 249

Query: 235 NEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD--FIVG 292
             +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  V  D      
Sbjct: 250 EHRLIDDMVAQMLKSTGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSMLVAPDGKTFES 308

Query: 293 EPCHGSA 299
           E  HG+ 
Sbjct: 309 EAAHGTV 315

>Smik_12.235 Chr12 (451719..452957) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 64/225 (28%), Positives = 108/225 (48%), Gaps = 37/225 (16%)

Query: 175 TTD----IAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVY-ESNKERY 229
           TTD     AK + E++++R     K  L  T K+ +L + DG F++V + +Y ES KE++
Sbjct: 185 TTDSIEGFAKASFELAIER-----KLPLYSTTKNTILKKYDGKFKDVFEGMYAESYKEKF 239

Query: 230 GAIG--YNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGH 287
            ++G  Y  +++D MV ++ +    + +I   N  GD+ SD  A   GSLG++ S  +  
Sbjct: 240 ESLGIWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITP 298

Query: 288 D--FIVGEPCHGSA-----PDIAGKGIS-NPIATIRSTALMLEFMGYTEAAQDIHK---- 335
           D      E  HG+          GK  S N IA+I +    +   G  +   D+ K    
Sbjct: 299 DGKTFESEAAHGTVTRHFRQHQQGKETSTNSIASIFAWTRGIIQRGKLDNTPDVVKFGQI 358

Query: 336 ---AVDTNIRENQIKTPDLG---GKS------TTQQVVDDILSKM 368
              A    ++E+ I T DL    GK+      TT++ +D + S++
Sbjct: 359 LESATVNTVQEDGIMTKDLALILGKTERSAYVTTEEFIDAVESRL 403

>KLTH0H12012g Chr8 (1026586..1027827) [1242 bp, 413 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 413

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 65/126 (51%), Gaps = 11/126 (8%)

Query: 178 IAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESN-KERY--GAIGY 234
            A+ + E++LQR     K  L  T K+ +L + DG F++  + +YE+  +ER+    I Y
Sbjct: 194 FARASFELALQR-----KMPLYSTTKNTILKRYDGRFKDEFEAMYEAEYRERFERAGIWY 248

Query: 235 NEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD--FIVG 292
             +++D MV ++ +    F VI   N  GD+ SD  A   GSLG++ S  V  D      
Sbjct: 249 EHRLIDDMVAQMLKSAGGF-VIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGRAFES 307

Query: 293 EPCHGS 298
           E  HG+
Sbjct: 308 EAAHGT 313

>SAKL0D08426g Chr4 (705189..706424) [1236 bp, 411 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 411

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 111/233 (47%), Gaps = 34/233 (14%)

Query: 163 VAEAIKRISETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVY 222
           VA A+   +E + T  AK + E++L+R     K  L  T K+ +L + DG F+++ +++Y
Sbjct: 178 VAMAMYNTTE-SITGFAKASFELALER-----KLPLYSTTKNTILKRYDGKFKDIFESMY 231

Query: 223 ESN-KERYGAIG--YNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGV 279
            S+ ++++  IG  Y  +++D MV ++ +    + +I   N  GD+ SD  A   GSLG+
Sbjct: 232 ASDYQDKFEVIGIWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGL 290

Query: 280 VPSANVGHD--FIVGEPCHGSA-----PDIAGKGIS-NPIATIRSTALMLEFMGYTEAAQ 331
           + S  V  D      E  HG+          GK  S N IA+I + +  +   G  +   
Sbjct: 291 MSSVLVTPDGKTFESEAAHGTVTRHYRQHQQGKETSTNSIASIFAWSRGIIQRGKIDETP 350

Query: 332 DIHK-------AVDTNIRENQIKTPDL---------GGKSTTQQVVDDILSKM 368
           ++ K       A    ++E+ I T DL         G   TT++ +D +  ++
Sbjct: 351 EVVKFGQLLEDATTNTVQEDGIMTKDLALILGKTDRGSYVTTEEFIDAVEKRL 403

>YLR174W Chr12 (504591..505829) [1239 bp, 412 aa] {ON}
           IDP2Cytosolic NADP-specific isocitrate dehydrogenase,
           catalyzes oxidation of isocitrate to
           alpha-ketoglutarate; levels are elevated during growth
           on non-fermentable carbon sources and reduced during
           growth on glucose
          Length = 412

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 64/225 (28%), Positives = 107/225 (47%), Gaps = 37/225 (16%)

Query: 175 TTD----IAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVY-ESNKERY 229
           TTD     AK + E++++R     K  L  T K+ +L + DG F++V + +Y  S KE++
Sbjct: 185 TTDSIEGFAKASFELAIER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYARSYKEKF 239

Query: 230 GAIG--YNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGH 287
            ++G  Y  +++D MV ++ +    + +I   N  GD+ SD  A   GSLG++ S  +  
Sbjct: 240 ESLGIWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITP 298

Query: 288 D--FIVGEPCHGSA-----PDIAGKGIS-NPIATIRSTALMLEFMGYTEAAQDIHK---- 335
           D      E  HG+          GK  S N IA+I +    +   G  +   D+ K    
Sbjct: 299 DGKTFESEAAHGTVTRHFRQHQQGKETSTNSIASIFAWTRGIIQRGKLDNTPDVVKFGQI 358

Query: 336 ---AVDTNIRENQIKTPDLG---GKS------TTQQVVDDILSKM 368
              A    ++E+ I T DL    GKS      TT++ +D + S++
Sbjct: 359 LESATVNTVQEDGIMTKDLALILGKSERSAYVTTEEFIDAVESRL 403

>KAFR0I02130 Chr9 (438428..439654) [1227 bp, 408 aa] {ON} Anc_1.396
           YLR174W
          Length = 408

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 65/127 (51%), Gaps = 11/127 (8%)

Query: 178 IAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESN-KERYGAIG--Y 234
            A+ +  ++++R     K  L  T K+ +L Q DG F+++ K VYE+  KE +  +G  Y
Sbjct: 190 FARASFTMAIER-----KLPLYSTTKNTILKQYDGQFKDIFKTVYENEYKETFEELGIWY 244

Query: 235 NEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD--FIVG 292
             +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  +  D      
Sbjct: 245 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSTLIAADGKTFES 303

Query: 293 EPCHGSA 299
           E  HG+ 
Sbjct: 304 EAAHGTV 310

>TBLA0C01290 Chr3 complement(283624..284880) [1257 bp, 418 aa] {ON}
           Anc_1.396 YLR174W
          Length = 418

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 65/130 (50%), Gaps = 11/130 (8%)

Query: 174 ATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYE---SNKERYG 230
           + TD AK + E +L+R     K  L  T K+ +L Q DG F+++ + +Y     +K +  
Sbjct: 194 SITDFAKASFEFALER-----KIPLYSTTKNTILKQYDGKFKDIFEEMYAKEYEDKFKVL 248

Query: 231 AIGYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD-- 288
            I Y  +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  +  D  
Sbjct: 249 NIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDVVAQGFGSLGLMTSVLLTPDGS 307

Query: 289 FIVGEPCHGS 298
               E  HG+
Sbjct: 308 SFESEAAHGT 317

>Kpol_1055.78 s1055 (207889..209172) [1284 bp, 427 aa] {ON}
           (207889..209172) [1284 nt, 428 aa]
          Length = 427

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 100/207 (48%), Gaps = 28/207 (13%)

Query: 189 RLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESN-KERYGAIG--YNEQIVDSMVYR 245
           +L  N K  L ++ K+ +L + DG F+++ + +YES+ K ++  +G  Y  +++D MV +
Sbjct: 209 KLAINKKLNLFLSTKNTILKKYDGRFKDIFQEIYESDYKSQFENLGISYEHRLIDDMVAQ 268

Query: 246 LFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD--FIVGEPCHGSAPDI- 302
           + +    F ++   N  GD+ SD  A   GSLG++ S  V  D      E  HG+     
Sbjct: 269 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHY 327

Query: 303 ----AGKGIS-NPIATIRSTALMLEFMGYTEAAQDIHK-------AVDTNIRENQIKTPD 350
                GK  S N IA+I + +  L   G  ++  D+ K       A    ++++ I T D
Sbjct: 328 RQYEQGKETSTNSIASIFAWSRGLAKRGELDSTPDVIKFANLLESATLNTVQQDGIMTKD 387

Query: 351 LG---GKS------TTQQVVDDILSKM 368
           L    GK+      TT + +D + +++
Sbjct: 388 LALACGKTERSAYVTTDEFLDAVATRL 414

>Suva_10.271 Chr10 (476726..477964) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 70/133 (52%), Gaps = 15/133 (11%)

Query: 175 TTD----IAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVY-ESNKERY 229
           TTD     AK + E++L+R     K  L  T K+ +L + DG F++V + +Y E  KE++
Sbjct: 185 TTDSIKGFAKASFELALER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYAEVYKEKF 239

Query: 230 GAIG--YNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGH 287
            A+G  Y  +++D MV ++ +    + +I   N  GD+ SD  A   GSLG++ S  +  
Sbjct: 240 EALGIWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSLLITP 298

Query: 288 D--FIVGEPCHGS 298
           D      E  HG+
Sbjct: 299 DGKTFESEAAHGT 311

>Skud_12.239 Chr12 (451342..452580) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 60/218 (27%), Positives = 103/218 (47%), Gaps = 33/218 (15%)

Query: 178 IAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESN-KERYGAIG--Y 234
            AK + E++++R     K  L  T K+ +L + DG F++V + +Y  N KE++ ++G  Y
Sbjct: 192 FAKASFELAIER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYAENYKEKFESLGIWY 246

Query: 235 NEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD--FIVG 292
             +++D MV ++ +    + +I   N  GD+ SD  A   GSLG++ S  +  D      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSMLITPDGKTFES 305

Query: 293 EPCHGSA-----PDIAGKGIS-NPIATIRSTALMLEFMGYTEAAQDIHK-------AVDT 339
           E  HG+          GK  S N IA+I +    +   G  +   D+ K       A   
Sbjct: 306 EAAHGTVTRHFRQHQQGKETSTNSIASIFAWTRGIIQRGKLDNTPDVVKFGEILESATVN 365

Query: 340 NIRENQIKTPDLG---GKS------TTQQVVDDILSKM 368
            ++E+ I T DL    GK+      TT+  +D + S++
Sbjct: 366 TVQEDGIMTKDLALILGKTERSAYVTTEDFIDAVESRL 403

>TPHA0B03660 Chr2 (863280..864548) [1269 bp, 422 aa] {ON} Anc_1.396
           YLR174W
          Length = 422

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 66/126 (52%), Gaps = 11/126 (8%)

Query: 178 IAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVY-ESNKERYGA--IGY 234
            A+ + E +L+R     K  L  T K+ +L + DG F+++ +++Y E  +E++ A  I Y
Sbjct: 203 FARSSFEFALER-----KLPLYSTTKNTILKKYDGQFKDIFESMYKEEYEEKFKALNIWY 257

Query: 235 NEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD--FIVG 292
             +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  +  D      
Sbjct: 258 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLISDDGKTFES 316

Query: 293 EPCHGS 298
           E  HG+
Sbjct: 317 EAAHGT 322

>TDEL0B06100 Chr2 complement(1076365..1077609) [1245 bp, 414 aa]
           {ON} Anc_1.396 YLR174W
          Length = 414

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 67/130 (51%), Gaps = 11/130 (8%)

Query: 174 ATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVY-ESNKERYGAI 232
           + T  AK + E++L+R     K  L  T K+ +L + DG F++V + +Y +  + R+  +
Sbjct: 187 SITGFAKASFELALER-----KLPLYSTTKNTILKKYDGKFKDVFEQMYADQYQSRFEEL 241

Query: 233 G--YNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD-- 288
           G  Y  +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  V  D  
Sbjct: 242 GIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLVTPDGK 300

Query: 289 FIVGEPCHGS 298
               E  HG+
Sbjct: 301 TFESEAAHGT 310

>KNAG0I01320 Chr9 complement(255478..256716) [1239 bp, 412 aa] {ON}
           Anc_1.396 YLR174W
          Length = 412

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 67/126 (53%), Gaps = 11/126 (8%)

Query: 178 IAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESN-KERYGAIG--Y 234
            AK + +++++R     K  L  T K+ +L + DG+F+++ + +YE   KE++  +G  Y
Sbjct: 195 FAKASFQLAVER-----KMPLYSTTKNTILKKYDGMFKDIFEGMYEREYKEKFEELGIWY 249

Query: 235 NEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD--FIVG 292
             +++D MV ++ +    + +I   N  GD+ SD  A   GSLG++ S  +  D      
Sbjct: 250 EHRLIDDMVAQMLKSSGGY-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFES 308

Query: 293 EPCHGS 298
           E  HG+
Sbjct: 309 EAAHGT 314

>CAGL0H03663g Chr8 (337533..338789) [1257 bp, 418 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174w IDP2 isocitrate dehydrogenase or uniprot|P53982
           Saccharomyces cerevisiae YNL009w IDP3 or uniprot|P21954
           Saccharomyces cerevisiae YDL066w IDP1
          Length = 418

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 69/133 (51%), Gaps = 11/133 (8%)

Query: 171 SETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVY-ESNKERY 229
           ++ + T  A+ + E++++R     K  L  T K+ +L + DG F+++ + +Y E  K ++
Sbjct: 186 TDESITGFARASFELAIKR-----KLPLFFTTKNTILKKYDGRFKDIFQKMYDEDYKGKF 240

Query: 230 GAIG--YNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGH 287
             +G  Y  +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  +  
Sbjct: 241 KELGISYEHRLIDDMVAQMIKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSTLLTP 299

Query: 288 D--FIVGEPCHGS 298
           D      E  HG+
Sbjct: 300 DGKIFESEAAHGT 312

>YNL009W Chr14 (614821..616083) [1263 bp, 420 aa] {ON}
           IDP3Peroxisomal NADP-dependent isocitrate dehydrogenase,
           catalyzes oxidation of isocitrate to alpha-ketoglutarate
           with the formation of NADP(H+), required for growth on
           unsaturated fatty acids
          Length = 420

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 178 IAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESN-KERYGA--IGY 234
            AK + E++L+R     K  L  T K+ +L   D  F+++  N+++   KE++ A  I Y
Sbjct: 192 FAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDNLFDKEYKEKFQALKITY 246

Query: 235 NEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD--FIVG 292
             +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  +  D      
Sbjct: 247 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILITPDGKTFES 305

Query: 293 EPCHGS 298
           E  HG+
Sbjct: 306 EAAHGT 311

>ZYRO0E05016g Chr5 complement(379654..380889) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P41939 Saccharomyces
           cerevisiae YLR174W IDP2 Cytosolic NADP-specific
           isocitrate dehydrogenase catalyzes oxidation of
           isocitrate to alpha- ketoglutarate levels are elevated
           during growth on non- fermentable carbon sources and
           reduced during growth on glucose
          Length = 411

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 73/145 (50%), Gaps = 14/145 (9%)

Query: 160 GTRVAEAIKRISETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCK 219
           G  VA A+   +E +    AK + E++L+R     K  L  T K+ +L + DG F+++ +
Sbjct: 176 GGGVAMAMYNTTE-SIEGFAKASFELALER-----KQPLYSTTKNTILKKYDGKFKDIFE 229

Query: 220 NVYE----SNKERYGAIGYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVG 275
            +YE    S  E+ G I Y  +++D MV ++ +    + +I   N  GD+ SD  A   G
Sbjct: 230 AMYEKEYRSQFEKLG-IWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVQSDIVAQGFG 287

Query: 276 SLGVVPSANVGHD--FIVGEPCHGS 298
           SLG++ S  V  D      E  HG+
Sbjct: 288 SLGLMTSVLVTPDGKTFESEAAHGT 312

>TPHA0B02210 Chr2 (509945..511246) [1302 bp, 433 aa] {ON} Anc_4.254
           YDL066W
          Length = 433

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 68/271 (25%), Positives = 123/271 (45%), Gaps = 30/271 (11%)

Query: 100 VEGYSSPIVALRKKLGLYANVRPVKSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKT 159
           V+ +  PI+     +G +A+    K+       P  + +V ++ ++   KT+   + +  
Sbjct: 142 VKNWEKPII-----IGRHAHADQYKATDTLIPGPGTLELVYKSKDNDPSKTQVLNVYDYK 196

Query: 160 GTRVAEAIKRISETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCK 219
            + VA A+    E+ T          S  +L  + K  L ++ K+ +L + DG F++V +
Sbjct: 197 SSGVALAMYNTDESIT------GFAHSSFKLAIDKKLDLFLSTKNTILKKYDGRFKDVFQ 250

Query: 220 NVYESN-KERYGA--IGYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGS 276
            V++S  K+++ A  I Y  +++D MV ++ +    + ++   N  GD+ SD  A   GS
Sbjct: 251 EVFDSTYKDKFEALNIKYEHRLIDDMVAQMIKSKGGY-IMALKNYDGDVQSDIVAQGFGS 309

Query: 277 LGVVPSANVGHD--FIVGEPCHGSA-----PDIAGKGIS-NPIATIRSTALMLEFMG--- 325
           LG++ S  V  D      E  HG+          GK  S N IA+I + +  L   G   
Sbjct: 310 LGLMTSILVTPDGKTFESEAAHGTVTRHYRQHQQGKQTSTNSIASIFAWSRGLAKRGELD 369

Query: 326 ----YTEAAQDIHKAVDTNIRENQIKTPDLG 352
                 + AQ + KA    ++E+ I T DL 
Sbjct: 370 NTPDVMKFAQTLEKATLDTVQEDGIMTKDLA 400

>Kwal_0.191 s0 (98033..99268) [1236 bp, 411 aa] {ON} YLR174W (IDP2)
           - Cytosolic form of NADP-dependent isocitrate
           dehydrogenase [contig 82] FULL
          Length = 411

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 72/141 (51%), Gaps = 12/141 (8%)

Query: 163 VAEAIKRISETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVY 222
           VA A+   SE+     A+ + E++LQR     +  L  T K+ +L + DG F++V + +Y
Sbjct: 178 VALAMYNTSES-IAGFARASFELALQR-----RMPLYSTTKNTILKKYDGKFKDVFEAMY 231

Query: 223 ESN-KERYGAIG--YNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGV 279
            +  + R+  +G  Y  +++D MV ++ +    F +I   N  GD+ SD  A   GSLG+
Sbjct: 232 AAEYQSRFEELGIWYEHRLIDDMVAQMLKSTGGF-IIAMKNYDGDVQSDIVAQGFGSLGL 290

Query: 280 VPSANVGHD--FIVGEPCHGS 298
           + S  V  D      E  HG+
Sbjct: 291 MTSVLVTPDGKTFESEAAHGT 311

>KLLA0F12342g Chr6 (1137608..1138855) [1248 bp, 415 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 415

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 64/229 (27%), Positives = 107/229 (46%), Gaps = 27/229 (11%)

Query: 142 NTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEISLQRLKANGKATLTVT 201
           NTE++ +       DE++   VA A+    E + T  A  + +++L+R        L  T
Sbjct: 162 NTENIELSVYD--FDEESKGGVAMAMYNTLE-SITGFAHASFKMALER-----GLPLYST 213

Query: 202 HKSNVLSQSDGLFREVCKNVYESN-KERYGA--IGYNEQIVDSMVYRLFREPECFDVIVA 258
            K+ +L + DG F++V +++YES  K  + A  I Y  +++D MV ++ +    + +I  
Sbjct: 214 TKNTILKKYDGKFKDVFESLYESQYKSAFEAKGIWYEHRLIDDMVAQMLKSKGGY-IIAM 272

Query: 259 PNLYGDILSDGAAALVGSLGVVPSANVGHD--FIVGEPCHGSA-----PDIAGKGIS-NP 310
            N  GD+ SD  A   GSLG++ S  +  D      E  HG+          GK  S N 
Sbjct: 273 KNYDGDVESDIVAQGFGSLGLMTSVLITPDGKAFESEAAHGTVTRHYRQHQQGKETSTNS 332

Query: 311 IATIRSTALMLEFMGYTEAAQDIHK-------AVDTNIRENQIKTPDLG 352
           IA+I +    L   G  ++  D+ K       A    ++E++I T DL 
Sbjct: 333 IASIFAWTRGLIQRGKLDSTPDVVKFAELVESATVNTVQEDEIMTKDLA 381

>Suva_14.339 Chr14 (594794..596047) [1254 bp, 417 aa] {ON} YNL009W
           (REAL)
          Length = 417

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 65/126 (51%), Gaps = 11/126 (8%)

Query: 178 IAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESN-KERYGAIG--Y 234
            AK + E++L+R     K  L  T K+ +L   D  F+++   ++++  KE++ A+G  Y
Sbjct: 192 FAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDKLFDAEYKEQFQALGITY 246

Query: 235 NEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD--FIVG 292
             +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  +  D      
Sbjct: 247 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILITPDGKTFES 305

Query: 293 EPCHGS 298
           E  HG+
Sbjct: 306 EAAHGT 311

>Smik_14.319 Chr14 (573167..574423) [1257 bp, 418 aa] {ON} YLR174W
           (REAL)
          Length = 418

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 178 IAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVY-ESNKERYGAIG--Y 234
            AK + E++L+R     K  L  T K+ +L   D  F+++   ++ E  +E++ A+G  Y
Sbjct: 192 FAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDGLFNEKYREKFQALGIKY 246

Query: 235 NEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD--FIVG 292
             +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  V  D      
Sbjct: 247 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFES 305

Query: 293 EPCHGS 298
           E  HG+
Sbjct: 306 EAAHGT 311

>Smik_4.169 Chr4 (311244..312530) [1287 bp, 428 aa] {ON} YDL066W
           (REAL)
          Length = 428

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 62/115 (53%), Gaps = 6/115 (5%)

Query: 189 RLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESN-KERYGAIG--YNEQIVDSMVYR 245
           +L  + K  L ++ K+ +L + DG F+++ + VYE+  K ++ A+G  Y  +++D MV +
Sbjct: 215 KLAIDKKLNLFLSTKNTILKKYDGRFKDIFQKVYEAQYKSKFEALGIHYEHRLIDDMVAQ 274

Query: 246 LFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD--FIVGEPCHGS 298
           + +    F ++   N  GD+ SD  A   GSLG++ S  V  D      E  HG+
Sbjct: 275 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 328

>Skud_14.318 Chr14 (581597..582859) [1263 bp, 420 aa] {ON} YNL009W
           (REAL)
          Length = 420

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 65/126 (51%), Gaps = 11/126 (8%)

Query: 178 IAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESN-KERYGAIG--Y 234
            AK + E++L+R     +  L  T K+ +L   D  F+E+   ++++  KE++ A+G  Y
Sbjct: 192 FAKASFELALKR-----RLPLFFTTKNTILKSYDNQFKEIFDKLFDAEYKEKFQALGITY 246

Query: 235 NEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD--FIVG 292
             +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  +  D      
Sbjct: 247 EHRLIDDMVAQMLKSRGGF-IVAMKNYDGDVQSDIVAQGFGSLGLMTSLLITPDAKTFES 305

Query: 293 EPCHGS 298
           E  HG+
Sbjct: 306 EAAHGT 311

>NCAS0A08720 Chr1 complement(1722511..1723752) [1242 bp, 413 aa]
           {ON} Anc_1.396
          Length = 413

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 69/133 (51%), Gaps = 15/133 (11%)

Query: 175 TTD----IAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESN-KERY 229
           TTD     A+ + +++L+R     +  L  T K+ +L + DG F+ V +++YE   K+++
Sbjct: 187 TTDAIEGFARSSFQLALER-----QLPLYSTTKNTILKKYDGKFKSVFEDMYEREYKQQF 241

Query: 230 GAIG--YNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGH 287
             +G  Y  +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  V  
Sbjct: 242 EDLGIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVAP 300

Query: 288 D--FIVGEPCHGS 298
           D      E  HG+
Sbjct: 301 DGKTFESEAAHGT 313

>Kwal_23.4210 s23 (619516..620784) [1269 bp, 422 aa] {ON} YDL066W
           (IDP1) - Mitochondrial form of NADP-specific isocitrate
           dehydrogenase [contig 1] FULL
          Length = 422

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 83/182 (45%), Gaps = 19/182 (10%)

Query: 189 RLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKE---RYGAIGYNEQIVDSMVYR 245
           +L  + +  L ++ K+ +L Q DG F+++ + VY    +   R   I Y  +++D MV +
Sbjct: 208 KLALSKRLNLFMSTKNTILKQYDGRFKDIFQEVYAQEYQTQFRDEGISYEHRLIDDMVAQ 267

Query: 246 LFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD--FIVGEPCHGSA---- 299
           + +    F V+   N  GD+LSD  A   GSLG++ S  V  D      E  HG+     
Sbjct: 268 MIKSRGGF-VMALKNYDGDVLSDIVAQGFGSLGLMTSMLVTPDGKTFESEAAHGTVTRHF 326

Query: 300 -PDIAGKGIS-NPIATIRSTALMLEFMG-------YTEAAQDIHKAVDTNIRENQIKTPD 350
                GK  S N IA+I + +  L   G         E A+ +  A    ++++ I T D
Sbjct: 327 RQHQQGKETSTNSIASIFAWSRGLGKRGELDGTPDVVEFARKLEAATIETVQQHGIMTKD 386

Query: 351 LG 352
           L 
Sbjct: 387 LA 388

>CAGL0B04917g Chr2 complement(477939..479174) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P41939 Saccharomyces
           cerevisiae YLR174w IDP2 isocitrate dehydrogenase or
           uniprot|P53982 Saccharomyces cerevisiae YNL009w IDP3 or
           uniprot|P21954 Saccharomyces cerevisiae YDL066w IDP1
          Length = 411

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 57/199 (28%), Positives = 96/199 (48%), Gaps = 30/199 (15%)

Query: 198 LTVTHKSNVLSQSDGLFREVCKNVYESN-KERYGA--IGYNEQIVDSMVYRLFREPECFD 254
           L  T K+ +L + DG F++  +++YE+  KE++ A  I Y  +++D MV ++ +    F 
Sbjct: 207 LYSTTKNTILKKYDGKFKDTFESMYEAEYKEQFEAKGIWYEHRLIDDMVAQMLKSKGGF- 265

Query: 255 VIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD--FIVGEPCHGSA-----PDIAGKGI 307
           +I   N  GD+ SD  A   GSLG++ S  +  D      E  HG+          GK  
Sbjct: 266 IIAMKNYDGDVESDIVAQGFGSLGLMTSVLISPDGKTFESEAAHGTVTRHYRQHQQGKET 325

Query: 308 S-NPIATIRSTALMLEFMGYTEAAQDIHK--------AVDTNIRENQIKTPDLG---GKS 355
           S N IA+I +    +   G  +   D+ K         VDT ++E+ I T DL    GK+
Sbjct: 326 STNSIASIFAWTRGIIQRGKLDETADVVKFGELLERATVDT-VQEDGIMTKDLALILGKT 384

Query: 356 ------TTQQVVDDILSKM 368
                 TT++ +D + +++
Sbjct: 385 DRSAYVTTEEFIDAVENRI 403

>Suva_4.184 Chr4 (324382..325671) [1290 bp, 429 aa] {ON} YDL066W
           (REAL)
          Length = 429

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 62/115 (53%), Gaps = 6/115 (5%)

Query: 189 RLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESN-KERYGAIG--YNEQIVDSMVYR 245
           ++  + K  L ++ K+ +L + DG F+++ +N+YE+  K ++  +G  Y  +++D MV +
Sbjct: 216 KMAIDKKLNLFLSTKNTILKKYDGRFKDIFQNIYEAQYKPKFEELGIHYEHRLIDDMVAQ 275

Query: 246 LFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD--FIVGEPCHGS 298
           + +    F ++   N  GD+ SD  A   GSLG++ S  V  D      E  HG+
Sbjct: 276 MVKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 329

>KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.396
           YLR174W
          Length = 424

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 67/126 (53%), Gaps = 11/126 (8%)

Query: 178 IAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESN-KERYGAIG--Y 234
            AK + E++L+R     K  L    K+ +L + DGLF+++ + +Y+ + K ++  +G  +
Sbjct: 195 FAKSSFELALKR-----KLPLFFATKNTILKEYDGLFKDIFEKLYKDHYKTKFEELGITF 249

Query: 235 NEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIV--G 292
             +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  V  D  V   
Sbjct: 250 EHRLIDDMVAQMLKSNGGF-ILSLKNYDGDVQSDIVAQGFGSLGLMTSMLVTPDDSVFES 308

Query: 293 EPCHGS 298
           E  HG+
Sbjct: 309 EAAHGT 314

>YDL066W Chr4 (334835..336121) [1287 bp, 428 aa] {ON}
           IDP1Mitochondrial NADP-specific isocitrate
           dehydrogenase, catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate; not required for mitochondrial
           respiration and may function to divert
           alpha-ketoglutarate to biosynthetic processes
          Length = 428

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 61/115 (53%), Gaps = 6/115 (5%)

Query: 189 RLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESN-KERYGAIG--YNEQIVDSMVYR 245
           +L  + K  L ++ K+ +L + DG F+++ + VYE+  K ++  +G  Y  +++D MV +
Sbjct: 215 KLAIDKKLNLFLSTKNTILKKYDGRFKDIFQEVYEAQYKSKFEQLGIHYEHRLIDDMVAQ 274

Query: 246 LFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD--FIVGEPCHGS 298
           + +    F ++   N  GD+ SD  A   GSLG++ S  V  D      E  HG+
Sbjct: 275 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 328

>Skud_4.189 Chr4 (330300..331589) [1290 bp, 429 aa] {ON} YDL066W
           (REAL)
          Length = 429

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 61/115 (53%), Gaps = 6/115 (5%)

Query: 189 RLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESN-KERYGAIG--YNEQIVDSMVYR 245
           +L  + K  L ++ K+ +L + DG F+++ + VYE+  K ++  +G  Y  +++D MV +
Sbjct: 216 KLAIDKKLNLFLSTKNTILKKYDGRFKDIFQEVYEAEYKSKFEKLGIHYEHRLIDDMVAQ 275

Query: 246 LFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD--FIVGEPCHGS 298
           + +    F ++   N  GD+ SD  A   GSLG++ S  V  D      E  HG+
Sbjct: 276 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 329

>TDEL0E01160 Chr5 (234217..235488) [1272 bp, 423 aa] {ON} Anc_4.254
           YDL066W
          Length = 423

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 84/182 (46%), Gaps = 19/182 (10%)

Query: 189 RLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESN-KERYGA--IGYNEQIVDSMVYR 245
           +L  N K  L ++ K+ +L + DG F+++ + ++++  K ++ A  I Y  +++D MV +
Sbjct: 210 KLALNKKLNLFLSTKNTILKKYDGRFKDIFQEIFDAEYKTQFEAANISYEHRLIDDMVAQ 269

Query: 246 LFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD--FIVGEPCHGS----- 298
           + +    F ++   N  GD+ SD  A   GSLG++ S  V  D      E  HG+     
Sbjct: 270 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHY 328

Query: 299 -----APDIAGKGISNPIATIRSTALMLEFMG---YTEAAQDIHKAVDTNIRENQIKTPD 350
                  + +   I++  A  R  A   E  G    T+ A  +  A    ++E+ I T D
Sbjct: 329 RQYQQGKETSTNSIASIFAWTRGLAKRGELDGTPEVTKFANLLESATLNTVQEDGIMTKD 388

Query: 351 LG 352
           L 
Sbjct: 389 LA 390

>Kpol_1048.70 s1048 complement(198298..199557) [1260 bp, 419 aa]
           {ON} complement(198298..199557) [1260 nt, 420 aa]
          Length = 419

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 57/106 (53%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREVCKNVYESN-KERYGA--IGYNEQIVDSMVYRLFREPECFD 254
           L  T K+ +L + DG ++++  ++YE + K+++ A  I Y  +++D MV ++ +    F 
Sbjct: 212 LYSTTKNTILKKYDGQYKDIFNDMYEKDYKDKFEAKGIWYEHRLIDDMVAQMLKSKGGF- 270

Query: 255 VIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD--FIVGEPCHGS 298
           VI   N  GD+ SD  A   GSLG++ S  +  D      E  HG+
Sbjct: 271 VIAMKNYDGDVQSDVVAQGFGSLGLMSSILISDDGKTFESEAAHGT 316

>NDAI0G00850 Chr7 (179074..180333) [1260 bp, 419 aa] {ON} Anc_1.396
          Length = 419

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 65/126 (51%), Gaps = 11/126 (8%)

Query: 178 IAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESN-KERYGAIG--Y 234
            AK +  ++L+R     K  L +  K+ +L + DG F+ +  ++Y++  KE++  +G  Y
Sbjct: 195 FAKASFIMALKR-----KLPLFLATKNTILKKYDGRFKSIFDDMYQNEFKEKFEKLGLTY 249

Query: 235 NEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD--FIVG 292
             +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  +  D      
Sbjct: 250 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSQLITPDGKTFQS 308

Query: 293 EPCHGS 298
           E  HG+
Sbjct: 309 EAAHGT 314

>KLLA0B03355g Chr2 (303444..304733) [1290 bp, 429 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066W IDP1 Mitochondrial NADP-specific isocitrate
           dehydrogenase catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate not required for mitochondrial
           respiration and may function to divert alpha-
           ketoglutarate to biosynthetic processes
          Length = 429

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 68/271 (25%), Positives = 120/271 (44%), Gaps = 32/271 (11%)

Query: 100 VEGYSSPIVALRKKLGLYANVRPVKSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKT 159
           V G+  PIV     +G +A+    K+       P  + +V + T+    KT + Y  +  
Sbjct: 140 VPGWEKPIV-----IGRHAHGDQYKATDLVVPGPGKLELVYKPTDGSETKTLEVY--DYK 192

Query: 160 GTRVAEAIKRISETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCK 219
           G  +A A+    E +    A  + ++++ +     K  L ++ K+ +L + DG F+++ +
Sbjct: 193 GPGIALAMYNTDE-SIRGFAHASFKLAITK-----KLNLYLSTKNTILKKYDGRFKDIFQ 246

Query: 220 NVYESN-KERYGAIG--YNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGS 276
            +Y+S  K  +  +G  Y  +++D MV ++ +    F ++   N  GD+ SD  A   GS
Sbjct: 247 EIYDSEYKSEFEKLGIWYEHRLIDDMVAQMIKSKGGF-ILAFKNYDGDVQSDIVAQGFGS 305

Query: 277 LGVVPSANVGHD--FIVGEPCHGSAPDI-----AGKGIS-NPIATIRSTALMLEFMG--- 325
           LG++ S  V  D      E  HG+          GK  S N IA+I +    L   G   
Sbjct: 306 LGLMTSVLVTPDGKAFESEAAHGTVTRHYRQYQQGKETSTNSIASIFAWTRGLAKRGELD 365

Query: 326 ----YTEAAQDIHKAVDTNIRENQIKTPDLG 352
                 E A  + K+    ++E+ I T DL 
Sbjct: 366 NTPEVVEFANLLEKSTLNTVQEDGIMTKDLA 396

>NDAI0D04360 Chr4 (1024297..1025571) [1275 bp, 424 aa] {ON}
           Anc_4.254
          Length = 424

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 61/115 (53%), Gaps = 6/115 (5%)

Query: 189 RLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESN---KERYGAIGYNEQIVDSMVYR 245
           +L  + K  L ++ K+ +L + DG F+++ +++YE++   K +   I Y  +++D MV +
Sbjct: 215 KLAIDKKLNLFLSTKNTILKKYDGRFKDIFQSIYETHYKAKFQQLNINYEHRLIDDMVAQ 274

Query: 246 LFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD--FIVGEPCHGS 298
           + +    F ++   N  GD+ SD  A   GSLG++ S  V  D      E  HG+
Sbjct: 275 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 328

>KAFR0G03260 Chr7 complement(675642..676907) [1266 bp, 421 aa] {ON}
           Anc_4.254 YDL066W
          Length = 421

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 82/177 (46%), Gaps = 19/177 (10%)

Query: 193 NGKATLTVTHKSNVLSQSDGLFREVCKNVYESN-KERYGAIG--YNEQIVDSMVYRLFRE 249
           N K  L +  K+ +L + DG F+++ + +Y    K ++  +G  Y  +++D MV ++ + 
Sbjct: 214 NKKLNLFLATKNTILKKYDGRFKDIFQQIYNGQYKAKFEQLGITYEHRLIDDMVAQMIKS 273

Query: 250 PECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD--FIVGEPCHGSAP------D 301
              F ++   N  GD+ SD  A   GSLG++ S  V  D      E  HG+         
Sbjct: 274 KGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVSPDGKTFESEAAHGTVTRHFRRHQ 332

Query: 302 IAGKGISNPIATIRSTALMLEFMGYTEAAQDI-------HKAVDTNIRENQIKTPDL 351
           +  +  +N IA+I + +  L   G  +  +D+         A   +++E+ I T DL
Sbjct: 333 MGEETSTNSIASIFAWSRGLAKRGELDGTKDVIAFANKLEAATLDSVQEDGIMTKDL 389

>CAGL0D00770g Chr4 (95715..96986) [1272 bp, 423 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066w IDP1 isocitrate dehydrogenase or uniprot|P41939
           Saccharomyces cerevisiae YLR174w IDP2 or uniprot|P53982
           Saccharomyces cerevisiae YNL009w IDP3
          Length = 423

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 66/126 (52%), Gaps = 11/126 (8%)

Query: 178 IAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESN-KERYGA--IGY 234
            A  + +++LQ+     K  L ++ K+ +L + DG F+++ + VY+S  K+++    I Y
Sbjct: 204 FAHSSFKLALQK-----KLNLFLSTKNTILKKYDGRFKDIFQEVYDSEYKQKFAELNITY 258

Query: 235 NEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD--FIVG 292
             +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  +  D      
Sbjct: 259 EHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILITPDGKTFES 317

Query: 293 EPCHGS 298
           E  HG+
Sbjct: 318 EAAHGT 323

>AER061C Chr5 complement(749709..750986) [1278 bp, 425 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL066W
           (IDP1)
          Length = 425

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 68/138 (49%), Gaps = 14/138 (10%)

Query: 189 RLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNK----ERYGAIGYNEQIVDSMVY 244
           RL    +  L ++ K+ +L Q DG F++V + +Y++      ER G I Y  +++D MV 
Sbjct: 215 RLALAKQLNLFLSTKNTILKQYDGRFKDVFEELYQAQYKAEFERLG-IYYEHRLIDDMVA 273

Query: 245 RLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD--FIVGEPCHGSA--- 299
           ++ +    F ++   N  GD+ SD  A   GSLG++ S  V  D      E  HG+    
Sbjct: 274 QMVKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGTVTRH 332

Query: 300 --PDIAGKGIS-NPIATI 314
                AGK  S N IA+I
Sbjct: 333 FRQHQAGKETSTNSIASI 350

>SAKL0H02860g Chr8 (280944..282209) [1266 bp, 421 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066W IDP1 Mitochondrial NADP-specific isocitrate
           dehydrogenase catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate not required for mitochondrial
           respiration and may function to divert alpha-
           ketoglutarate to biosynthetic processes
          Length = 421

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 61/115 (53%), Gaps = 6/115 (5%)

Query: 189 RLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESN-KERYGAIG--YNEQIVDSMVYR 245
           +L    K  L ++ K+ +L + DG F+++ + +Y++  K+++ A G  Y  +++D MV +
Sbjct: 208 KLALTKKLNLYLSTKNTILKKYDGRFKDIFQELYDAEYKKQFEAAGIYYEHRLIDDMVAQ 267

Query: 246 LFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD--FIVGEPCHGS 298
           + +    F ++   N  GD+ SD  A   GSLG++ S  V  D      E  HG+
Sbjct: 268 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGT 321

>KLTH0D14476g Chr4 complement(1184813..1186075) [1263 bp, 420 aa]
           {ON} highly similar to uniprot|P21954 Saccharomyces
           cerevisiae YDL066W IDP1 Mitochondrial NADP-specific
           isocitrate dehydrogenase catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate not required for
           mitochondrial respiration and may function to divert
           alpha- ketoglutarate to biosynthetic processes
          Length = 420

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 59/116 (50%), Gaps = 8/116 (6%)

Query: 189 RLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNK----ERYGAIGYNEQIVDSMVY 244
           RL  + +  L +  K+ +L Q DG F+++ + +Y++      ER G I Y  +++D MV 
Sbjct: 207 RLALSKQLNLFLATKNTILKQYDGRFKDLFQQLYDAEYREAFERAG-ISYEHRLIDDMVA 265

Query: 245 RLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD--FIVGEPCHGS 298
           ++ +    F V+   N  GD+ SD  A   GSLG++ S  +  D      E  HG+
Sbjct: 266 QMIKSRGGF-VLALKNYDGDVQSDIVAQGFGSLGLMSSVLITPDGNAFESEAAHGT 320

>NCAS0G03620 Chr7 complement(675224..676480) [1257 bp, 418 aa] {ON}
           Anc_1.396
          Length = 418

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 56/216 (25%), Positives = 101/216 (46%), Gaps = 32/216 (14%)

Query: 178 IAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVY-ESNKERYGAIG--Y 234
            A+ + ++++++     K  L  T K+ +L + DG F+++   +Y    K+ +  +G  Y
Sbjct: 196 FARASFQMAIKK-----KIPLYFTTKNTILKKYDGTFKDIFMEMYLNEYKDEFDKLGIFY 250

Query: 235 NEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD--FIVG 292
             +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  +  D      
Sbjct: 251 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFQS 309

Query: 293 EPCHGSAP-----DIAGKGIS-NPIATIRSTALMLEFMGYTEAAQDIHK--------AVD 338
           E  HG+         AGK  S N IA+I + +  L   G  +   D+ K         +D
Sbjct: 310 EAAHGTVTRHYRLHQAGKPTSTNSIASIFAWSRGLIQRGKLDNNPDLVKFGELLEQSTLD 369

Query: 339 TNIRENQIKTPDL------GGKSTTQQVVDDILSKM 368
           T ++ + I T DL      G  +TT+  +D + ++M
Sbjct: 370 T-VQIDGIMTKDLALLIGQGKYATTEGFIDAVTNRM 404

>NDAI0G05160 Chr7 complement(1250883..1252145) [1263 bp, 420 aa]
           {ON} Anc_1.396
          Length = 420

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 60/123 (48%), Gaps = 11/123 (8%)

Query: 182 ALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYG---AIGYNEQI 238
           + +++L+R     K  L  T K+ +L + DG F+++ +N+YE           I Y  ++
Sbjct: 204 SFKLALER-----KMPLYSTTKNTILKRYDGKFKDIFENMYEEQFREQFEELGIWYEHRL 258

Query: 239 VDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD--FIVGEPCH 296
           +D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  +  D      E  H
Sbjct: 259 IDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLISSDGKSFESEAAH 317

Query: 297 GSA 299
           G+ 
Sbjct: 318 GTV 320

>NCAS0A02510 Chr1 complement(476363..477643) [1281 bp, 426 aa] {ON}
           Anc_4.254
          Length = 426

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 59/115 (51%), Gaps = 6/115 (5%)

Query: 189 RLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESN-KERYGAIG--YNEQIVDSMVYR 245
           +L    K  L ++ K+ +L + DG F+++ + +++   K ++  +G  Y  +++D MV +
Sbjct: 213 KLALTKKLNLFLSTKNTILKKYDGRFKDIFQEIFDMEYKTKFANLGISYEHRLIDDMVAQ 272

Query: 246 LFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD--FIVGEPCHGS 298
           + +    F ++   N  GD+ SD  A   GSLG++ S  V  D      E  HG+
Sbjct: 273 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 326

>KNAG0D04410 Chr4 complement(799414..800700) [1287 bp, 428 aa] {ON}
           Anc_4.254 YDL066W
          Length = 428

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 69/137 (50%), Gaps = 12/137 (8%)

Query: 189 RLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESN-KERY--GAIGYNEQIVDSMVYR 245
           +L  + K  L ++ K+ +L + DG F+++ + ++++  K+++    I Y  +++D MV +
Sbjct: 215 KLALSKKLDLFLSTKNTILKRYDGRFKDLFQEIFDAEYKQQFEESGIQYQHRLIDDMVAQ 274

Query: 246 LFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD--FIVGEPCHGSAPDIA 303
           + +    F ++   N  GD+ SD  A   GSLG++ S  V  D      E  HG+     
Sbjct: 275 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHY 333

Query: 304 GK------GISNPIATI 314
            K        +NPIA+I
Sbjct: 334 RKYQRGEETSTNPIASI 350

>ZYRO0B12496g Chr2 complement(1007086..1008354) [1269 bp, 422 aa]
           {ON} highly similar to uniprot|P21954 Saccharomyces
           cerevisiae YDL066W IDP1 Mitochondrial NADP-specific
           isocitrate dehydrogenase catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate not required for
           mitochondrial respiration and may function to divert
           alpha- ketoglutarate to biosynthetic processes
          Length = 422

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 58/115 (50%), Gaps = 6/115 (5%)

Query: 189 RLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKE---RYGAIGYNEQIVDSMVYR 245
           +L  + K  L ++ K+ +L + DG F+++ + +Y++  +       I Y  +++D MV +
Sbjct: 209 KLALDKKLNLYLSTKNTILKKYDGRFKDIFQELYDTQYKAEFEKAGIFYEHRLIDDMVAQ 268

Query: 246 LFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD--FIVGEPCHGS 298
           + +    F ++   N  GD+ SD  A   GSLG++ S  +  D      E  HG+
Sbjct: 269 MVKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFESEAAHGT 322

>Ecym_3265 Chr3 (504267..505541) [1275 bp, 424 aa] {ON} similar to
           Ashbya gossypii AER061C
          Length = 424

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 52/98 (53%), Gaps = 6/98 (6%)

Query: 189 RLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNK----ERYGAIGYNEQIVDSMVY 244
           +L    K  L ++ K+ +L   DG F+++ + +Y++      E +G I Y  +++D MV 
Sbjct: 211 KLALTKKLNLFLSTKNTILKTYDGRFKDIFQELYDTQYKTEFENHG-IYYEHRLIDDMVA 269

Query: 245 RLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPS 282
           ++ +    F ++   N  GD+ SD  A   GSLG++ S
Sbjct: 270 QMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTS 306

>Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C
           (REAL)
          Length = 53

 Score = 40.4 bits (93), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%)

Query: 319 LMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQQVVDDILSKM 368
           LML  +G  E+A  I KAV   I E +  T D+GG S+T    ++I++K+
Sbjct: 1   LMLNHLGLNESATRISKAVHETIAEGKHTTRDIGGSSSTTDFTNEIINKL 50

>TBLA0A08010 Chr1 (1981576..1982862) [1287 bp, 428 aa] {ON}
           Anc_4.254 YDL066W
          Length = 428

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 55/114 (48%), Gaps = 6/114 (5%)

Query: 190 LKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGA---IGYNEQIVDSMVYRL 246
           L  N    L +  K+ +L + DG F+++ + +YE+  ++      I Y  +++D MV ++
Sbjct: 214 LAVNKNMNLFLATKNTILKKYDGRFKDIFQEIYENEYKKEFERLNITYEHRLIDDMVAQM 273

Query: 247 FREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHD--FIVGEPCHGS 298
            +    + ++   N  GD+ SD  A   GSLG++ S     D      E  HG+
Sbjct: 274 IKSKGGY-IMALKNYDGDVQSDIVAQGFGSLGLMTSILASPDGKTFESEAAHGT 326

>Suva_16.483 Chr16 complement(831888..833729) [1842 bp, 613 aa] {ON}
           YPR155C (REAL)
          Length = 613

 Score = 34.3 bits (77), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 16/77 (20%), Positives = 38/77 (49%)

Query: 159 TGTRVAEAIKRISETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVC 218
           T  R+ ++ + I+ +    + K+ L++  Q ++ + K T  +    + L Q   +  +VC
Sbjct: 3   TNRRILKSFEEINHSLEESLQKVTLDLQQQLVQDDNKETRELARLQDQLQQVRSIVEKVC 62

Query: 219 KNVYESNKERYGAIGYN 235
            ++   N E Y +I ++
Sbjct: 63  VSIKSDNVESYCSISFD 79

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,277,122
Number of extensions: 1535193
Number of successful extensions: 4581
Number of sequences better than 10.0: 140
Number of HSP's gapped: 4357
Number of HSP's successfully gapped: 140
Length of query: 368
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 257
Effective length of database: 40,753,473
Effective search space: 10473642561
Effective search space used: 10473642561
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)