Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E07634g2.288ON97497450840.0
KLTH0G10406g2.288ON96390028780.0
NDAI0G006702.288ON96893928410.0
Kwal_27.115182.288ON95393127870.0
NCAS0G037802.288ON95795027580.0
KAFR0H033002.288ON96691927500.0
Suva_14.3242.288ON96894227300.0
Smik_14.3082.288ON96593327210.0
YNL023C (FAP1)2.288ON96591027180.0
KNAG0H019902.288ON97392026880.0
TDEL0G021902.288ON93694926770.0
Skud_14.3062.288ON97090726670.0
TBLA0B059502.288ON99594726170.0
CAGL0M06919g2.288ON95689625040.0
ZYRO0A01936g2.288ON95390925010.0
KLLA0E08317g2.288ON92189124670.0
Kpol_1039.452.288ON96890724370.0
Ecym_33272.288ON92690024300.0
ADL213W2.288ON90889324140.0
TPHA0D015302.288ON96290423630.0
SAKL0H05544g8.718ON82172744.4
KNAG0G028008.718ON82972744.5
Ecym_23558.718ON83644744.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E07634g
         (974 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E07634g Chr5 complement(616444..619368) [2925 bp, 974 aa] {...  1962   0.0  
KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} simila...  1113   0.0  
NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.2...  1098   0.0  
Kwal_27.11518 s27 complement(832986..835847) [2862 bp, 953 aa] {...  1078   0.0  
NCAS0G03780 Chr7 complement(696877..699750) [2874 bp, 957 aa] {O...  1066   0.0  
KAFR0H03300 Chr8 complement(627520..630420) [2901 bp, 966 aa] {O...  1063   0.0  
Suva_14.324 Chr14 complement(571146..574052) [2907 bp, 968 aa] {...  1056   0.0  
Smik_14.308 Chr14 complement(550650..553547) [2898 bp, 965 aa] {...  1052   0.0  
YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON} ...  1051   0.0  
KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {O...  1040   0.0  
TDEL0G02190 Chr7 (430157..432967) [2811 bp, 936 aa] {ON} Anc_2.2...  1035   0.0  
Skud_14.306 Chr14 complement(558943..561855) [2913 bp, 970 aa] {...  1031   0.0  
TBLA0B05950 Chr2 (1404509..1407496) [2988 bp, 995 aa] {ON} Anc_2...  1012   0.0  
CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa] ...   969   0.0  
ZYRO0A01936g Chr1 (159749..162610) [2862 bp, 953 aa] {ON} simila...   967   0.0  
KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {...   954   0.0  
Kpol_1039.45 s1039 (135833..138739) [2907 bp, 968 aa] {ON} (1358...   943   0.0  
Ecym_3327 Chr3 (626396..629176) [2781 bp, 926 aa] {ON} similar t...   940   0.0  
ADL213W Chr4 (329646..332372) [2727 bp, 908 aa] {ON} Syntenic ho...   934   0.0  
TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {O...   914   0.0  
SAKL0H05544g Chr8 (497300..499765) [2466 bp, 821 aa] {ON} simila...    33   4.4  
KNAG0G02800 Chr7 complement(619337..621826) [2490 bp, 829 aa] {O...    33   4.5  
Ecym_2355 Chr2 (694551..697061) [2511 bp, 836 aa] {ON} similar t...    33   4.8  

>SAKL0E07634g Chr5 complement(616444..619368) [2925 bp, 974 aa] {ON}
           similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023C
          Length = 974

 Score = 1962 bits (5084), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 963/974 (98%), Positives = 963/974 (98%)

Query: 1   MDKHVSPLRVSSELPDSHSTSEYSSSGDASDDHENYXXXXXXXXXXXLPYYEKTIHEIQK 60
           MDKHVSPLRVSSELPDSHSTSEYSSSGDASDDHENY           LPYYEKTIHEIQK
Sbjct: 1   MDKHVSPLRVSSELPDSHSTSEYSSSGDASDDHENYTSDTEDDESDDLPYYEKTIHEIQK 60

Query: 61  GDSYACMICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLDKTWKCPNCYYVNS 120
           GDSYACMICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLDKTWKCPNCYYVNS
Sbjct: 61  GDSYACMICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLDKTWKCPNCYYVNS 120

Query: 121 EIPVKNRHTCWCGKVVHPESNPIDPNSCGQTCNAPICSHGCSKPCHLGPHPECMRTTKVK 180
           EIPVKNRHTCWCGKVVHPESNPIDPNSCGQTCNAPICSHGCSKPCHLGPHPECMRTTKVK
Sbjct: 121 EIPVKNRHTCWCGKVVHPESNPIDPNSCGQTCNAPICSHGCSKPCHLGPHPECMRTTKVK 180

Query: 181 CLCGKHTKDMFCYQSEEEKASYQCGEPCNLLLPCGVHKCQRKCHSGPCGNCEETISGKIM 240
           CLCGKHTKDMFCYQSEEEKASYQCGEPCNLLLPCGVHKCQRKCHSGPCGNCEETISGKIM
Sbjct: 181 CLCGKHTKDMFCYQSEEEKASYQCGEPCNLLLPCGVHKCQRKCHSGPCGNCEETISGKIM 240

Query: 241 CYCGMETREQIICKDVKSVAKSKNKSGEIWIGVFSCAHLRSVEYSCGHHSFQESCTAPPT 300
           CYCGMETREQIICKDVKSVAKSKNKSGEIWIGVFSCAHLRSVEYSCGHHSFQESCTAPPT
Sbjct: 241 CYCGMETREQIICKDVKSVAKSKNKSGEIWIGVFSCAHLRSVEYSCGHHSFQESCTAPPT 300

Query: 301 NSGELACPFSPRLLKTCPCGSTPLKLLEAPRKKCTDPIPTCENRCNKPLKCGKHSCPFVC 360
           NSGELACPFSPRLLKTCPCGSTPLKLLEAPRKKCTDPIPTCENRCNKPLKCGKHSCPFVC
Sbjct: 301 NSGELACPFSPRLLKTCPCGSTPLKLLEAPRKKCTDPIPTCENRCNKPLKCGKHSCPFVC 360

Query: 361 HDGPCMDPCVSVDKVSCSCHSKSFLVPCQFHDEAHCNTKCESLMSCRRHRCTERCCSGRS 420
           HDGPCMDPCVSVDKVSCSCHSKSFLVPCQFHDEAHCNTKCESLMSCRRHRCTERCCSGRS
Sbjct: 361 HDGPCMDPCVSVDKVSCSCHSKSFLVPCQFHDEAHCNTKCESLMSCRRHRCTERCCSGRS 420

Query: 421 LAIKREKTIFLARDRLDESLVEAQHICLKPCNLKLSCGIHYCRRKCHPGKCSPCLESDSN 480
           LAIKREKTIFLARDRLDESLVEAQHICLKPCNLKLSCGIHYCRRKCHPGKCSPCLESDSN
Sbjct: 421 LAIKREKTIFLARDRLDESLVEAQHICLKPCNLKLSCGIHYCRRKCHPGKCSPCLESDSN 480

Query: 481 DLSCPCGKTVVPAPVRCGTKLPPCRHPCIKTLQADTVCGHPPMPHECHSLEQPCPQCTAP 540
           DLSCPCGKTVVPAPVRCGTKLPPCRHPCIKTLQADTVCGHPPMPHECHSLEQPCPQCTAP
Sbjct: 481 DLSCPCGKTVVPAPVRCGTKLPPCRHPCIKTLQADTVCGHPPMPHECHSLEQPCPQCTAP 540

Query: 541 IYKKCKCNKVEKVRTLCFQNDVSCGKICGLPLKNCSHTCKRTCHEPGQCQTICKQICGLP 600
           IYKKCKCNKVEKVRTLCFQNDVSCGKICGLPLKNCSHTCKRTCHEPGQCQTICKQICGLP
Sbjct: 541 IYKKCKCNKVEKVRTLCFQNDVSCGKICGLPLKNCSHTCKRTCHEPGQCQTICKQICGLP 600

Query: 601 RKFCEHKCFARCHPGKDCPDEACQVKVKVTCSCGRKESILPCDAHADQPSSKLLITLPCD 660
           RKFCEHKCFARCHPGKDCPDEACQVKVKVTCSCGRKESILPCDAHADQPSSKLLITLPCD
Sbjct: 601 RKFCEHKCFARCHPGKDCPDEACQVKVKVTCSCGRKESILPCDAHADQPSSKLLITLPCD 660

Query: 661 DKCEESKRHRMLMEAFGIKEKLTAPVEELRDLVESAKSFDELHLPFTESTLSVYSKQRAW 720
           DKCEESKRHRMLMEAFGIKEKLTAPVEELRDLVESAKSFDELHLPFTESTLSVYSKQRAW
Sbjct: 661 DKCEESKRHRMLMEAFGIKEKLTAPVEELRDLVESAKSFDELHLPFTESTLSVYSKQRAW 720

Query: 721 CNQIESFLSKLMRDVTRTSLHFKPMKLPQRRFIHELANAYALYSESQDREPKRSVFVKKV 780
           CNQIESFLSKLMRDVTRTSLHFKPMKLPQRRFIHELANAYALYSESQDREPKRSVFVKKV
Sbjct: 721 CNQIESFLSKLMRDVTRTSLHFKPMKLPQRRFIHELANAYALYSESQDREPKRSVFVKKV 780

Query: 781 ENKSHIPLLCLGEALPLYHSFKQLQKERKVKELEKSTTRRLFNYTVDDANDVPHNAEFNC 840
           ENKSHIPLLCLGEALPLYHSFKQLQKERKVKELEKSTTRRLFNYTVDDANDVPHNAEFNC
Sbjct: 781 ENKSHIPLLCLGEALPLYHSFKQLQKERKVKELEKSTTRRLFNYTVDDANDVPHNAEFNC 840

Query: 841 FLVKGVAPGVTKDELSDCLAEYLQFTLIQNPSYQTLENGDFLIYPEDHMSISENVENDIK 900
           FLVKGVAPGVTKDELSDCLAEYLQFTLIQNPSYQTLENGDFLIYPEDHMSISENVENDIK
Sbjct: 841 FLVKGVAPGVTKDELSDCLAEYLQFTLIQNPSYQTLENGDFLIYPEDHMSISENVENDIK 900

Query: 901 RLAPYISSICKEKQISEGVKLYKIDENLKTFTSEEYLQEEQPEKQASFEINTDGEVAVIN 960
           RLAPYISSICKEKQISEGVKLYKIDENLKTFTSEEYLQEEQPEKQASFEINTDGEVAVIN
Sbjct: 901 RLAPYISSICKEKQISEGVKLYKIDENLKTFTSEEYLQEEQPEKQASFEINTDGEVAVIN 960

Query: 961 TDKGTCEFPDSVST 974
           TDKGTCEFPDSVST
Sbjct: 961 TDKGTCEFPDSVST 974

>KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} similar
           to uniprot|P53971 Saccharomyces cerevisiae YNL023C
          Length = 963

 Score = 1113 bits (2878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/900 (58%), Positives = 665/900 (73%), Gaps = 8/900 (0%)

Query: 49  PYYEKTIHEIQKGDSYACMICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLDK 108
           PYYEKTI EI KGD Y CMICT+EMD+TCHMYACPECYRV+D+ECIREWA+KS+QKS+ K
Sbjct: 62  PYYEKTIKEIAKGDRYPCMICTVEMDFTCHMYACPECYRVFDYECIREWAVKSTQKSVTK 121

Query: 109 TWKCPNCYYVNSEIPVKNRHTCWCGKVVHPESNPIDPNSCGQTCNAPICSHGCSKPCHLG 168
           TWKCPNCY+   ++P+KNR TCWCGK +HPE NP++PNSCGQTC+APIC HGCS  CHLG
Sbjct: 122 TWKCPNCYFEKKDVPLKNRPTCWCGKNIHPEPNPLNPNSCGQTCDAPICVHGCSSTCHLG 181

Query: 169 PHPECMRTTKVKCLCGKHTKDMFCYQSEEEKASYQCGEPCNLLLPCGVHKCQRKCHSGPC 228
           PHP CMR  + KC CGK +KD+FC ++ + +  ++CG PC L LPCGVHKCQR+CH+G C
Sbjct: 182 PHPTCMRMVQTKCRCGKKSKDVFCSEARKHQELFRCGNPCGLTLPCGVHKCQRECHNGVC 241

Query: 229 GNCEETISGKIMCYCGMETREQIICKDVKSVAKSKNKSGEIWIGVFSCAHLRSVEYSCGH 288
           G C ETI+ +I CYCG+E+   I C+DVK  +KS++ SG+ WIG F+C+ +R+VEYSC  
Sbjct: 242 GECPETIAKEINCYCGLESLPSIKCQDVKIQSKSQDGSGKKWIGAFACSRIRTVEYSCRE 301

Query: 289 HSFQESCTAPPTNSGELACPFSPRLLKTCPCGSTPLKLLEAPRKKCTDPIPTCENRCNKP 348
           HSF E C APP+ +G + CP+SP+ LKTCPCG TPL+ +E PR KCTDPIPTC+  C K 
Sbjct: 302 HSFAEPCKAPPSIAGRIPCPYSPKALKTCPCGETPLENMETPRTKCTDPIPTCDATCGKL 361

Query: 349 LKCGKHSCPFVCHDGPCMDPCVSVDKVSCSCHSKSFLVPCQFHDEAHCNTKCESLMSCRR 408
           L CG+H CPF CH G CM+ C   DK+ CSC+S+ F+VPC+F     CNTKCESLMSCRR
Sbjct: 362 LSCGRHRCPFKCHTGTCMEICTCSDKIKCSCNSRPFIVPCKFQGPPRCNTKCESLMSCRR 421

Query: 409 HRCTERCCSGRSLAIKREKTIFLARDRLDESLVEAQHICLKPCNLKLSCGIHYCRRKCHP 468
           HRC ERCC GRSLA  REK +FL RD+LDESLVEAQHICLK CNLKLSCG H+C+RKCHP
Sbjct: 422 HRCAERCCDGRSLAQVREKKVFLTRDKLDESLVEAQHICLKKCNLKLSCGRHFCQRKCHP 481

Query: 469 GKCSPCLESDSNDLSCPCGKTVVPAPVRCGTKLPPCRHPCIKTLQADTVCGHPPMPHECH 528
           G C PCLESDSNDL CPCGKTV PAPVRCGT LPPCR+PCIKTLQ    CGHPPMPH CH
Sbjct: 482 GNCPPCLESDSNDLVCPCGKTVAPAPVRCGTVLPPCRNPCIKTLQGPLDCGHPPMPHACH 541

Query: 529 SLEQPCPQCTAPIYKKCKCNKVEKVRTLCFQNDVSCGKICGLPLKNCSHTCKRTCHEPGQ 588
           SL++PCP CTAP++K+CKC K +KVRTLCFQN+VSCG++CG  L +C H+C +TCH  G+
Sbjct: 542 SLDEPCPSCTAPVFKQCKCGKNKKVRTLCFQNNVSCGRVCGKQLVSCHHSCTKTCHREGE 601

Query: 589 CQTICKQICGLPRKFCEHKCFARCHPGKDCPDEACQVKVKVTCSCGRKESILPCDAHADQ 648
           CQ+ICKQ+CG+ R  C H C  +CH G  CPD  C V V+V C CG + S   C AH  Q
Sbjct: 602 CQSICKQVCGISRSNCSHICRFKCHTGSPCPDVPCNVTVEVKCGCGHRSSFATCAAHEGQ 661

Query: 649 PSSKLLITLPCDDKCEESKRHRMLMEAFGIKEKLTAPVEELRD---LVESAKSFDELHLP 705
             +     L C + C  ++R   LMEAFG+  +   P E + D   L E   +F EL LP
Sbjct: 662 DPADQR-PLECTEDCAAARRRLELMEAFGMNTETVQPTEGIVDLAALAEKVTTFQELMLP 720

Query: 706 FTESTLSVYSKQRAWCNQIESFLSKLMRDVTRTSLHFKPMKLPQRRFIHELANAYALYSE 765
           FTE++LS+++KQ  WC+QIE  L++LM D+++ SLHFKPMK PQR FIHELA AY LY E
Sbjct: 721 FTEASLSIFAKQSNWCSQIEEHLNRLMSDISKPSLHFKPMKPPQRHFIHELAQAYKLYCE 780

Query: 766 SQDREPKRSVFVKKVENKSHIPLLCLGEALPLYHSFKQLQKERKVKELEKSTTRRLFNYT 825
           SQD+EPKRSV+VKK  + S  P L L EALPLY SFK  QKERK+KELE+STT R+ NYT
Sbjct: 781 SQDKEPKRSVYVKKTVD-SRKPSLSLKEALPLYQSFKNAQKERKLKELERSTTTRILNYT 839

Query: 826 VDDANDVPHNAEFNCFLVKGVAPGVTKDELSDCLAEYLQFTLIQNPSYQTLENGDFLIYP 885
                  P  A+ N  L++ V  G  +  +  C A+YL+ TLI++P+Y  L++GD +++ 
Sbjct: 840 -STGESSPPVAQINGLLIQKVFEGTDEKTIEACFADYLKHTLIKDPNYLKLDSGDVMVFA 898

Query: 886 EDHMSISENVENDIKRLAPYISSICKEKQISEGVKLYKIDENL--KTFTSEEYLQEEQPE 943
           E++ + S NVE DI R+  ++  I K+  ++EGV + ++++ +  +T  S+E    E PE
Sbjct: 899 ENYATASINVERDINRVVGHLDLIAKDSFLAEGVTVCRVEQVMAEETNRSDESSVAEAPE 958

>NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.288
           YNL023C
          Length = 968

 Score = 1098 bits (2841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/939 (57%), Positives = 671/939 (71%), Gaps = 19/939 (2%)

Query: 8   LRVSSELPDSHSTSEYSSSGDASDDHENYXXXXXXXXXXXLPYYEKTIHEIQKGDSYACM 67
           L+ S++   S      +S  D  D  + Y           + YYE+TI EI KGDSY CM
Sbjct: 20  LQASADEIKSSENVSSTSDNDEYDQEDEYAAATAADED--MKYYERTIQEIAKGDSYVCM 77

Query: 68  ICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLDKTWKCPNCYYVNSEIPVKNR 127
           ICT+EMDYTC MYAC ECYRV+D++CIREWA+KS++K++D+ WKCPNCY+VN ++P KNR
Sbjct: 78  ICTVEMDYTCQMYACKECYRVFDYDCIREWAVKSTEKTVDRIWKCPNCYHVNKKVPPKNR 137

Query: 128 HTCWCGKVVHPESNPIDPNSCGQTCNAPICSHGCSKPCHLGPHPECMRTTKVKCLCGKHT 187
            TCWCGKVV+PE+NP++PNSCGQTCNA IC HGC+  CHLGPHPEC R   + C CGKHT
Sbjct: 138 STCWCGKVVNPEANPLNPNSCGQTCNAKICVHGCTNICHLGPHPECTRMLSITCRCGKHT 197

Query: 188 KDMFCYQSEEEKAS--YQCGEPCNLLLPCGVHKCQRKCHSGPCGNCEETI------SGKI 239
           KD+FCYQS+  K +  +QC + C L L CG+HKC+RKCHSG CG C E +      +  +
Sbjct: 198 KDIFCYQSKTFKGNSKFQCKDECGLPLSCGIHKCKRKCHSGLCGVCPERLEVNEENAWIL 257

Query: 240 MCYCGMETREQIICKDVK---SVAKSKNKSGEIWIGVFSCAHLRSVEYSCGHHSFQESCT 296
            CYCG ET++ + CKD+K   S   S +  G  WIGVF+C  +R+V+Y C  HSF E C 
Sbjct: 258 KCYCGSETQKSMKCKDIKIPESAKYSSDAEGNKWIGVFACKEIRTVQYDCDKHSFIERCI 317

Query: 297 APPTNSGELACPFSPRLLKTCPCGSTPLKLLEAPRKKCTDPIPTCENRCNKPLKCGKHSC 356
           APPT S E  CP+SP+LLKTCPCG TPL+ L  PR  CTDPIPTCE+ CNKPLKCGKH C
Sbjct: 318 APPTLSMEKPCPYSPKLLKTCPCGKTPLQKLAKPRTLCTDPIPTCESHCNKPLKCGKHKC 377

Query: 357 PFVCHDGPCMDPCVSVDKVSCSCHSKSFLVPCQFHDEAHCNTKCESLMSCRRHRCTERCC 416
           PF CH G CMDPC+ ++   CSC  +SFLVPCQF    HCN KCESLMSCRRHRC ERCC
Sbjct: 378 PFKCHTGACMDPCLQIETRKCSCEQQSFLVPCQFTGSPHCNIKCESLMSCRRHRCLERCC 437

Query: 417 SGRSLAIKREKTIFLARDRLDESLVEAQHICLKPCNLKLSCGIHYCRRKCHPGKCSPCLE 476
           SGR  A KR+KT+F ++D +DE+LVEA+HICLK CNL LSCGIH C+RKCHPGKC PCLE
Sbjct: 438 SGRPAAEKRKKTLFRSQDLMDETLVEAEHICLKECNLLLSCGIHRCQRKCHPGKCPPCLE 497

Query: 477 SDSNDLSCPCGKTVVPAPVRCGTKLPPCRHPCIKTLQADTVCGHPPMPHECHSLEQPCPQ 536
           SDSNDL CPCGKT+V APVRCGTKLPPC   CIK ++ +  CGH PMPH CH L++PCP 
Sbjct: 498 SDSNDLVCPCGKTIVEAPVRCGTKLPPCPFQCIKVVRNEYPCGHTPMPHTCHPLDEPCPP 557

Query: 537 CTAPIYKKCKCNKVEKVRTLCFQNDVSCGKICGLPLKNCSHTCKRTCHEPGQCQTICKQI 596
           CTAP++K CKC KV++VRTLCFQNDVSCGKICGLPLK+C H C + CH PG CQT CKQI
Sbjct: 558 CTAPVFKPCKCGKVKEVRTLCFQNDVSCGKICGLPLKDCPHKCMKRCHIPGDCQTKCKQI 617

Query: 597 CGLPRKFCEHKCFARCHPGKDCPDEACQVKVKVTCSCGRKESILPCDAHADQPSSKLLIT 656
           CG  R  C+H C   CH   +CPD  C V  KVTC CGR+E+ + C A ++  S+     
Sbjct: 618 CGKRRINCDHTCSRPCHGNTECPDVPCTVSAKVTCECGRRETYVTCGAMSNIASAVTTTI 677

Query: 657 LPCDDKCEESKRHRMLMEAFGIKEKLTAPV----EELRDLVESAKSFDELHLPFTESTLS 712
           L CD++CE  +RHR L EAFGIKE +++      E L+D+V +A +F+EL LPFTE+TLS
Sbjct: 678 LECDEECEMLERHRQLKEAFGIKEIISSSTDLEFERLKDIVPTAIAFEELQLPFTEATLS 737

Query: 713 VYSKQRAWCNQIESFLSKLMRDVTRTSLHFKPMKLPQRRFIHELANAYALYSESQDREPK 772
           ++S+Q  WC QIE  ++K M D +R SLHFKPM+ PQR FIHEL+ AY LY ESQD EPK
Sbjct: 738 IFSRQERWCQQIEEIINKFMDDKSRPSLHFKPMRPPQRHFIHELSKAYNLYCESQDPEPK 797

Query: 773 RSVFVKKVENKSHIPLLCLGEALPLYHSFKQLQKERKVKELEKSTTRRLFNYTVDDANDV 832
           RSVF+KK    S  P   L + LPLY +FK+L+KERK++E E  T++RL N  V +    
Sbjct: 798 RSVFIKK-NTTSSKPSFSLSKVLPLYQTFKELEKERKLQEFEARTSKRLVNVEVPEGPTD 856

Query: 833 PHNAEFNCFLVKGVAPGVTKDELSDCLAEYLQFTLIQNPSYQTLENG-DFLIYPEDHMSI 891
            + AE N FL+K ++PG T ++L     +YL+ TLI+NP Y  L++G   +IYPED+ +I
Sbjct: 857 NYIAEANGFLIKDLSPGTTVEDLERIFGQYLKSTLIKNPQYLVLQDGKSGVIYPEDYPTI 916

Query: 892 SENVENDIKRLAPYISSICKEKQISEGVKLYKIDENLKT 930
           + NVE D K L  +   + K+  ISEGV+L KID+ L T
Sbjct: 917 TANVERDFKSLVGHFDVLAKDTFISEGVELCKIDDVLST 955

>Kwal_27.11518 s27 complement(832986..835847) [2862 bp, 953 aa] {ON}
           YNL023C (FAP1) - Transcription factor homolog;
           similarity to Drosophila melanogaster shuttle craft
           protein; similarity to human NFX1 protein; similarity to
           human DNA-binding protein tenascin [contig 27] FULL
          Length = 953

 Score = 1078 bits (2787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/931 (56%), Positives = 671/931 (72%), Gaps = 9/931 (0%)

Query: 10  VSSEL---PDSHSTSEYSSSGDASDDHENYX-XXXXXXXXXXLPYYEKTIHEIQKGDSYA 65
           ++SEL   PD+  ++ Y     +S++ E++             PYYEKT+ EI+KGD Y 
Sbjct: 1   MTSELDSTPDNDLSNGYVLVDASSEESEDFEHVEDEIDELEDQPYYEKTVKEIEKGDRYP 60

Query: 66  CMICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLDKTWKCPNCYYVNSEIPVK 125
           CMICT+EMD+TCHMYACP+CYRV+D ECIREWALKS+QKS+ KTWKCPNCY+   E+P+K
Sbjct: 61  CMICTVEMDFTCHMYACPDCYRVFDFECIREWALKSTQKSVSKTWKCPNCYFERKEVPMK 120

Query: 126 NRHTCWCGKVVHPESNPIDPNSCGQTCNAPICSHGCSKPCHLGPHPECMRTTKVKCLCGK 185
           NR TCWCGK V PE NP++PNSCGQTC+A IC HGCS  CHLGPHP CMR  +VKC CGK
Sbjct: 121 NRPTCWCGKSVQPEPNPLNPNSCGQTCDAQICEHGCSSICHLGPHPTCMRMVQVKCNCGK 180

Query: 186 HTKDMFCYQSEEEKASYQCGEPCNLLLPCGVHKCQRKCHSGPCGNCEETISGKIMCYCGM 245
             K +FC+++ +   S+ C  PC L LPCG+HKCQRKCHSG CG C E+I G I CYC +
Sbjct: 181 KNKSVFCHEAGKFVDSFICDSPCGLTLPCGIHKCQRKCHSGICGECPESIYGTINCYCKL 240

Query: 246 ETREQIICKDVKSVAKSKNKSGEIWIGVFSCAHLRSVEYSCGHHSFQESCTAPPTNSGEL 305
           E++  + C +V+   +S++ SG  W+G FSC ++R+VE+SC  HSF E C APP+ SG++
Sbjct: 241 ESKPSLKCTEVRIEGRSRDSSGNKWVGAFSCENIRTVEHSCKKHSFAEPCKAPPSISGQV 300

Query: 306 ACPFSPRLLKTCPCGSTPLKLLEAPRKKCTDPIPTCENRCNKPLKCGKHSCPFVCHDGPC 365
            CPFSPR LKTCPCG +PL+ ++  R +CTDPIPTC++ C K L+CGKH CPF CH G C
Sbjct: 301 PCPFSPRTLKTCPCGRSPLREMDVSRSQCTDPIPTCDSVCGKMLRCGKHKCPFKCHTGSC 360

Query: 366 MDPCVSVDKVSCSCHSKSFLVPCQFHDEAHCNTKCESLMSCRRHRCTERCCSGRSLAIKR 425
           M+ C+  DKV CSCH++ F+VPC+F ++A CNTKCE+LMSCRRHRC ERCC GRSLA  R
Sbjct: 361 MEECLCTDKVKCSCHARQFIVPCKFQEKARCNTKCEALMSCRRHRCIERCCDGRSLAQSR 420

Query: 426 EKTIFLARDRLDESLVEAQHICLKPCNLKLSCGIHYCRRKCHPGKCSPCLESDSNDLSCP 485
           EK +FL RD+LDESLVEAQHICLK CNLKLSCG H+C+RKCHPG C+PCLESDSNDL CP
Sbjct: 421 EKKVFLTRDKLDESLVEAQHICLKQCNLKLSCGKHFCKRKCHPGNCAPCLESDSNDLVCP 480

Query: 486 CGKTVVPAPVRCGTKLPPCRHPCIKTLQADTVCGHPPMPHECHSLEQPCPQCTAPIYKKC 545
           CGKTVVPAPVRCGT LP C HPCIKTLQ    CGHPPMPH CH LE+PCP CTAP++K C
Sbjct: 481 CGKTVVPAPVRCGTVLPRCLHPCIKTLQGPAPCGHPPMPHPCHPLEEPCPSCTAPVFKSC 540

Query: 546 KCNKVEKVRTLCFQNDVSCGKICGLPLKNCSHTCKRTCHEPGQCQTICKQICGLPRKFCE 605
           KC K +KVRTLCFQNDVSCG++CG  L  C H C++ CH+ G+CQT CKQ CG  R+ CE
Sbjct: 541 KCRKNDKVRTLCFQNDVSCGRVCGKQLAGCQHICQKACHKEGECQTSCKQPCGKTRENCE 600

Query: 606 HKCFARCHPGKDCPDEACQVKVKVTCSCGRKESILPCDAHADQPSSKLLITLPCDDKCEE 665
           H+C A CH G  CPD+ C   V + C+CG + + + C A+ ++  ++    L C++ C+ 
Sbjct: 601 HRCRALCHSGTPCPDKPCLNLVDIKCNCGHRSTTVTCGANENRAPAE-ETALECNNDCDV 659

Query: 666 SKRHRMLMEAFGIKEKL---TAPVEELRDLVESAKSFDELHLPFTESTLSVYSKQRAWCN 722
           ++RH  LMEAFGIK      +  +E+L  L E   +F EL LPF+E+TLS++SKQ  WC 
Sbjct: 660 ARRHHELMEAFGIKNDANQGSKSLEDLEALAEKVSTFQELLLPFSEATLSIFSKQTTWCT 719

Query: 723 QIESFLSKLMRDVTRTSLHFKPMKLPQRRFIHELANAYALYSESQDREPKRSVFVKKVEN 782
           QIE  L +LM D  + SLHFKPM+ PQR FIHEL  AY LY ESQD+EPKRSVFVKK  +
Sbjct: 720 QIEECLERLMNDKNKPSLHFKPMRPPQRHFIHELGQAYHLYCESQDQEPKRSVFVKKTAD 779

Query: 783 KSHIPLLCLGEALPLYHSFKQLQKERKVKELEKSTTRRLFNYTVDDANDVPHNAEFNCFL 842
            S  P + L  ALPLY+SFK  Q+E+K+KE E+ TT R+ NY V D    P  A FN  L
Sbjct: 780 -SQRPSISLKVALPLYYSFKSAQREKKLKETERHTTTRIINYAVTDQAQTPPAARFNGLL 838

Query: 843 VKGVAPGVTKDELSDCLAEYLQFTLIQNPSYQTLENGDFLIYPEDHMSISENVENDIKRL 902
           V+ V  G+ +  + +  +EYL+ TL+++P Y  L +GD L+Y +D+ + S NVENDI+R+
Sbjct: 839 VQNVLNGINEKAIQESFSEYLKHTLLKDPHYLLLASGDVLVYCDDYSTASVNVENDIERI 898

Query: 903 APYISSICKEKQISEGVKLYKIDENLKTFTS 933
             ++  I KE+ ++EGV   ++   L    S
Sbjct: 899 VGHLDHIVKEQLLAEGVYATRVQSFLDDLES 929

>NCAS0G03780 Chr7 complement(696877..699750) [2874 bp, 957 aa] {ON} 
          Length = 957

 Score = 1066 bits (2758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/950 (57%), Positives = 677/950 (71%), Gaps = 27/950 (2%)

Query: 7   PLRVSSELPDSHSTSEYSSSGDASDDHENYXXXXXXXXXXXLPYYEKTIHEIQKGDSYAC 66
           P  +  EL D  S  E  +S     D   Y           + YYE+ I EI KGDSY C
Sbjct: 14  PKSLVLELSDDDSNGESGNS-----DSSEYESDFAGMDDDAMHYYERAIQEIAKGDSYVC 68

Query: 67  MICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLDKTWKCPNCYYVNSEIPVKN 126
           MICT+EMDYTC MYAC +CYRV+D+ECIREWALKS++K++D+ WKCPNCY+VN ++P KN
Sbjct: 69  MICTVEMDYTCQMYACKQCYRVFDYECIREWALKSTEKTVDRIWKCPNCYHVNKKVPPKN 128

Query: 127 RHTCWCGKVVHPESNPIDPNSCGQTCNAPICSHGCSKPCHLGPHPECMRTTKVKCLCGKH 186
           R TCWCGKVV+PE NP++PNSCGQTCNA  C HGCSK CHLGPHPEC R   +KC CGKH
Sbjct: 129 RPTCWCGKVVNPEPNPLNPNSCGQTCNAHTCVHGCSKICHLGPHPECTRIITIKCRCGKH 188

Query: 187 TKDMFCYQSE--EEKASYQCGEPCNLLLPCGVHKCQRKCHSGPCGNCEETISGK------ 238
           TKD+ CYQS     K  +QC EPC L L CG+H+CQ+KCHSG CG C E ++ K      
Sbjct: 189 TKDISCYQSSLLRGKDKFQCDEPCGLPLACGLHRCQKKCHSGLCGICPEILNTKEYLDAH 248

Query: 239 IMCYCGMETREQIICKDVK---SVAKSKNKSGEIWIGVFSCAHLRSVEYSCGHHSFQESC 295
           I CYCG + R+ I C+DV    S + S+N  GE W+GVF C ++R+V+Y C  HSF E C
Sbjct: 249 IRCYCGSQDRDTIKCRDVHVPLSASLSQNLKGEKWVGVFKCDNIRNVDYKCHEHSFVEQC 308

Query: 296 TAPPTNSGELACPFSPRLLKTCPCGSTPLKLLEAPRKKCTDPIPTCENRCNKPLKCGKHS 355
            APPT  G   CPFSP+LLKTCPCG TPLK L   RKKCTDPIPTC++RC KPLKCG+H+
Sbjct: 309 IAPPTIDGTKPCPFSPKLLKTCPCGKTPLKELVESRKKCTDPIPTCDSRCGKPLKCGRHT 368

Query: 356 CPFVCHDGPCMDPCVSVDKVSCSCHSKSFLVPCQFHDEAHCNTKCESLMSCRRHRCTERC 415
           CPF+CH GPCMDPC+ +DK  CSC+ +SFLVPCQFH +  C TKCESLMSCRRHRCTERC
Sbjct: 369 CPFICHVGPCMDPCLQIDKKKCSCNQQSFLVPCQFHQDPQCTTKCESLMSCRRHRCTERC 428

Query: 416 CSGRSLAIKREKTIFLARDRLDESLVEAQHICLKPCNLKLSCGIHYCRRKCHPGKCSPCL 475
           C+GR  A  R+K +F ++D +DESLVE QHICLK CNL LSCG H C+RKCHPGKC PCL
Sbjct: 429 CAGRPRAEARKKRLFRSQDLMDESLVEPQHICLKECNLMLSCGKHKCQRKCHPGKCPPCL 488

Query: 476 ESDSNDLSCPCGKTVVPAPVRCGTKLPPCRHPCIKTLQADTVCGHPPMPHECHSLEQPCP 535
           ESDSNDL CPCG+T++ APVRCGTKLPPC +PCIK ++ +  CGH PMPH CH L +PCP
Sbjct: 489 ESDSNDLVCPCGRTIIEAPVRCGTKLPPCPYPCIKVVRGEYPCGHTPMPHTCHPLNEPCP 548

Query: 536 QCTAPIYKKCKCNKVEKVRTLCFQNDVSCGKICGLPLKNCSHTCKRTCHEPGQCQTICKQ 595
            CTA ++K CKC KV+KVRTLCFQNDVSCGKICGLPL+NC+HTC++ CH  G+CQ  CKQ
Sbjct: 549 PCTASVFKPCKCGKVDKVRTLCFQNDVSCGKICGLPLENCNHTCQKRCHLLGECQKTCKQ 608

Query: 596 ICGLPRKFCEHKCFARCHPGKDCPDEACQVKVKVTCSCGRKESILPCDAHADQPSSKLLI 655
           IC   R  CEH C   CH   DCPD  C V +K+TC CGRKE+ + C A +  PS+    
Sbjct: 609 ICKKKRINCEHTCLKPCHGKTDCPDIPCSVSIKITCECGRKETYVTCGATSTIPSAATKT 668

Query: 656 TLPCDDKCEESKRHRMLMEAFGI---KEKLTAPVEELRDLVESAKSFDELHLPFTESTLS 712
            + CD++CE  +RHR L EAFGI       +  VE+L+DL + A +F+EL LP+ E+TLS
Sbjct: 669 HIECDEECELLERHRQLKEAFGIVDSNRSTSLEVEKLKDLAKVATTFEELQLPYNETTLS 728

Query: 713 VYSKQRAWCNQIESFLSKLMRDVTRTSLHFKPMKLPQRRFIHELANAYALYSESQDREPK 772
           +Y+KQ  WC+QIE  L+KLM D  R SLHFKPM+ PQR FI E A ++ LY+E+QDREPK
Sbjct: 729 IYAKQEKWCDQIEEILNKLMDDKARPSLHFKPMRPPQRHFIQEFAKSFNLYAEAQDREPK 788

Query: 773 RSVFVKKVEN-KSHIPLLCLGEALPLYHSFKQLQKERKVKELEKSTTRRLFNYTVDDAND 831
           RSVFVKK E+  S  P++ L +ALPLY +FK+L+KERK+KE E  TT RL N      ++
Sbjct: 789 RSVFVKKEEDGSSSKPIISLHDALPLYQTFKELEKERKLKEFEARTTTRLINVEAPQEDN 848

Query: 832 VPHNAEFNCFLVKGVAPGVTKDELSDCLAEYLQFTLIQNPSYQTLENG-DFLIYPEDHMS 890
           V H A+++ FL+K ++PG T ++L     ++L  TLI NP Y  +++G D LIYPE++  
Sbjct: 849 VYH-AKYSGFLIKKISPGTTVEDLQRIFGQFLTSTLIVNPQYLIIQDGKDALIYPENYQE 907

Query: 891 ISENVENDIKRLAPYISSICKEKQISEGVKLYKID-----ENLKTFTSEE 935
           +S  VE D++ L  +   I KE  I++GV+L  ++     E L+T   EE
Sbjct: 908 MSAGVERDLETLVGHFDFISKENFIADGVELCDVEVAMLGERLETPILEE 957

>KAFR0H03300 Chr8 complement(627520..630420) [2901 bp, 966 aa] {ON}
           Anc_2.288 YNL023C
          Length = 966

 Score = 1063 bits (2750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/919 (56%), Positives = 650/919 (70%), Gaps = 19/919 (2%)

Query: 24  SSSGDASDDHENYXXXXXXXXXXXLPYYEKTIHEIQKGDSYACMICTMEMDYTCHMYACP 83
           +SS  +SDD E             + YYE+ I EI  GDSY CMICT+EMDYTC MYAC 
Sbjct: 33  TSSAASSDDEE----MDVLSDNDDMMYYERAIQEIAAGDSYICMICTVEMDYTCKMYACK 88

Query: 84  ECYRVYDHECIREWALKSSQKSLDKTWKCPNCYYVNSEIPVKNRHTCWCGKVVHPESNPI 143
           +C R++D++CIREWALKS++K+ ++ WKCPNCY+VN ++P KNR TCWCGKVV+PE NP+
Sbjct: 89  KCCRIFDYDCIREWALKSTEKTKERIWKCPNCYHVNKKVPTKNRATCWCGKVVNPEKNPL 148

Query: 144 DPNSCGQTCNAPICSHGCSKPCHLGPHPECMRTTKVKCLCGKHTKDMFCYQSEEE---KA 200
           +PNSCGQTCNAP+C HGCSK CHLGPHPEC+RT  +KC CGKH + + C+QS+ +   + 
Sbjct: 149 NPNSCGQTCNAPVCIHGCSKICHLGPHPECLRTITMKCDCGKHERQISCFQSKSQSGRRN 208

Query: 201 SYQCGEPCNLLLPCGVHKCQRKCHSGPCGNCEETIS------GKIMCYCGMETREQIICK 254
            + C E C L L CG+H C++KCHSG CG+C E +         I CYCG+ET++   CK
Sbjct: 209 RFSCEEECGLPLSCGIHTCKKKCHSGLCGSCPELLEVNEEKCATIKCYCGLETKKSFPCK 268

Query: 255 DVKS-VAKSKNKSGEIWIGVFSCAHLRSVEYSCGHHSFQESCTAPPTNSGELACPFSPRL 313
           DVK+    S++  G  W+GVFSC  +R+VEYSC  HSF ESC APPT SG   CPFSP L
Sbjct: 269 DVKAPTTLSRDAEGNKWVGVFSCNKIRNVEYSCQKHSFVESCVAPPTVSGTKQCPFSPNL 328

Query: 314 LKTCPCGSTPLKLLEAPRKKCTDPIPTCENRCNKPLKCGKHSCPFVCHDGPCMDPCVSVD 373
           LKTCPCG TPL  L  PR KCTDP+PTCE  CNKPLKCGKH CPF CH+GPCMDPC+ +D
Sbjct: 329 LKTCPCGRTPLNALSKPRLKCTDPVPTCEACCNKPLKCGKHRCPFTCHNGPCMDPCIQID 388

Query: 374 KVSCSCHSKSFLVPCQFHDEAHCNTKCESLMSCRRHRCTERCCSGRSLAIKREKTIFLAR 433
           K  CSCH   FL PCQF  E HCN KCESLMSCRRHRCTERCCSGR LA KR+KT+F + 
Sbjct: 389 KKPCSCHQSFFLTPCQFEGEPHCNIKCESLMSCRRHRCTERCCSGRPLAEKRKKTLFRSS 448

Query: 434 DRLDESLVEAQHICLKPCNLKLSCGIHYCRRKCHPGKCSPCLESDSNDLSCPCGKTVVPA 493
           D  DE+LVEAQH+CLK CNL LSCG H C+RKCHPGKC PCLESDSNDL CPCGKTVV A
Sbjct: 449 DINDETLVEAQHVCLKECNLMLSCGKHRCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEA 508

Query: 494 PVRCGTKLPPCRHPCIKTLQADTVCGHPPMPHECHSLEQPCPQCTAPIYKKCKCNKVEKV 553
           PVRCGTKL PC  PCIK ++ ++VCGHPP+PH CH L+QPCP CTA ++K CKC K +KV
Sbjct: 509 PVRCGTKLSPCLFPCIKVIRNESVCGHPPVPHSCHPLDQPCPPCTATVFKPCKCGKRDKV 568

Query: 554 RTLCFQNDVSCGKICGLPLKNCSHTCKRTCHEPGQCQTICKQICGLPRKFCEHKCFARCH 613
           RT+CFQ DVSCGKICGLPL  C H C++ CH  G+CQ  CKQ+C   R  C H+C   CH
Sbjct: 569 RTVCFQKDVSCGKICGLPLLTCHHKCQKVCHPNGECQVKCKQVCRKKRVNCVHECLKSCH 628

Query: 614 PGKDCPDEACQVKVKVTCSCGRKESILPCDAHADQPSSKLLITLPCDDKCEESKRHRMLM 673
              +C D  C V  K++C CGR+ES + C+A +   S+ L+  L C+++CE  KRHR L 
Sbjct: 629 GSTECSDSPCPVSTKISCPCGRRESYVTCNATSTIDSAALITRLDCNEECEVVKRHRELR 688

Query: 674 EAFGIKEK---LTAPVEELRDLVESAKSFDELHLPFTESTLSVYSKQRAWCNQIESFLSK 730
           EAFGI EK        E L+   +SA ++D+L LP+TE  L  Y+KQ  WC QIE  L K
Sbjct: 689 EAFGIVEKEEPENLGTERLQSFAQSATNYDDLQLPYTEPALVAYTKQPNWCEQIEELLIK 748

Query: 731 LMRDVTRTSLHFKPMKLPQRRFIHELANAYALYSESQDREPKRSVFVKKVENKSHI-PLL 789
            M D +R SLHFKPM+ PQR FIHE+A A+ LY+ESQDREPKRSVF+KK ++ + + P L
Sbjct: 749 FMDDNSRPSLHFKPMRPPQRYFIHEIAKAFNLYAESQDREPKRSVFLKKNDDGTSLKPAL 808

Query: 790 CLGEALPLYHSFKQLQKERKVKELEKSTTRRLFNYTVDDANDVPHNAEFNCFLVKGVAPG 849
            L + LP+Y +FK+L+KERK K+ E  TT RL N T+DD  +     E N  ++K ++ G
Sbjct: 809 RLSDVLPVYQNFKKLEKERKAKQFEARTTARLMNITLDDTLEERKKFENNGLIIKNLSNG 868

Query: 850 VTKDELSDCLAEYLQFTLIQNPSYQTLENGDFLIYPEDHMSISENVENDIKRLAPYISSI 909
           +T + LS+   ++ + TLI+NP Y  +EN   LIYPE H  I++ V ND+  L  + + I
Sbjct: 869 ITLEFLSEFFNKFFKSTLIKNPQYLIIENNG-LIYPESHNEITQGVYNDLDMLVGHFNVI 927

Query: 910 CKEKQISEGVKLYKIDENL 928
            KE+ I + V++  I+  L
Sbjct: 928 VKEELIGDSVEMCNIENEL 946

>Suva_14.324 Chr14 complement(571146..574052) [2907 bp, 968 aa] {ON}
           YNL023C (REAL)
          Length = 968

 Score = 1056 bits (2730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/942 (55%), Positives = 658/942 (69%), Gaps = 35/942 (3%)

Query: 2   DKHVSPLRVSSELPDSHSTSEYSSSGDASDDHENYXXXXXXXXXXXLPYYEKTIHEIQKG 61
           D+HVS + VS E      +S Y S  ++ DD               + YYE+ I EI KG
Sbjct: 28  DEHVSGVEVSHE-----QSSTYDSEEESDDD---------------MQYYERAIQEIAKG 67

Query: 62  DSYACMICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLDKTWKCPNCYYVNSE 121
           DSY CMICT+EMDYTC M+AC +CYRV+D+ CIREWALKS++K++DK WKCPNCY++  +
Sbjct: 68  DSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTVDKIWKCPNCYHIGKK 127

Query: 122 IPVKNRHTCWCGKVVHPESNPIDPNSCGQTCNAPICSHGCSKPCHLGPHPECMRTTKVKC 181
           +P +NR TCWCGKVV+P+ NP+DPNSCGQTCNAP C HGCSK CHLGPHPEC RT ++KC
Sbjct: 128 VPTRNRPTCWCGKVVNPDHNPLDPNSCGQTCNAPTCVHGCSKICHLGPHPECTRTVEIKC 187

Query: 182 LCGKHTKDMFCYQSEEEKASYQCGEPCNLLLPCGVHKCQRKCHSGPCGNCEETISGK--- 238
            CGKH+K +FCYQS+  K  + C E C L L CG+HKC++KCHSG CG C E I  +   
Sbjct: 188 RCGKHSKSIFCYQSKAMKKHFDCQEECGLPLSCGIHKCKKKCHSGLCGPCPELIMSEDKA 247

Query: 239 ---IMCYCGMETREQIICKDV---KSVAKSKNKSGEIWIGVFSCAHLRSVEYSCGHHSFQ 292
              I CYCG+ +++ I C +V   KS   SK++SG  WIGVF+C  +R+V+Y+C  HSF 
Sbjct: 248 MDWIKCYCGIHSKDSIKCCEVNFPKSGRSSKDESGNEWIGVFACKDIRTVDYACHKHSFI 307

Query: 293 ESCTAPPTNSGELACPFSPRLLKTCPCGSTPLKLLEAPRKKCTDPIPTCENRCNKPLKCG 352
           E C +PPT +G+  CPF P LLKTCPCG T L+ L  PRK CTDPIPTC +RC+KPLKCG
Sbjct: 308 EPCISPPTVNGKKTCPFLPSLLKTCPCGRTALEELTKPRKHCTDPIPTCSSRCSKPLKCG 367

Query: 353 KHSCPFVCHDGPCMDPCVSVDKVSCSCHSKSFLVPCQFHDEAHCNTKCESLMSCRRHRCT 412
           KHSCPF+CHDG CMDPC+  D V C+C   +FLVPC F ++ HCN KCESLMSCRRHRC 
Sbjct: 368 KHSCPFICHDGACMDPCLQTDSVKCACEQSTFLVPCGFQEKPHCNIKCESLMSCRRHRCI 427

Query: 413 ERCCSGRSLAIKREKTIFLARDRLDESLVEAQHICLKPCNLKLSCGIHYCRRKCHPGKCS 472
           +RCCSGR  A++R+K IF ++D +DESLVEAQHICLKPCNL LSCGIH C+RKCHPGKC 
Sbjct: 428 DRCCSGRPSALERKKRIFRSQDLMDESLVEAQHICLKPCNLTLSCGIHKCQRKCHPGKCP 487

Query: 473 PCLESDSNDLSCPCGKTVVPAPVRCGTKLPPCRHPCIKTLQADTVCGHPPMPHECHSLEQ 532
           PCLESDSNDL CPCGKTV+PAPVRCGTKLP C + CIK ++ ++ CGH PMPH CH L+ 
Sbjct: 488 PCLESDSNDLVCPCGKTVIPAPVRCGTKLPLCNYACIKVVRGESECGHKPMPHTCHPLDL 547

Query: 533 PCPQCTAPIYKKCKCNKVEKVRTLCFQNDVSCGKICGLPLKNCSHTCKRTCHEPGQCQTI 592
            CP CT  ++K CKC K +KVRT+CFQ DVSCG  CG PL  C HTC++TCH P  CQ +
Sbjct: 548 ACPPCTETVFKPCKCGKKDKVRTVCFQTDVSCGTTCGKPLSGCHHTCQKTCHLPENCQKV 607

Query: 593 CKQICGLPRKFCEHKCFARCHPGKDCPDEACQVKVKVTCSCGRKESILPCDAHADQPSSK 652
           CKQIC   R  C+H C   CH   +CPD  C   VK+TC CGR E  + C A ++  S  
Sbjct: 608 CKQICRQKRPNCDHACPKPCHGRSECPDLPCASLVKITCKCGRIEKKVACGAKSNVVSVT 667

Query: 653 LLITLPCDDKCEESKRHRMLMEAFGIKEK----LTAPVEELRDLVESAKSFDELHLPFTE 708
               L C+++CE  KR + L EAFGI E+        ++ L+ LV  A +F+EL LPFTE
Sbjct: 668 EAPQLDCNEECEALKRLKELREAFGISEESNESTNNELDTLKKLVSVATTFEELQLPFTE 727

Query: 709 STLSVYSKQRAWCNQIESFLSKLMRDVTRTSLHFKPMKLPQRRFIHELANAYALYSESQD 768
           + LSVY+KQ  WC QIE+ ++KLM D TR+SLHFKPM+ PQR FI ELA AY LYSESQD
Sbjct: 728 TVLSVYAKQEGWCLQIENIVNKLMSDKTRSSLHFKPMRPPQRHFIRELAKAYNLYSESQD 787

Query: 769 REPKRSVFVKKVEN-KSHIPLLCLGEALPLYHSFKQLQKERKVKELEKSTTRRLFNYTVD 827
           REP RSVF+KK +N KS  P+L L EA PLY SFK+LQKERK++E +  TT +L N+ V 
Sbjct: 788 REPMRSVFIKKEDNSKSSRPILSLAEAFPLYESFKELQKERKIQEFQARTTAKLINFEVR 847

Query: 828 DANDVPHNAEFNCFLVKGVAPGVTKDELSDCLAEYLQFTLIQNPSYQTLENGD-FLIYPE 886
           DA      A+ N FLV+ +  G   D+L      +L+ TL+  P Y  +++G   L+YPE
Sbjct: 848 DAEPKVELAKNNGFLVQKLVNGNDVDDLRRFFEPHLKHTLVVKPQYLIIDDGKTALVYPE 907

Query: 887 DHMSISENVENDIKRLAPYISSICKEKQISEGVKLYKIDENL 928
           ++  +S N E D+  L  +   + KE  +++ + L  IDE L
Sbjct: 908 NYQEVSVNTERDMDILVGHFDFMAKEAFLADSISLCSIDEEL 949

>Smik_14.308 Chr14 complement(550650..553547) [2898 bp, 965 aa] {ON}
           YNL023C (REAL)
          Length = 965

 Score = 1052 bits (2721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/933 (56%), Positives = 648/933 (69%), Gaps = 16/933 (1%)

Query: 24  SSSGDAS-DDHENYXXXXXXXXXXXLPYYEKTIHEIQKGDSYACMICTMEMDYTCHMYAC 82
           SS  D+S +D+              + YYE++I EI KGDSY CMICT+EMDYTC M+AC
Sbjct: 25  SSEQDSSVEDNNEQPSSYEEETDDDMQYYERSIQEISKGDSYICMICTVEMDYTCQMFAC 84

Query: 83  PECYRVYDHECIREWALKSSQKSLDKTWKCPNCYYVNSEIPVKNRHTCWCGKVVHPESNP 142
             CYRV+D+ CIREWA+KS++K++D+ WKCPNCY+V  ++P  NR TCWCGKVV+P+ NP
Sbjct: 85  KRCYRVFDYGCIREWAIKSTEKTVDRIWKCPNCYHVGKKVPANNRPTCWCGKVVNPDPNP 144

Query: 143 IDPNSCGQTCNAPICSHGCSKPCHLGPHPECMRTTKVKCLCGKHTKDMFCYQSEEEKASY 202
           +DPNSCGQTC+APIC HGCSK CHLGPHPEC R  ++ C CGKH++ +FCYQS+  K ++
Sbjct: 145 LDPNSCGQTCSAPICIHGCSKTCHLGPHPECTRMVEIMCHCGKHSQSIFCYQSKAMKKNF 204

Query: 203 QCGEPCNLLLPCGVHKCQRKCHSGPCGNCEETISGK------IMCYCGMETREQIICKDV 256
           +C E C L L C VH C+RKCH+G CG C E I+ K      I CYCG  +R  I C + 
Sbjct: 205 KCQEECGLPLSCSVHNCKRKCHTGLCGPCPELITSKDSTEEQIKCYCGNHSRASIKCSEA 264

Query: 257 ---KSVAKSKNKSGEIWIGVFSCAHLRSVEYSCGHHSFQESCTAPPTNSGELACPFSPRL 313
              KS   SK+ +G  WIGVF+C  +R+V++SC  HSF E C +PP+ +G   CPF P L
Sbjct: 265 RFPKSGRSSKDGNGNEWIGVFACTDIRTVDFSCRKHSFIEPCLSPPSVNGRKVCPFLPSL 324

Query: 314 LKTCPCGSTPLKLLEAPRKKCTDPIPTCENRCNKPLKCGKHSCPFVCHDGPCMDPCVSVD 373
           LKTCPCG T L  L  PRK C DPIPTC +RC+KPLKCGKHSCPF+CHD  CMDPC+ +D
Sbjct: 325 LKTCPCGRTALDELTKPRKHCDDPIPTCNSRCSKPLKCGKHSCPFICHDLACMDPCLQID 384

Query: 374 KVSCSCHSKSFLVPCQFHDEAHCNTKCESLMSCRRHRCTERCCSGRSLAIKREKTIFLAR 433
              C+C   +F VPC F     CN KCESLMSCRRHRCT+RCCSGR  A+KR K  F ++
Sbjct: 385 SAKCACEQSTFSVPCGFQGRPRCNIKCESLMSCRRHRCTDRCCSGRPSAVKRRKNFFRSQ 444

Query: 434 DRLDESLVEAQHICLKPCNLKLSCGIHYCRRKCHPGKCSPCLESDSNDLSCPCGKTVVPA 493
           D LDESLVEA+HICLKPCNL LSCGIH C+RKCHPGKC PCLESDSNDL CPCGKTVVPA
Sbjct: 445 DLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCHPGKCPPCLESDSNDLICPCGKTVVPA 504

Query: 494 PVRCGTKLPPCRHPCIKTLQADTVCGHPPMPHECHSLEQPCPQCTAPIYKKCKCNKVEKV 553
           PVRCGT+LP C HPCIK ++ ++ CGH PMPH CH L  PCP CT  ++K CKC K +KV
Sbjct: 505 PVRCGTELPVCNHPCIKVVRGESSCGHKPMPHTCHPLGVPCPPCTETVFKPCKCGKKDKV 564

Query: 554 RTLCFQNDVSCGKICGLPLKNCSHTCKRTCHEPGQCQTICKQICGLPRKFCEHKCFARCH 613
           RT+CFQ DVSCG  CGL L  C HTC++TCH PG CQ +CKQICG  R  C H C   CH
Sbjct: 565 RTVCFQKDVSCGTKCGLLLHFCRHTCQKTCHLPGNCQKVCKQICGHERLSCRHTCPKPCH 624

Query: 614 PGKDCPDEACQVKVKVTCSCGRKESILPCDAHADQPSSKLLITLPCDDKCEESKRHRMLM 673
              +CPD  C   VK+TC CGR E  + C A +    +     L CD++CE  KR + L 
Sbjct: 625 GKTECPDLPCPTLVKITCKCGRNEKSVTCSAKSGVVPANESSVLDCDEECEALKRLKELR 684

Query: 674 EAFGIKEK----LTAPVEELRDLVESAKSFDELHLPFTESTLSVYSKQRAWCNQIESFLS 729
           EAFGIKE+     +  ++ L+ LV  A +F+ELHLPFTE+TLSVYSKQ  WC+QIE  L+
Sbjct: 685 EAFGIKEESNNVTSNELDALKKLVSVATTFEELHLPFTETTLSVYSKQERWCSQIEVILN 744

Query: 730 KLMRDVTRTSLHFKPMKLPQRRFIHELANAYALYSESQDREPKRSVFVKKVEN-KSHIPL 788
           KLM D TR+SLHFKPM+ PQR FI ELA AY LYSESQDREP RSVF+KK +N  S+ P+
Sbjct: 745 KLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYSESQDREPMRSVFIKKEDNGTSNKPV 804

Query: 789 LCLGEALPLYHSFKQLQKERKVKELEKSTTRRLFNYTVDDANDVPHNAEFNCFLVKGVAP 848
           L LGEALPLY SFKQLQKERKV+E +  TT +L N+ V DA      A+ N FLV+ +  
Sbjct: 805 LSLGEALPLYESFKQLQKERKVQEFQSRTTAKLINFEVQDAQPKVEVAKNNGFLVRNLVT 864

Query: 849 GVTKDELSDCLAEYLQFTLIQNPSYQTLENGD-FLIYPEDHMSISENVENDIKRLAPYIS 907
           G T ++L      +L+ TL+ NP Y  L++G   L+YPE++ + S N E D++ L  +  
Sbjct: 865 GNTVEDLKRFFEPHLKHTLVVNPQYLILDDGKTALVYPENYETASVNTERDMELLVGHFD 924

Query: 908 SICKEKQISEGVKLYKIDENLKTFTSEEYLQEE 940
            + KE  +++ + L   DE +        +QE+
Sbjct: 925 FMAKEAFLADSILLCSTDEEVGKRLDTPVIQED 957

>YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON}
           FAP1Protein that binds to Fpr1p, conferring rapamycin
           resistance by competing with rapamycin for Fpr1p
           binding; accumulates in the nucleus upon treatment of
           cells with rapamycin; has similarity to D. melanogaster
           shuttle craft and human NFX1
          Length = 965

 Score = 1051 bits (2718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/910 (56%), Positives = 637/910 (70%), Gaps = 15/910 (1%)

Query: 48  LPYYEKTIHEIQKGDSYACMICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLD 107
           + YYE+ I EI  GDSY CMICT+EMDYTC M+AC  CYRV+D+ CIREWALKS++K++D
Sbjct: 50  MQYYERAIQEISSGDSYVCMICTVEMDYTCQMFACKRCYRVFDYGCIREWALKSTEKTVD 109

Query: 108 KTWKCPNCYYVNSEIPVKNRHTCWCGKVVHPESNPIDPNSCGQTCNAPICSHGCSKPCHL 167
           + WKCPNCYYV+  +PVKNR TCWCGKVV+P+ NP+DPNSCGQTCNA  C HGCSK CHL
Sbjct: 110 RIWKCPNCYYVSKRVPVKNRPTCWCGKVVNPDPNPLDPNSCGQTCNASTCMHGCSKICHL 169

Query: 168 GPHPECMRTTKVKCLCGKHTKDMFCYQSEEEKASYQCGEPCNLLLPCGVHKCQRKCHSGP 227
           GPHPEC R  ++ C CGKH+K +FCYQS+  K ++ C E C L L C +H C++KCH G 
Sbjct: 170 GPHPECTRMVEIMCHCGKHSKSIFCYQSKVMKKNFNCQEVCGLPLSCSIHTCKKKCHPGL 229

Query: 228 CGNCEETISGK------IMCYCGMETREQIICKDVK---SVAKSKNKSGEIWIGVFSCAH 278
           CG C E I  K      I CYCG  TR  I C + K   S   SK+++G  WIGVF+CA 
Sbjct: 230 CGPCPEMIISKDSPKKQIKCYCGNHTRANIKCSETKFPKSGKSSKDENGNRWIGVFACAD 289

Query: 279 LRSVEYSCGHHSFQESCTAPPTNSGELACPFSPRLLKTCPCGSTPLKLLEAPRKKCTDPI 338
            R V+YSC  HSF ESC +PPT +GE ACPF P  LKTCPCG T L+ L  PRK C DPI
Sbjct: 290 NRVVDYSCRKHSFIESCISPPTINGEKACPFLPSSLKTCPCGRTALEELTKPRKHCDDPI 349

Query: 339 PTCENRCNKPLKCGKHSCPFVCHDGPCMDPCVSVDKVSCSCHSKSFLVPCQFHDEAHCNT 398
           PTC++RC KPLKCGKHSCPF CHD  CM+PC+ +D V C+C   +F VPC F     CN 
Sbjct: 350 PTCDSRCGKPLKCGKHSCPFTCHDKACMEPCLQIDSVKCACEQSTFSVPCGFQGRPRCNI 409

Query: 399 KCESLMSCRRHRCTERCCSGRSLAIKREKTIFLARDRLDESLVEAQHICLKPCNLKLSCG 458
           KCESLMSCRRHRCT+RCCSGR  AI+R+K +F  +D LDESLVEA+HICLKPCNL LSCG
Sbjct: 410 KCESLMSCRRHRCTDRCCSGRPSAIRRKKNLFRTQDLLDESLVEAKHICLKPCNLTLSCG 469

Query: 459 IHYCRRKCHPGKCSPCLESDSNDLSCPCGKTVVPAPVRCGTKLPPCRHPCIKTLQADTVC 518
           IH C+RKCHPGKC PCLESDSNDL CPCG TVVPAPVRCGTKLP C HPCIK ++ ++ C
Sbjct: 470 IHKCQRKCHPGKCPPCLESDSNDLVCPCGNTVVPAPVRCGTKLPTCNHPCIKVVRGESTC 529

Query: 519 GHPPMPHECHSLEQPCPQCTAPIYKKCKCNKVEKVRTLCFQNDVSCGKICGLPLKNCSHT 578
           GH PMPH CHSL+  CP CT  ++K CKC K  KVRT+CFQ DVSCG  CG+PL  C HT
Sbjct: 530 GHKPMPHTCHSLDVSCPPCTETVFKPCKCGKKTKVRTVCFQTDVSCGIKCGIPLSYCYHT 589

Query: 579 CKRTCHEPGQCQTICKQICGLPRKFCEHKCFARCHPGKDCPDEACQVKVKVTCSCGRKES 638
           C++TCH PG CQ +CKQ CG  R  C H+C   CH   +CPD  C   VK+ C CGR + 
Sbjct: 590 CQKTCHLPGNCQKVCKQTCGQKRLNCNHECPKPCHGKTECPDLPCATLVKIYCKCGRIKK 649

Query: 639 ILPCDAHADQPSSKLLITLPCDDKCEESKRHRMLMEAFGIKEK----LTAPVEELRDLVE 694
            + C A +D+ S      L C+++CE  KR + L EAFGIKE+     +  ++ L+ LV 
Sbjct: 650 SVTCGAKSDRVSVTESSVLDCNEECEALKRLKELKEAFGIKEETNNFTSNELDALKKLVS 709

Query: 695 SAKSFDELHLPFTESTLSVYSKQRAWCNQIESFLSKLMRDVTRTSLHFKPMKLPQRRFIH 754
            A +F+EL LPFTE+ LSVYSKQ  WC+QIE+ L+KLM D TR+SLHFKPM+ PQR FI 
Sbjct: 710 VATTFEELQLPFTEAALSVYSKQERWCSQIEAILNKLMDDKTRSSLHFKPMRPPQRHFIR 769

Query: 755 ELANAYALYSESQDREPKRSVFVKKVEN-KSHIPLLCLGEALPLYHSFKQLQKERKVKEL 813
           ELA AY LYSESQDREP RSVF+KK +N  S+ P+L L EA PLY SFKQLQKERK +E 
Sbjct: 770 ELAKAYGLYSESQDREPMRSVFIKKEDNGASNKPVLSLAEAYPLYESFKQLQKERKAQEF 829

Query: 814 EKSTTRRLFNYTVDDANDVPHNAEFNCFLVKGVAPGVTKDELSDCLAEYLQFTLIQNPSY 873
           +  TT +L N+ V D       A+ N FLV+ +  G T ++L      +L+ TL+ NP Y
Sbjct: 830 QARTTAKLINFEVQDTEPKVEVAKKNGFLVQNLVAGNTAEDLRRFFEPHLKHTLVVNPQY 889

Query: 874 QTLENGD-FLIYPEDHMSISENVENDIKRLAPYISSICKEKQISEGVKLYKIDENLKTFT 932
             L++G   L+YPE++ + S N E D++ L  +   + KE  +++ + L   +E L+   
Sbjct: 890 LILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSISLCSTEEELERRL 949

Query: 933 SEEYLQEEQP 942
               +QE+ P
Sbjct: 950 DTPVIQEDSP 959

>KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {ON}
           Anc_2.288 YNL023C
          Length = 973

 Score = 1040 bits (2688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/920 (55%), Positives = 639/920 (69%), Gaps = 22/920 (2%)

Query: 48  LPYYEKTIHEIQKGDSYACMICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLD 107
           LPYYE+ + EI KGD Y CMICT+EMDYTC M+AC +CYRV+D++C+REWA+KS+ K++D
Sbjct: 51  LPYYERAVREIAKGDLYTCMICTVEMDYTCKMFACRKCYRVFDYDCVREWAIKSTDKTVD 110

Query: 108 KTWKCPNCYYVNSEIPVKNRHTCWCGKVVHPESNPIDPNSCGQTCNAPICSHGCSKPCHL 167
           + WKCPNCY VN ++P KNR TCWCGKVV+PE NP+DPNSCGQTC+A IC HGCSK CHL
Sbjct: 111 RIWKCPNCYLVNKKVPTKNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKICIHGCSKICHL 170

Query: 168 GPHPECMRTTKVKCLCGKHTKDMFCYQSEEEKAS--YQCGEPCNLLLPCGVHKCQRKCHS 225
           GPHPEC+RTT VKC CGK TK++ C++++  +    +QC EPCN LLPCG+H+CQ+ CHS
Sbjct: 171 GPHPECLRTTSVKCRCGKATKEIPCFETKGRRGRNLFQCNEPCNSLLPCGIHRCQKICHS 230

Query: 226 GPCGNCEETISGK------IMCYCGMETREQIICKDVKSVA-KSKNKSGEIWIGVFSCAH 278
           G CG+C E ++ K      I CYCG  TR  I CKDV     KSKN +G+ WIGV++C  
Sbjct: 231 GLCGSCPENLTVKEGDDVSISCYCGQHTRNSIKCKDVNVTGRKSKNANGDEWIGVYACKD 290

Query: 279 LRSVEYSCGHHSFQESCTAPPTNSGELACPFSPRLLKTCPCGSTPLKLLEAPRKKCTDPI 338
           +RSVEYSC  HSF E C APPT +G   CPFSP+ LKTC CG TPL+ L   R++C DPI
Sbjct: 291 IRSVEYSCRQHSFFEECIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALGKARRRCIDPI 350

Query: 339 PTCENRCNKPLKCGKHSCPFVCHDGPCMDPCVSVDKVSCSCHSKSFLVPCQFHDEAHCNT 398
           P CE+RC+K LKCGKH+CPF CHDGPCMDPC+ +DKV C+C   +FLVPC F    HC  
Sbjct: 351 PHCESRCDKLLKCGKHTCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPCGFQGAPHCQL 410

Query: 399 KCESLMSCRRHRCTERCCSGRSLAIKREKTIFLARDRLDESLVEAQHICLKPCNLKLSCG 458
           KCESL+SCRRH+C ERCCSGR  A +R K     +D  DE+L+EA+H+CLK CNL LSCG
Sbjct: 411 KCESLLSCRRHKCAERCCSGRPAAEERRKNSSRFQDVNDETLMEAEHVCLKACNLTLSCG 470

Query: 459 IHYCRRKCHPGKCSPCLESDSNDLSCPCGKTVVPAPVRCGTKLPPCRHPCIKTLQADTVC 518
            H C+RKCHPGKC PCLESDSNDL CPCGKT+VPAPVRCGTKLP CRHPCIK ++  + C
Sbjct: 471 QHQCQRKCHPGKCPPCLESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPCIKVVEGISEC 530

Query: 519 GHPPMPHECHSLEQPCPQCTAPIYKKCKCNKVEKVRTLCFQNDVSCGKICGLPLKNCSHT 578
           GH P+PH CH L+QPCP CTA ++K CKC K  +VRT+CFQ DVSCG+ CG PL NC H 
Sbjct: 531 GHKPIPHACHPLDQPCPPCTATVFKPCKCGKNSRVRTICFQKDVSCGQTCGKPLPNCHHF 590

Query: 579 CKRTCHEPGQCQTICKQICGLPRKFCEHKCFARCHPGKDCPDEACQVKVKVTCSCGRKES 638
           C++TCH PGQCQ  CKQ+C  P   C HKC   CH    CPD  C   VK+ C CGRKE 
Sbjct: 591 CQKTCHLPGQCQATCKQVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVKIRCPCGRKEV 650

Query: 639 ILPCDAHADQPSSKLLITLPCDDKCEESKRHRMLMEAFGIKEKLT--APVEE-----LRD 691
            + C A +   SS     L CD++CE   RHR L EAFGI +K+   + ++E     L  
Sbjct: 651 EVTCGATSTLSSSLFTERLECDEECEAYTRHRQLKEAFGITDKVANGSAMKEKEGTRLEG 710

Query: 692 LVESAKSFDELHLPFTESTLSVYSKQRAWCNQIESFLSKLMRDVTRTSLHFKPMKLPQRR 751
           L   A +F+EL  PFTEST+S Y +Q  WC +IE  L+  M +  ++SLHFKPMK PQR 
Sbjct: 711 LASKATTFEELQFPFTESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMKPPQRL 770

Query: 752 FIHELANAYALYSESQDREPKRSVFVKKVENKSHI-PLLCLGEALPLYHSFKQLQKERKV 810
           FI ELA AY LYSE+QD EPKRSVFVKK ++ S   P+  L E  PLY SFK L+KERK+
Sbjct: 771 FIRELAKAYNLYSEAQDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLLEKERKM 830

Query: 811 KELEKSTTRRLFNYTVDD--ANDVPHNAEFNCFLVKGVAPGVTKDELSDCLAEYLQFTLI 868
           ++    TT  L N  ++D  A    H+ + N FL+K ++ G T  +L +   +Y++ TLI
Sbjct: 831 QDFLAKTTTHLINVKLNDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKYMEKTLI 890

Query: 869 QNPSYQTL-ENGDFLIYPEDHMSISENVENDIKRLAPYISSICKEKQISEGVKLYKIDEN 927
           +NP YQ L E    ++YPED+ +IS N  ND++ L  +I+ I  +  +++  +L      
Sbjct: 891 RNPQYQELPEENSAIVYPEDYRTISANAVNDMENLVGHINFIVNDAFLADSAELCDASSK 950

Query: 928 LKTFTSEEYLQE--EQPEKQ 945
           L    SE  + E  E PE Q
Sbjct: 951 LPEEISENDISERLETPEVQ 970

>TDEL0G02190 Chr7 (430157..432967) [2811 bp, 936 aa] {ON} Anc_2.288
           YNL023C
          Length = 936

 Score = 1035 bits (2677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/949 (53%), Positives = 648/949 (68%), Gaps = 32/949 (3%)

Query: 1   MDKHVSPLRVSSELPDSHSTSEYSSSGDASDDHENYXXXXXXXXXXXLPYYEKTIHEIQK 60
           +++H   L  S +  DS  +SE  S  +  D+H+             + YYE+ + EI  
Sbjct: 6   LNQHSLVLEFSED--DSDFSSESCSVHEVRDEHD-------------MAYYERAVQEIAL 50

Query: 61  GDSYACMICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLDKTWKCPNCYYVNS 120
           GD Y CMICT+EMDYTC MYAC  CYRV+D+ECIREWALKS++K+LD+ WKCPNCY VN 
Sbjct: 51  GDRYVCMICTVEMDYTCKMYACEGCYRVFDYECIREWALKSTEKTLDRVWKCPNCYKVNK 110

Query: 121 EIPVKNRHTCWCGKVVHPESNPIDPNSCGQTCNAPICSHGCSKPCHLGPHPECMRTTKVK 180
            +P KNR TCWCGK V+P+ NP+DPNSCGQTC+APIC HGCSK CHLGPHP+C+RT   K
Sbjct: 111 RVPAKNRPTCWCGKTVNPDPNPLDPNSCGQTCDAPICPHGCSKQCHLGPHPDCVRTITTK 170

Query: 181 CLCGKHTKDMFCYQ--SEEEKASYQCGEPCNLLLPCGVHKCQRKCHSGPCGNCEETISGK 238
           C CGKHT++ FCYQ  S + K+ +QC E C L L CG+HKC+R CHSG CG C   ++ K
Sbjct: 171 CQCGKHTRETFCYQTISMKGKSQFQCNEVCGLPLACGIHKCERLCHSGICGPCPAVLNAK 230

Query: 239 -----IMCYCGMETREQIICKDVKSVAK-SKNKSGEIWIGVFSCAHLRSVEYSCGHHSFQ 292
                I CYCG+E R+   CKDV+  +  SK+  G+ WIG F C+ +R +EY+C  HSF 
Sbjct: 231 SNKLKIRCYCGLEHRDSFKCKDVRVASDLSKDGKGDSWIGAFGCSGIRKIEYACREHSFV 290

Query: 293 ESCTAPPTNSGELACPFSPRLLKTCPCGSTPLKLLEAPRKKCTDPIPTCENRCNKPLKCG 352
           E C   P+ SG++ACPFSP+LLKTCPCG T LK+L  PRK CT PIP C++ C K L CG
Sbjct: 291 EKCQPSPSISGKIACPFSPKLLKTCPCGRTSLKVLAEPRKSCTSPIPNCDSTCGKKLACG 350

Query: 353 KHSCPFVCHDGPCMDPCVSVDKVSCSCHSKSFLVPCQFHDEAHCNTKCESLMSCRRHRCT 412
           +H+CPF CHDGPCMDPC+ ++ V CSCH   + VPCQF ++  C+TKCESLMSCRRHRCT
Sbjct: 351 RHTCPFTCHDGPCMDPCIQIETVRCSCHKNLYSVPCQFKEQPRCDTKCESLMSCRRHRCT 410

Query: 413 ERCCSGRSLAIKREKTIFLARDRLDESLVEAQHICLKPCNLKLSCGIHYCRRKCHPGKCS 472
           ERCC GR  A +R KT   +R+ +DES VE++HICLK CNL LSCG H C+RKCHPGKC 
Sbjct: 411 ERCCCGRPFAERRRKTPLSSRELMDESSVESEHICLKDCNLTLSCGCHKCQRKCHPGKCP 470

Query: 473 PCLESDSNDLSCPCGKTVVPAPVRCGTKLPPCRHPCIKTLQADTVCGHPPMPHECHSLEQ 532
           PCLESDSNDL CPCGKTVV APVRCGT+LPPC +PCI+ +Q    CGH PMPH CH L +
Sbjct: 471 PCLESDSNDLVCPCGKTVVEAPVRCGTRLPPCHYPCIRVIQNAYKCGHKPMPHTCHPLNE 530

Query: 533 PCPQCTAPIYKKCKCNKVEKVRTLCFQNDVSCGKICGLPLKNCSHTCKRTCHEPGQCQTI 592
           PCP CTAP++K CKC K +KVRTLCFQNDVSCG  CG PL NC H C+++CH PG+CQ  
Sbjct: 531 PCPSCTAPVFKPCKCGKKDKVRTLCFQNDVSCGTTCGKPLDNCPHMCQKSCHIPGECQKK 590

Query: 593 CKQICGLPRKFCEHKCFARCHPGKDCPDEACQVKVKVTCSCGRKESILPCDAHADQPSSK 652
           CKQIC   R +C+HKC   CH    CPD  C + VK+ C C  KES + C A+++ PS  
Sbjct: 591 CKQICNRKRIYCDHKCRLICHGNDKCPDIPCPLSVKIKCECEVKESFITCGANSETPSKA 650

Query: 653 LLITLPCDDKCEESKRHRMLMEAFGIKEKLTAP----VEELRDLVESAKSFDELHLPFTE 708
               LPCD++CE  KRH  L EAFGI      P       L +L   A SF+EL LPF+E
Sbjct: 651 TTTILPCDEECERHKRHLQLREAFGISNFSDNPSRSKTASLENLAAVANSFEELELPFSE 710

Query: 709 STLSVYSKQRAWCNQIESFLSKLMRDVTRTSLHFKPMKLPQRRFIHELANAYALYSESQD 768
             L  ++KQ AWC QIE+ L+  M +  +TSLHFKPM+  QR FIHELA +Y LY ESQD
Sbjct: 711 PALGTFAKQEAWCTQIENVLNSFMDNEEKTSLHFKPMRPAQRHFIHELAKSYNLYVESQD 770

Query: 769 REPKRSVFVKKVENKSHI-PLLCLGEALPLYHSFKQLQKERKVKELEKSTTRRLFNYTVD 827
           REPKRSVFVKK +N     P++ L ++LP+Y  FK+ +KE+K +  E  TT    N+   
Sbjct: 771 REPKRSVFVKKQDNGGSCKPVIQLKDSLPIYQFFKENEKEKKAQRFEAQTTTEFVNFIPK 830

Query: 828 DANDVPHNAEFNCFLVKGVAPGVTKDELSDCLAEYLQFTLIQNPSYQTLENG-DFLIYPE 886
           +   +   A+ N F +K V+ G TK++L    A++L+ TL++NP ++  ++  + LIYPE
Sbjct: 831 EEPQL-ERAKNNAFKLKNVSTGTTKEDLERIFADHLKPTLVKNPQFKIQDSTKNGLIYPE 889

Query: 887 DHMSISENVENDIKRLAPYISSICKEKQISEGVKLYKIDENLKTFTSEE 935
           D+  IS NVE D++ L  +   +CKE  I +G++L  ID  LK     E
Sbjct: 890 DYAEISVNVERDLEALVGHFDYLCKESFIGDGIELCHID--LKVLQESE 936

>Skud_14.306 Chr14 complement(558943..561855) [2913 bp, 970 aa] {ON}
           YNL023C (REAL)
          Length = 970

 Score = 1031 bits (2667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/907 (55%), Positives = 631/907 (69%), Gaps = 15/907 (1%)

Query: 48  LPYYEKTIHEIQKGDSYACMICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLD 107
           L YYE+ I EI KGDSY CMICT+EMDYTC M+AC +CYRV+D+ CIREWALKS++K++D
Sbjct: 55  LQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTVD 114

Query: 108 KTWKCPNCYYVNSEIPVKNRHTCWCGKVVHPESNPIDPNSCGQTCNAPICSHGCSKPCHL 167
           K WKCPNCY+V  ++P +NR TCWCG VV+P+ N +DPNSCGQTCNAP C HGC K CHL
Sbjct: 115 KIWKCPNCYHVGKKVPTRNRPTCWCGNVVNPDPNQLDPNSCGQTCNAPTCVHGCFKICHL 174

Query: 168 GPHPECMRTTKVKCLCGKHTKDMFCYQSEEEKASYQCGEPCNLLLPCGVHKCQRKCHSGP 227
           GPHPEC R  ++KC CG+H+K +FCYQS+  +  + C E C L L CGVHKC++KCHSG 
Sbjct: 175 GPHPECTRMVEIKCHCGRHSKTIFCYQSKAMRRRFNCQEECGLSLSCGVHKCKKKCHSGL 234

Query: 228 CGNCEETISG------KIMCYCGMETREQIICKDV---KSVAKSKNKSGEIWIGVFSCAH 278
           CG+C E I        +I CYCG   +  I C +    KS   SK++SG  W GVF+CA 
Sbjct: 235 CGSCPEFIINDDSSKKQIKCYCGNHIQNSIKCSEARFPKSGRTSKDESGNEWAGVFACAD 294

Query: 279 LRSVEYSCGHHSFQESCTAPPTNSGELACPFSPRLLKTCPCGSTPLKLLEAPRKKCTDPI 338
           +R+V+Y+C  HSF E C +PPT SG+  CPF P LLKTCPCG T L+ L  PRK C DPI
Sbjct: 295 IRTVDYACHKHSFIEPCLSPPTISGQKTCPFLPSLLKTCPCGRTALEELTKPRKHCHDPI 354

Query: 339 PTCENRCNKPLKCGKHSCPFVCHDGPCMDPCVSVDKVSCSCHSKSFLVPCQFHDEAHCNT 398
           PTC +RC+KPLKCGKH CPF CHDG CMDPC+ +D  +CSC   +F +PC F +   CN 
Sbjct: 355 PTCNSRCSKPLKCGKHLCPFTCHDGACMDPCLQIDSANCSCEQSTFSIPCGFQESPRCNI 414

Query: 399 KCESLMSCRRHRCTERCCSGRSLAIKREKTIFLARDRLDESLVEAQHICLKPCNLKLSCG 458
           KCESLMSCRRHRC +RCCSGR  AI+R+K+ F ++D LDESLVEA+HICLKPCNL LSCG
Sbjct: 415 KCESLMSCRRHRCIDRCCSGRPSAIRRKKSFFRSQDLLDESLVEAKHICLKPCNLTLSCG 474

Query: 459 IHYCRRKCHPGKCSPCLESDSNDLSCPCGKTVVPAPVRCGTKLPPCRHPCIKTLQADTVC 518
           +H C+RKCHPGKC PCLESDSNDL C CGKTVVPAPVRCGTKLP C HPCIK ++ ++ C
Sbjct: 475 LHKCQRKCHPGKCPPCLESDSNDLICACGKTVVPAPVRCGTKLPTCNHPCIKVVRGESWC 534

Query: 519 GHPPMPHECHSLEQPCPQCTAPIYKKCKCNKVEKVRTLCFQNDVSCGKICGLPLKNCSHT 578
           GH PMPH CH     CP CT  ++K C+C K +KVRT+CFQ DVSCG  CG+PL  C HT
Sbjct: 535 GHKPMPHTCHPSNISCPPCTETVFKPCRCGKKDKVRTVCFQADVSCGTSCGIPLSGCYHT 594

Query: 579 CKRTCHEPGQCQTICKQICGLPRKFCEHKCFARCHPGKDCPDEACQVKVKVTCSCGRKES 638
           C++TCH  G+CQ +CKQICG  R  C H C   CH   +CPD  C   VK+TC CGR + 
Sbjct: 595 CQKTCHLLGKCQKVCKQICGQKRLDCIHTCPKPCHGKTECPDLPCAALVKITCECGRIKK 654

Query: 639 ILPCDAHADQPSSKLLITLPCDDKCEESKRHRMLMEAFGIKEK----LTAPVEELRDLVE 694
            + C A  D  S      L C+++CE  KR + L EAFG+ E     +   ++ L +LV 
Sbjct: 655 SITCSAKRDTVSVITSSILDCNEECETLKRLKELREAFGVSEGPNNVIRNELDALSELVS 714

Query: 695 SAKSFDELHLPFTESTLSVYSKQRAWCNQIESFLSKLMRDVTRTSLHFKPMKLPQRRFIH 754
            AK+F+EL LPFTE+TLSVYSKQ  WC QIE  L+KLM    R+SLHFKPM+ PQR FIH
Sbjct: 715 VAKTFEELQLPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRSSLHFKPMRPPQRHFIH 774

Query: 755 ELANAYALYSESQDREPKRSVFVKKVEN-KSHIPLLCLGEALPLYHSFKQLQKERKVKEL 813
           E+A AY LY+ESQDREP RSVF+KK +N  S  P+L L EA PLY SFKQ QKERK++E 
Sbjct: 775 EMAKAYNLYAESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQKERKLQEF 834

Query: 814 EKSTTRRLFNYTVDDANDVPHNAEFNCFLVKGVAPGVTKDELSDCLAEYLQFTLIQNPSY 873
           +  TT +L N+ V DA      A+ N FLV+ +  G T ++L      +L+ TL+ NP Y
Sbjct: 835 QARTTAKLINFEVQDAESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLKHTLVANPQY 894

Query: 874 QTLENG-DFLIYPEDHMSISENVENDIKRLAPYISSICKEKQISEGVKLYKIDENLKTFT 932
             L++    LIYPE++ + S N E D++ L  +   + KE  +++ + L  +DE +    
Sbjct: 895 LILDDSRSALIYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIHLCSVDEEIGKRL 954

Query: 933 SEEYLQE 939
               +QE
Sbjct: 955 DSPAIQE 961

>TBLA0B05950 Chr2 (1404509..1407496) [2988 bp, 995 aa] {ON}
           Anc_2.288 YNL023C
          Length = 995

 Score = 1012 bits (2617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/947 (53%), Positives = 652/947 (68%), Gaps = 18/947 (1%)

Query: 25  SSGDASDDHENYXXXXXXXXXXXLPYYEKTIHEIQKGDSYACMICTMEMDYTCHMYACPE 84
           ++ D S D +             L YYE+ + EI KGDSY CMICT+EMD+TC MYAC  
Sbjct: 46  NNSDLSRDEDESDVDTDNEYEEDLMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRH 105

Query: 85  CYRVYDHECIREWALKSSQKSLDKTWKCPNCYYVNSEIPVKNRHTCWCGKVVHPESNPID 144
           CYRV+D++CIREWALKS+QK++DKTWKCPNCY+ + ++P+K+R TCWCGKVV+P+ NP+D
Sbjct: 106 CYRVFDYDCIREWALKSTQKTVDKTWKCPNCYHSSKKVPLKDRPTCWCGKVVNPDPNPLD 165

Query: 145 PNSCGQTCNAPICSHGCSKPCHLGPHPECMRTTKVKCLCGKHTKDMFCYQSEEEKASYQC 204
           PNSCGQTCNA IC H C K CHLG HPEC +  K+ C CG+ TKD++C++S  +K+ + C
Sbjct: 166 PNSCGQTCNANICPHKCLKQCHLGSHPECTQLLKITCRCGRETKDIYCHESRRQKSIFHC 225

Query: 205 GEPCNLLLPCGVHKCQRKCHSGPCGNC-----EETISGKIMCYCGMETREQIICKDV--- 256
            + C L LPCG+HKC+RKCHSG CG+C     +E +SGKI CYCG+ + +++ CKDV   
Sbjct: 226 DQECGLTLPCGIHKCRRKCHSGLCGSCPELLIDENVSGKIKCYCGLHSLKEMNCKDVAFP 285

Query: 257 KSVAKSKNKSGEIWIGVFSCAHLRSVEYSCGHHSFQESCTAPPTNSGELACPFSPRLLKT 316
            S   S+N+  + W+G+F C  +RSV Y+C  H F E C APPT    + CPFSP LLKT
Sbjct: 286 SSGKISRNQEDKEWVGIFDCKEMRSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLKT 345

Query: 317 CPCGSTPLKLLEAPRKKCTDPIPTCENRCNKPLKCGKHSCPFVCHDGPCMDPCVSVDKVS 376
           CPCG T L+ ++  R KCTDPIPTC+N CNK LKCGKH CPF CH G CMDPC+ +DK+ 
Sbjct: 346 CPCGKTALQDMDCERTKCTDPIPTCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKMD 405

Query: 377 CSCHSKSFLVPCQFHDEAHCNTKCESLMSCRRHRCTERCCSGRSLAIKREKTIFLARDRL 436
           C+C  ++FLVPCQF  +  C  KCESLMSCRRHRC E CCSGR  A +R+KTI  + DR 
Sbjct: 406 CACERRTFLVPCQFKGKPVCKFKCESLMSCRRHRCMEYCCSGRPYAERRKKTILRSSDRN 465

Query: 437 DESLVEAQHICLKPCNLKLSCGIHYCRRKCHPGKCSPCLESDSNDLSCPCGKTVVPAPVR 496
           DE+LVEA+H+CLK CNLKLSCGIH C+RKCHPG C PCLESDSNDL CPCGKTV+PAPVR
Sbjct: 466 DETLVEAEHVCLKDCNLKLSCGIHTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPVR 525

Query: 497 CGTKLPPCRHPCIKTLQADTVCGHPPMPHECHSLEQPCPQCTAPIYKKCKCNKVEKVRTL 556
           CGT LPPC++PCIK ++ ++ CGH PMPH CHSL+QPCP CTAP++K CKC K +KVRT+
Sbjct: 526 CGTTLPPCKYPCIKVIRGESDCGHKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRTM 585

Query: 557 CFQNDVSCGKICGLPLKNCSHTCKRTCHEPGQCQTICKQICGLPRKFCEHKCFARCHPGK 616
           CFQ DVSCG  CGLPLK+C H C++ CH PG+CQ  C QIC   R  C H C  RCH   
Sbjct: 586 CFQEDVSCGLPCGLPLKDCYHKCQKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKNA 645

Query: 617 DCPDEACQVKVKVTCSCGRKESILPCDAHADQPSSKLLITLPCDDKCEESKRHRMLMEAF 676
            CPD  C V V V C CGR++ + PC + +   S  +   L CD++C    R   L  AF
Sbjct: 646 PCPDIPCTVPVTVVCDCGRRKLVKPCSSTSTIDSVTITSHLECDEECMLLLRRMELKAAF 705

Query: 677 GI-----KEKLTAPVEELRDLVESAKSFDELHLPFTESTLSVYSKQRAWCNQIESFLSKL 731
           GI      +K +  +E +++ +  AK+++EL LPF E+ L+VY+KQ  WC+QIE  L+K 
Sbjct: 706 GIVNGLGDDKTSVAIERIQNRISVAKAYEELELPFVEAVLTVYAKQPKWCSQIEGILNKF 765

Query: 732 MRDVTRTSLHFKPMKLPQRRFIHELANAYALYSESQDREPKRSVFVKKVEN-KSHIPLLC 790
           M +  ++SLHFK MK PQR F+H LA+AY +YSESQD EP RSVFVKK+ N  S  P+L 
Sbjct: 766 MDEKLKSSLHFKHMKAPQRSFVHNLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPILT 825

Query: 791 LGEALPLYHSFKQLQKERKVKELEKSTTRRLFNYTVDDANDVPHNAEFNCFLVKGVAPGV 850
           L EALPLY SFK++QKE+K +E E  T + L N   +         ++N FL+K +  G 
Sbjct: 826 LEEALPLYESFKEVQKEKKKQEYEARTHKTLINVEAETQTQ-QSATKYNGFLIKNLVKGT 884

Query: 851 TKDELSDCLAEYLQFTLIQNPSYQTL-ENGDFLIYPEDHMSISENVENDIKRLAPYISSI 909
           T+++L     E L+ TL+++P Y  + E+    I P D+  IS NVE D+++L  +  S+
Sbjct: 885 TEEDLERIFGESLKPTLVKDPQYLVMDESHHGFICPADYAEISINVERDMEQLIGFFDSL 944

Query: 910 CKEKQISEGVKLYKIDENLKTFTSEEYLQEEQPEKQASFEINTDGEV 956
           CKE  I + V+L  IDE L        L++ + EK  S E+  D ++
Sbjct: 945 CKEHFIGDIVELCNIDEAL--LQENVDLEDSEEEKLTSPEVENDSDI 989

>CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa]
           {ON} similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023c FAP1
          Length = 956

 Score =  969 bits (2504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/896 (54%), Positives = 608/896 (67%), Gaps = 15/896 (1%)

Query: 48  LPYYEKTIHEIQKGDSYACMICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLD 107
           + YYEK + EI KGDSY+C+ICT+E+DYTC +YAC +CYRVYD+ECIREWA KS+ K  D
Sbjct: 59  MAYYEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDYECIREWAEKSTSKRTD 118

Query: 108 KTWKCPNCYYVNSEIPVKNRHTCWCGKVVHPESNPIDPNSCGQTCNAPICSHGCSKPCHL 167
           K W CPNC+Y    IP KNR TCWCG+ V+PE NP++PNSCGQTCNA ICSHGCS+ CHL
Sbjct: 119 KLWACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQTCNAKICSHGCSQICHL 178

Query: 168 GPHPECMRTTKVKCLCGKHTKDMFCYQSEEEKASYQCGEPCNLLLPCGVHKCQRKCHSGP 227
           GPH EC R   +KC CGK TKD+ C+Q       + C   C+ LLPCG+HKC RKCH+G 
Sbjct: 179 GPHQECTRMMSIKCSCGKVTKDIVCFQRRLYSKGFNCETVCDKLLPCGIHKCNRKCHTGL 238

Query: 228 CGNCEETI-----SGKIMCYCGMETREQIICKDVK---SVAKSKNKSGEIWIGVFSCAHL 279
           CG+C ETI     + KI CYCG  ++++I CKDV+   + A SK+  G+ WIGVF C  +
Sbjct: 239 CGSCPETIISKNTNMKIRCYCGQTSKDKIKCKDVRFPANAAYSKDDKGQRWIGVFMCDKI 298

Query: 280 RSVEYSCGHHSFQESCTAPPTNSGELACPFSPRLLKTCPCGSTPLKLLEAPRKKCTDPIP 339
           R V Y CG HSF E C APP+ SG L C FSP+ LKTCPCG   L  L  PR KCTD IP
Sbjct: 299 RKVPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGKNELTDLSKPRSKCTDAIP 358

Query: 340 TCENRCNKPLKCGKHSCPFVCHDGPCMDPCVSVDKVSCSCHSKSFLVPCQFHDEAHCNTK 399
           TC   C K LKCGKH CPF CH G CMDPC  ++KV C+C  K F +PC F+D A CN K
Sbjct: 359 TCGQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACEQKQFTIPCGFNDHARCNLK 418

Query: 400 CESLMSCRRHRCTERCCSGRSLAIKREKTIFL-ARDRLDESLVEAQHICLKPCNLKLSCG 458
           CESLMSCRRHRCTERCC+GR LA +R KT+ +  RD  DES +E  HICLK CNL LSCG
Sbjct: 419 CESLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADESTIEPIHICLKDCNLTLSCG 478

Query: 459 IHYCRRKCHPGKCSPCLESDSNDLSCPCGKTVVPAPVRCGTKLPPCRHPCIKTLQADTVC 518
           IH C RKCH GKC PCLESDSNDL CPCGKT+V APVRCGTKLP C +PCI+ ++ +T C
Sbjct: 479 IHKCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPNCPYPCIRVVRGETDC 538

Query: 519 GHPPMPHECHSLEQPCPQCTAPIYKKCKCNKVEKVRTLCFQNDVSCGKICGLPLKNCSHT 578
           GH PMPHECH  + PCP CTA ++K CKC K ++VRT+CF  DVSCGK+CG  L+ C H 
Sbjct: 539 GHSPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTVCFMKDVSCGKVCGERLQTCYHK 598

Query: 579 CKRTCHEPGQCQTICKQICGLPRKFCEHKCFARCHPGKDCPDEACQVKVKVTCSCGRKES 638
           C++ CHEPG CQT+CKQ C +PR +C H+C   CH  ++CPD  C   VK+TC CGR E 
Sbjct: 599 CQKKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKFEECPDIPCTALVKITCPCGRIEK 658

Query: 639 ILPCDAHADQPSSKLLITLPCDDKCEESKRHRMLMEAFGIKEK----LTAPVEELRDLVE 694
            + C  ++    ++    + CD++C   +RH  L EAFGI +K        +  L  ++ 
Sbjct: 659 EVTCGVYSKNKEAQDSTRIVCDEECAVLQRHMQLKEAFGIVDKPQNTHNEEMARLEQVIS 718

Query: 695 SAKSFDELHLPFTESTLSVYSKQRAWCNQIESFLSKLMRDVTRTSLHFKPMKLPQRRFIH 754
           +A +F +L LPFTE  ++ Y +   WC  IE+ L+KL+ D  RTSLHFKPM+ PQR FI 
Sbjct: 719 TASTFADLDLPFTEPVITTYIRHENWCTDIENTLNKLIDDNNRTSLHFKPMRPPQRYFIR 778

Query: 755 ELANAYALYSESQDREPKRSVFVKK-VENKSHIPLLCLGEALPLYHSFKQLQKERKVKEL 813
           ELA AY LYSESQD EP RSVFVKK ++  S  P+L + EA PLY S+K+L+KE+K    
Sbjct: 779 ELAKAYNLYSESQDPEPNRSVFVKKNLDGSSTKPILSISEAAPLYQSYKKLEKEKKQANF 838

Query: 814 EKSTTRRLFNYTVDDANDVPHNAEFNCFLVKGVAPGVTKDELSDCLAEYLQFTLIQNPSY 873
           E  TT RL N+T + + ++   A FN FLV  V    + D+L +  A YL+ TL+  P +
Sbjct: 839 ESMTTTRLINFTPEMSPELESAARFNGFLVTNVGEFTSTDDLQNLFAPYLKSTLVVEPQF 898

Query: 874 QTL-ENGDFLIYPEDHMSISENVENDIKRLAPYISSICKEKQISEGVKLYKIDENL 928
           Q L E    +IYP  +  IS NVE D++ L  +   + KE  ++ GV+L  I+  L
Sbjct: 899 QILPERKQAVIYPNKYKEISINVERDMETLVQHFDFLIKESLLAGGVELCNIENVL 954

>ZYRO0A01936g Chr1 (159749..162610) [2862 bp, 953 aa] {ON} similar
           to uniprot|P53971 Saccharomyces cerevisiae YNL023C
          Length = 953

 Score =  967 bits (2501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/909 (52%), Positives = 623/909 (68%), Gaps = 21/909 (2%)

Query: 48  LPYYEKTIHEIQKGDSYACMICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLD 107
           + YYE+ + EI +GD+Y CMICT+EMDYTC M+AC +CYRV+D++CIREWALKS+ +++D
Sbjct: 56  MMYYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMD 115

Query: 108 KTWKCPNCYYVNSEIPVKNRHTCWCGKVVHPESNPIDPNSCGQTCNAPICSHGCSKPCHL 167
           KTWKCPNC   ++++P K+R TCWCGKVV+P+ NP+DPNSCGQTC+APIC HGCSK CHL
Sbjct: 116 KTWKCPNCLDESNKVPRKSRPTCWCGKVVNPDPNPLDPNSCGQTCDAPICEHGCSKVCHL 175

Query: 168 GPHPECMRTTKVKCLCGKHTKDMFCYQ-SEEEKASYQCGEPCNLLLPCGVHKCQRKCHSG 226
           GPHPEC R   +KC CG+HT+D+ C +        + C E C LLLPCGVHKC +KCHSG
Sbjct: 176 GPHPECTRIISIKCKCGRHTRDVRCSEVGSGRNQQFTCEESCGLLLPCGVHKCSKKCHSG 235

Query: 227 PCGNCEETISGK------IMCYCGMETREQIICKDVKSVAK-SKNKSGEIWIGVFSCAHL 279
            CG C ET+  K      I CYCG+     I C DV+   + S +  G  WIGVF C  +
Sbjct: 236 LCGGCNETLHSKPDKGAVIKCYCGLHESPSIRCGDVRVADRDSVDDQGNGWIGVFRCKDV 295

Query: 280 RSVEYSCGHHSFQESCTAPPTNSGELACPFSPRLLKTCPCGSTPLKLLEAPRKKCTDPIP 339
           R VEY+CG HSF ESC   P+   ++ CPFSP +L++CPCG TPL  L   R KCTD IP
Sbjct: 296 RVVEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCTDHIP 355

Query: 340 TCENRCNKPLKCGKHSCPFVCHDGPCMDPCVSVDKVSCSCHSKSFLVPCQFHDEAHCNTK 399
           TCE++C K L CGKH+CP+ CH+G CMDPCV  +K +C C ++SFLVPCQF ++  CNTK
Sbjct: 356 TCESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPRCNTK 415

Query: 400 CESLMSCRRHRCTERCCSGRSLAIKREKTIFLARDRLDESLVEAQHICLKPCNLKLSCGI 459
           CESLMSCRRHRCTE+CCSG+  A +R+KT F +R+ LDESLVEA+H+CLK CNL L+CG 
Sbjct: 416 CESLMSCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVEAEHVCLKSCNLTLTCGR 475

Query: 460 HYCRRKCHPGKCSPCLESDSNDLSCPCGKTVVPAPVRCGTKLPPCRHPCIKTLQADTVCG 519
           H C+RKCHPG+C PCLESD NDL CPCGKTVV APVRCGTKLPPC + CI  ++    CG
Sbjct: 476 HKCQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDGYPCG 535

Query: 520 HPPMPHECHSLEQPCPQCTAPIYKKCKCNKVEKVRTLCFQNDVSCGKICGLPLKNCSHTC 579
           H PMPH CH  E+ CP CTA + K CKC K   VRTLCFQ DVSCG+IC  PL +C HTC
Sbjct: 536 HTPMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPLGSCRHTC 595

Query: 580 KRTCHEPGQCQTICKQICGLPRKFCEHKCFARCHPGKDCPDEACQVKVKVTCSCGRKESI 639
           ++ CH+ G CQ  C+QICG  R  C+HKC   CH G+ CPD  C   V + C+CGRKES 
Sbjct: 596 QKKCHD-GGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGRKEST 654

Query: 640 LPCDAHADQPSSKLLITLPCDDKCEESKRHRMLMEAFGIKEKLTAPVEELRDLVESAKSF 699
            PC  ++   S+ +   L CD++CE  KR   L +A G+KE   + VE        A +F
Sbjct: 655 EPCGTNSQTLSASVTRELSCDEECERVKRCAQLKDALGLKENGDSSVENTVSNALVASNF 714

Query: 700 DELHLPFTESTLSVYSKQRAWCNQIESFLSKLMRDVTRTSLHFKPMKLPQRRFIHELANA 759
           +EL LPF E+ L++YS+Q+ +C+ IES L+  + D  ++SLHFKPMK  QR F+HELA A
Sbjct: 715 EELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHFVHELAKA 774

Query: 760 YALYSESQDREPKRSVFVKK-VENKSHIPLLCLGEALPLYHSFKQLQKERKVKELEKSTT 818
           Y LYSESQD EPKRSV+VKK +  +S+ P + L EALP+Y +FKQ +KE K++  E    
Sbjct: 775 YKLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETKIRRYEMQNV 834

Query: 819 RRLFNYTVDDANDVPHNAEFNCFLVKGVAPGVTKDELSDCLAEYLQFTLIQNPSYQTLEN 878
             L N+ V         A++N FL++ +  G   ++L     E+L+ TL++NP Y+ L +
Sbjct: 835 TNLVNF-VPKFEPTVELAKYNGFLIRNLTDGTNGEDLQRIYGEHLKPTLVRNPVYKALPD 893

Query: 879 GDF-LIYPEDHMSISENVENDIKRLAPYISSICKEKQISEGVKLYKIDENLKTFTSEEYL 937
            +  LI+PE +  ++ N E D++RL  +   ICKE  I +GV+L ++          EYL
Sbjct: 894 RNIALIFPESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQVG---------EYL 944

Query: 938 QEEQPEKQA 946
           Q E P + +
Sbjct: 945 QPEAPTESS 953

>KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {ON}
           similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023C
          Length = 921

 Score =  954 bits (2467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/891 (52%), Positives = 608/891 (68%), Gaps = 9/891 (1%)

Query: 48  LPYYEKTIHEIQKGDSYACMICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLD 107
           +PYYE+T+ EI+ GD Y CMICT+E+D TC MYAC  CYRV+D+EC+REWALKS+ K+LD
Sbjct: 32  IPYYEQTVKEIKDGDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTLD 91

Query: 108 KTWKCPNCYYVNSEIPVKNRHTCWCGKVVHPESNPIDPNSCGQTCNAPICSHGCSKPCHL 167
           K+WKCPNCY +N +IP + R TCWCGKVV+P+ N +DPNSCGQTCNA  C HGCSK CHL
Sbjct: 92  KSWKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCHL 151

Query: 168 GPHPECMRTTKVKCLCGKHTKDMFCYQSEEEKASYQCGEPCNLLLPCGVHKCQRKCHSGP 227
           GPHPEC+   ++KC CGKH K + C +S+    SY CG+ C LLLPCG H CQ+ CH+G 
Sbjct: 152 GPHPECLIPVQIKCKCGKHCKQIPCSRSKVLGNSYNCGDVCGLLLPCGKHTCQKTCHTGF 211

Query: 228 CGNCEETISGKIMCYCGMETREQIICKDVKSVAKSKNKSGEIWIGVFSCAHLRSVEYSCG 287
           CG CE  I  ++ CYCG + +  I C D++ +  SK+ SG+ WIGV+SC  +R++ YSC 
Sbjct: 212 CGPCESIIKTELPCYCGSDVKSGIQCSDLRVLDYSKDVSGKKWIGVYSCGEVRTLHYSCD 271

Query: 288 HHSFQESCTAPPTNSGELACPFSPRLLKTCPCGSTPLKLLEAPRKKCTDPIPTCENRCNK 347
           HH++ E C AP        CPFSP+ LKTCPCG T LK L+ PR+KCTD IPTC N C K
Sbjct: 272 HHTYVEQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRRKCTDTIPTCSNVCGK 331

Query: 348 PLKCGKHSCPFVCHDGPCMDPCVSVDKVSCSCHSKSFLVPCQFHDEAHCNTKCESLMSCR 407
            L CGKH+CPF CH G CMDPC+ + K  C+CHSK+FL PCQ HD   CN KCES MSCR
Sbjct: 332 QLSCGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHDTPRCNIKCESNMSCR 391

Query: 408 RHRCTERCCSGRSLAIKREKTIFLARDRLDESLVEAQHICLKPCNLKLSCGIHYCRRKCH 467
           RH+C E CCSG+  A KREKT+FL RD  +E+LVE +H+CLK CNLKLSCGIH C  KCH
Sbjct: 392 RHKCMEICCSGKPAAKKREKTLFLKRDLNNETLVEPEHVCLKQCNLKLSCGIHDCTWKCH 451

Query: 468 PGKCSPCLESDSNDLSCPCGKTVVPAPVRCGTKLPPCRHPCIKTLQADTVCGHPPMPHEC 527
           PGKC PCLESD NDL CPCGKTVVPAPVRCGTKLPPC +PCIK  +    CGH   PH+C
Sbjct: 452 PGKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKISEGPAPCGHRVGPHKC 511

Query: 528 HSLEQPCPQCTAPIYKKCKCNKVEKVRTLCFQND--VSCGKICGLPLKNCSHTCKRTCHE 585
           H     CP CTA + KKC+C K   +RTLC   D  V+CG  CGLPL  C H C++ CH 
Sbjct: 512 HPAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGLPLATCHHKCQKKCHV 571

Query: 586 PGQCQTICKQICGLPRKFCEHKCFARCHPGKDCPDEACQVKVKVTCSCGRKESILPCDAH 645
            G+C+  C + CGL R  C H C  +CH    CP++ C  KV +TC C R+   + C A 
Sbjct: 572 EGECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVITCDCNRRTKQVECGAT 631

Query: 646 ADQPSSKLLITLPCDDKCEESKRHRMLMEAFGIKEKLTAPVEELRDLVESAKSFDELHLP 705
            D  S      LPCD++C + +RH  LMEAFG+ EK     E+L  +V  AK FD+L++P
Sbjct: 632 HDTQSRSETEKLPCDEECAKLQRHMELMEAFGMNEKPKNTKEQLESIVLVAKKFDDLNMP 691

Query: 706 FTESTLSVYSKQRAWCNQIESFLSKLMRDVTRTSLHFKPMKLPQRRFIHELANAYALYSE 765
           ++E  L+VY KQ  WC+QI +   K + D  + SLH KPM++PQR+FI ELA+AYALYSE
Sbjct: 692 YSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVPQRQFIKELASAYALYSE 751

Query: 766 SQDREPKRSVFVKKVENKSHIPLLCLGEALPLYHSFKQLQKERKVKELEKSTTRRLFNYT 825
           SQDREP RSV++KK++++S  P L L +A  LY  FK L+KER  +      T+ L N  
Sbjct: 752 SQDREPNRSVYLKKIQSQSKKPELTLKDASELYQLFKTLEKERMQEHYSTKVTKTLINIP 811

Query: 826 VDDANDVPHNAEF---NCFLVKGVAPGVTKDELSDCLAEYLQFTLIQNPSYQTLEN-GDF 881
              A++ P  A +   N  ++ GV      D +   + ++L++TL++ P Y+ L++    
Sbjct: 812 ---ASETPLPAPYEGPNAIVISGVFDSSQIDNIEPLVHDFLKYTLVKTPQYRFLKDLNSV 868

Query: 882 LIYPEDHMSISENVENDIKRLAPYISSICKEKQISEGVKLYKIDENLKTFT 932
           LI+PE++  I++N  +D++++ P+I +  +++ ++ GV++ ++DENL   +
Sbjct: 869 LIFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVDENLSLVS 919

>Kpol_1039.45 s1039 (135833..138739) [2907 bp, 968 aa] {ON}
           (135833..138739) [2907 nt, 969 aa]
          Length = 968

 Score =  943 bits (2437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/907 (53%), Positives = 613/907 (67%), Gaps = 32/907 (3%)

Query: 48  LPYYEKTIHEIQKGDSYACMICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLD 107
           L +YE+ I +I KGD Y CMICT+E+D T  MYAC  CYRV+D++CIREWA+KSSQKSLD
Sbjct: 66  LMHYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSSQKSLD 125

Query: 108 KTWKCPNCYYVNSEIPVKNRHTCWCGKVVHPESNPIDPNSCGQTCNAPICSHGCSKPCHL 167
           K WKCPNC + +++IP++NR TCWCGK V+P+ NP  PNSCGQTCNA  C H CS  CHL
Sbjct: 126 KVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCSHFCHL 185

Query: 168 GPHPECMRTTKVKCLCGKHTKDMFCY---QSEEEKASYQCGEPCNLLLPCGVHKCQRKCH 224
           GPHP+C RTT + C CGKHTKD+FCY     +     + CGE CN+ L CG+HKC R CH
Sbjct: 186 GPHPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKCSRVCH 245

Query: 225 SGPCGNCEETISGKIMCYCGMETREQIICKDVK---SVAKSKNKSGEIWIGVFSCAHLRS 281
           SG CG C E I+ K+ CYCG  T ++I C +VK   S  KSK++ G  WIGVF C  +R+
Sbjct: 246 SGSCGPCPELITKKVNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNTWIGVFKCNKIRT 305

Query: 282 VEYSCGHHSFQESCTAPPTNSGELACPFSPRLLKTCPCGSTPLKL----------LEAPR 331
           VEY+C +HSF E+CT+PPT SG   CP+SP+LLK                      E  R
Sbjct: 306 VEYACKNHSFFETCTSPPTISGTKICPYSPKLLK----------TCPCGKTNLDDFENKR 355

Query: 332 KKCTDPIPTCENRCNKPLKCGKHSCPFVCHDGPCMDPCVSVDKVSCSCHSKSFLVPCQFH 391
           +KCTDPI TCENRC+KPLKCGKH CPF CH+GPCMDPC  ++   CSC+ K F VPCQFH
Sbjct: 356 QKCTDPISTCENRCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQFH 415

Query: 392 DEAHCNTKCESLMSCRRHRCTERCCSGRSLAIKREKTIFLARDRLDESLVEAQHICLKPC 451
           ++  CN KCESLMSCRRHRCT RCCSG+ +A KR+K +F   D LDESLVEA+HICLK C
Sbjct: 416 EKPRCNMKCESLMSCRRHRCTRRCCSGKPMADKRKKMLFSQADLLDESLVEAEHICLKDC 475

Query: 452 NLKLSCGIHYCRRKCHPGKCSPCLESDSNDLSCPCGKTVVPAPVRCGTKLPPCRHPCIKT 511
           NLKLSCGIH C RKCH GKC PCLESDS+DL CPCGKTVV APVRCGTKLP C  PCIK 
Sbjct: 476 NLKLSCGIHNCTRKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCIKY 535

Query: 512 LQADTVCGHPPMPHECHSLEQPCPQCTAPIYKKCKCNKVEKVRTLCFQNDVSCGKICGLP 571
           ++    CGH P  H CH  + PCP CT  ++K CKC K +K + LCFQ   SCGK+C   
Sbjct: 536 IEGSYPCGHKPGNHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCEKK 595

Query: 572 LKNCSHTCKRTCHEPGQCQTICKQICGLPRKFCEHKCFARCHPGKDCPDEACQVKVKVTC 631
           L  C H C+  CH PG+CQ  C QIC   R  C H C  +CH   +CPD  C+VK +V C
Sbjct: 596 LDGCHHYCQLKCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEVYC 655

Query: 632 SCGRKESILPCDAHADQPSSKLLITLPCDDKCEESKRHRMLMEAFGIKEKLTAP---VEE 688
            CGR++ +L C A +   S +L   LPCDD C + +R   L  AFG+K     P   +E 
Sbjct: 656 GCGRRKELLLCGATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGMKSSSEDPESELER 715

Query: 689 LRDLVESAKSFDELHLPFTESTLSVYSKQRAWCNQIESFLSKLMRDVTRTSLHFKPMKLP 748
           L+ +VE   S++EL LPF+E+ LSVYSKQ  WCNQIE  ++K + D  + SLHFKPM  P
Sbjct: 716 LKKIVEKVTSYEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAP 775

Query: 749 QRRFIHELANAYALYSESQDREPKRSVFVKKVENKSHIPLLCLGEALPLYHSFKQLQKER 808
           QR FIH L  AY +YSESQDREPKRSV++KK    + IP + L EALPLY S+K+++KER
Sbjct: 776 QRNFIHALVEAYEMYSESQDREPKRSVYLKK-NKYTRIPNISLEEALPLYQSYKKIEKER 834

Query: 809 KVKELEKSTTRRLFNYTVDDANDVPHNAEFNCFLVKGVAPGVTKDELSDCLAEYLQFTLI 868
           KV+  E        NY   + +  P + ++N FL+KG+  G T D+L+     +L+ TLI
Sbjct: 835 KVQSFESKKNVTYLNYQPPERSLTP-DVKYNGFLIKGITFGTTTDDLNTLFGVHLKPTLI 893

Query: 869 QNPSYQTLENG-DFLIYPEDHMSISENVENDIKRLAPYISSICKEKQISEGVKLYKIDEN 927
           ++  Y  L +G   ++YP+D+++ISENVE DI+ LA +   + KE  + E V++  I + 
Sbjct: 894 KDAQYSILPDGKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNITDI 953

Query: 928 LKTFTSE 934
           L+T ++E
Sbjct: 954 LQTESAE 960

>Ecym_3327 Chr3 (626396..629176) [2781 bp, 926 aa] {ON} similar to
           Ashbya gossypii ADL213W
          Length = 926

 Score =  940 bits (2430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/900 (50%), Positives = 592/900 (65%), Gaps = 6/900 (0%)

Query: 48  LPYYEKTIHEIQKGDSYACMICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLD 107
           LPYYEK I +IQ G  Y C+ICT+E+D TC MYAC  CYRVYD+ECI EWA KSS++S D
Sbjct: 28  LPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYACSNCYRVYDYECIMEWAKKSSKRSAD 87

Query: 108 KTWKCPNCYYVNSEIPVKNRHTCWCGKVVHPESNPIDPNSCGQTCNAPICSHGCSKPCHL 167
            TWKCPNCY+  +++  K R TCWCGK ++PE N   PNSCGQTC A IC HGC+  CHL
Sbjct: 88  STWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNATYPNSCGQTCGASICKHGCASTCHL 147

Query: 168 GPHPECMRTTKVKCLCGKHTKDMFCYQSEEEKASYQCGEPCNLLLPCGVHKCQRKCHSGP 227
           GPHP+CM    +KC CGK T+ + CYQ++  K    C  PC L LPCGVH CQ+ CHSGP
Sbjct: 148 GPHPKCMVPVGLKCKCGKITEQISCYQTKAVKPKLSCKLPCGLPLPCGVHTCQKICHSGP 207

Query: 228 CGNCEETISGKIMCYCGMETREQIICKDVKSVAKSKNKSGEIWIGVFSCAHLRSVEYSCG 287
           CG C   +SGK  CYCG    + IICKDV     S++   + WIGVFSC ++R V Y C 
Sbjct: 208 CGRCNTVMSGKFKCYCGSNHLDSIICKDVAVTKMSRSGKHKKWIGVFSCKNIREVRYRCK 267

Query: 288 HHSFQESCTAPPTNSGELACPFSPRLLKTCPCGSTPLKLLEAPRKKCTDPIPTCENRCNK 347
            HSF ESC   P+    + CP+SP + KTC CG+T L  ++  R+KCTDPIPTC+ RC K
Sbjct: 268 EHSFNESCKPSPSPDARIQCPYSPNICKTCCCGNTTLIDMQQKREKCTDPIPTCDQRCGK 327

Query: 348 PLKCGKHSCPFVCHDGPCMDPCVSVDKVSCSCHSKSFLVPCQFHDEAHCNTKCESLMSCR 407
           PL CGKH+CP  CH G CMDPC+ +++  CSC  ++FL PCQF  +  CN KCE+LMSCR
Sbjct: 328 PLSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQERTFLTPCQFDGKPSCNIKCENLMSCR 387

Query: 408 RHRCTERCCSGRSLAIKREKTIFLARDRLDESLVEAQHICLKPCNLKLSCGIHYCRRKCH 467
           RHRC +RCCSG+ LA+ R  TI    D+ DESL+EA+HIC K CN KLSCG+H+C  KCH
Sbjct: 388 RHRCIKRCCSGKPLALARSSTITPWLDKNDESLIEAEHICFKNCNRKLSCGLHHCTNKCH 447

Query: 468 PGKCSPCLESDSNDLSCPCGKTVVPAPVRCGTKLPPCRHPCIKTLQADTVCGHPPMPHEC 527
           PGKC PCLESDSNDL CPCGK+V+ APVRCGT  P C +PCI TL+    CGH    H+C
Sbjct: 448 PGKCPPCLESDSNDLVCPCGKSVILAPVRCGTVRPNCNYPCINTLRGSMPCGHRAPFHKC 507

Query: 528 HSLEQPCPQCTAPIYKKCKCNKVEKVRTLCFQNDVSCGKICGLPLKNCSHTCKRTCHEPG 587
           H   + CP CTA +YK CKC K+   RT+CFQND+SCG+ C   L NC H C++ CH PG
Sbjct: 508 HPSTEDCPPCTAFVYKPCKCGKLTAARTICFQNDISCGRKCAAKLTNCHHLCQKQCHPPG 567

Query: 588 QCQTICKQICGLPRKFCEHKCFARCHPGKDCPDEACQVKVKVTCSCGRKESILPCDAHAD 647
           +C   C ++CGL R  CEH C A CH  + CPD  C  +V V+C CGR+   +PC A+ D
Sbjct: 568 ECPNTCTEVCGLKRSACEHLCTANCHGDEICPDVPCLEEVVVSCGCGRRSLKVPCGAYKD 627

Query: 648 QPSSKLLITLPCDDKCEESKRHRMLMEAFGIKEKLTAPVEELRDLVESAKSFDELHLPFT 707
           + S+    +L CDD C + ++H+ML++     E           ++    S+++L LP++
Sbjct: 628 KESATATQSLLCDDDCAKVQKHQMLLQTLRSSESTNKAEHGSSSVINKPTSYEDLGLPYS 687

Query: 708 ESTLSVYSKQRAWCNQIESFLSKLMRDVTRTSLHFKPMKLPQRRFIHELANAYALYSESQ 767
           E  + V+SKQ  WC  I+  L +L+ D +R SLHFKPMK PQR+F+HEL+ A+ LYSESQ
Sbjct: 688 EQMMCVFSKQATWCKNIQDSLIRLLEDKSRKSLHFKPMKAPQRQFVHELSKAFGLYSESQ 747

Query: 768 DREPKRSVFVKKVENKSHIPLLCLGEALPLYHSFKQLQKERKVKELEKSTTRRLFNYTVD 827
           DREPKRSVFVK ++  S IP + L EAL LY   K  QKER+  EL+ +TT+ L +  +D
Sbjct: 748 DREPKRSVFVKILKT-SKIPAIGLSEALLLYQRMKTFQKERRDLELQHNTTKILISIPID 806

Query: 828 DANDVPH-NAEFNCFLVKGVAPGVTKDELSDCLAEYLQFTLIQNPSYQTLENGDFLIYPE 886
           D +D     A  N  L+ GV   VT + +  C  E L+ TL+++P ++ L N +  IYP 
Sbjct: 807 DGSDSKTLEASCNAILITGVPRTVTVENIKACFDECLKQTLLKDPQFR-LINSNAYIYPS 865

Query: 887 DHMSISENVENDIKRLAPYISSICKEKQISEGVKLYKIDENLKTFT---SEEYLQEEQPE 943
           + + IS NVE DI+RL PY S +C+ KQI   V  +K+  +    +   +  ++  E P+
Sbjct: 866 NFLEISANVETDIQRLVPYFSHVCERKQIGYNVSAHKLTADFNKTSQALNNSFISTEDPD 925

>ADL213W Chr4 (329646..332372) [2727 bp, 908 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL023C (FAP1)
          Length = 908

 Score =  934 bits (2414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/893 (51%), Positives = 595/893 (66%), Gaps = 14/893 (1%)

Query: 48  LPYYEKTIHEIQKGDSYACMICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLD 107
           +PYYE+T+ E++ G++Y C+ICT+EMD +C MYAC +CYRVYD+ECIR WALK++  ++D
Sbjct: 16  IPYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYECIRRWALKATSTTVD 75

Query: 108 KTWKCPNCYYVNSEIPVKNRHTCWCGKVVHPESNPIDPNSCGQTCNAPICSHGCSKPCHL 167
           +TWKCPNCY+VN ++P KNRHTCWCGK V+ + N I+PNSCGQTC APIC HGCSK CHL
Sbjct: 76  RTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTCGAPICQHGCSKLCHL 135

Query: 168 GPHPECMRTTKVKCLCGKHTKDMFCYQSEEEKASYQCGEPCNLLLPCGVHKCQRKCHSGP 227
           GPH ECM     KC CGK T+++ CY+++  K ++ C +PC L +PCG+HKC+R CH+GP
Sbjct: 136 GPHEECMVRIDFKCRCGKLTEEIPCYEAKAAKRNFSCDQPCGLPMPCGIHKCERVCHNGP 195

Query: 228 CGNCEETISGKIMCYCGMETREQIICKDVKSVAKSKNKSGEIWIGVFSCAHLRSVEYSCG 287
           CG C+E I+G I CYCG+ TR +++C +V  VA+SK    + WIG F+C  +R V YSCG
Sbjct: 196 CGPCKEEIAGDIKCYCGLTTRNKMVCSEVSVVARSKVSKYKSWIGAFACDRMREVPYSCG 255

Query: 288 HHSFQESCTAPPTNSGELACPFSPRLLKTCPCGSTPLKLLEAPRKKCTDPIPTCENRCNK 347
            HSF E C APP+      CP+SP    TCPCG T L  L + R  CTD I +C   C K
Sbjct: 256 KHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGSTRTACTDHISSCGKVCGK 315

Query: 348 PLKCGKHSCPFVCHDGPCMDPCVSVDKVSCSCHSKSFLVPCQFHDEAHCNTKCESLMSCR 407
            L CG H+CP  CHDG CMDPC+ + +  C+C  + FLVPCQF     C  KCESLMSCR
Sbjct: 316 QLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQFPHSPSCTAKCESLMSCR 375

Query: 408 RHRCTERCCSGRSLAIKREKTIFLARDRL----DESLVEAQHICLKPCNLKLSCGIHYCR 463
           RHRC ERCCSGR  ++KR      +R R     DES VEAQH+CLK CN  L CGIH C 
Sbjct: 376 RHRCAERCCSGRPHSVKRN-----SRRRRESPDDESEVEAQHVCLKDCNRVLLCGIHMCN 430

Query: 464 RKCHPGKCSPCLESDSNDLSCPCGKTVVPAPVRCGTKLPPCRHPCIKTLQADTVCGHPPM 523
            KCH GKC PCLESDSNDL CPCGKT+VPAPVRCGTKLP C HPC  +L     CGH P 
Sbjct: 431 YKCHAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRNSLLDTWPCGHSPP 490

Query: 524 PHECHSLEQPCPQCTAPIYKKCKCNKVEKVRTLCFQNDVSCGKICGLPLKNCSHTCKRTC 583
            H CH L++PCP CT  + K C+C K E +RT C+ +DVSC + C  PL  C+H C+  C
Sbjct: 491 SHNCHPLDEPCPPCTITVKKTCRCGKNE-IRTFCYNDDVSCSRPCKKPLSYCNHFCQVPC 549

Query: 584 HEPGQCQTICKQICGLPRKFCEHKCFARCHPGKDCPDEACQVKVKVTCSCGRKESILPCD 643
           H  GQCQ  CKQ CGLPRK CEH C A+CH    CP+  C  K  +TCSCG K S   C 
Sbjct: 550 HSDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTITCSCGHKSSTKICS 609

Query: 644 AHADQPSS-KLLITLPCDDKCEESKRHRMLMEAFGIKEKLTAPVEELRDLVESAKSFDEL 702
            +A +         L CD+ C + +RH+ LM AFG+ EK T+  +E   L + ++SFD+L
Sbjct: 610 EYAGKDDGIGASQHLSCDEDCAKFQRHQQLMRAFGVVEKATSEEDEALLLAQRSQSFDDL 669

Query: 703 HLPFTESTLSVYSKQRAWCNQIESFLSKLMRDVTRTSLHFKPMKLPQRRFIHELANAYAL 762
           HLPFTE  LSV++KQ  WC QIE +L KLM D +  +LHFKPM+  QRRF+HEL++++ L
Sbjct: 670 HLPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAAQRRFVHELSSSFGL 729

Query: 763 YSESQDREPKRSVFVKKVENKSHIPLLCLGEALPLYHSFKQLQKERKVKELEKSTTRRLF 822
           YSESQD EPKRSV+VKK    S +P + L +A PLY SFK+L++E K    E + T++L 
Sbjct: 730 YSESQDPEPKRSVYVKKT-GISRVPAIGLSKAAPLYTSFKKLEREFKANS-ESAVTKKLV 787

Query: 823 NYTVDDANDVPHNAEFNCFLVKGVAPGVTKDELSDCLAEYLQFTLIQNPSYQTLENGDFL 882
           +  +DD+ +  H+A  N  L+ G+    ++  L DC A+Y   TL+  P Y  +   +  
Sbjct: 788 SVHIDDSPESQHDAAINAILLSGLTSFASESALRDCFADYFSQTLLNCPQY-VVRGTEGY 846

Query: 883 IYPEDHMSISENVENDIKRLAPYISSICKEKQISEGVKLYKIDENLKTFTSEE 935
           I+P D++S+S N E D+ +LA Y   + +E+ +   +   K+D NL    S E
Sbjct: 847 IFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLDSNLNRIGSCE 899

>TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {ON}
           Anc_2.288 YNL023C
          Length = 962

 Score =  914 bits (2363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/904 (50%), Positives = 598/904 (66%), Gaps = 22/904 (2%)

Query: 48  LPYYEKTIHEIQKGDSYACMICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLD 107
           L YYE+TI +I KGD Y CMICT+EMDYTC MYAC  CYRV+D+ECI+EWA KS+ K++D
Sbjct: 45  LVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSASKTID 104

Query: 108 KTWKCPNCYYVNSEIPVKNRHTCWCGKVVHPESNPIDPNSCGQTCNAPICSHGCSKPCHL 167
           K WKCPNC + + +IP++NR TCWCGKV++P+ N + PNSCGQTCN   C HGC   CHL
Sbjct: 105 KVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCKNFCHL 164

Query: 168 GPHPECMRTTKVKCLCGKHTKDMFCYQSEEEKAS--YQCGEPCNLLLPCGVHKCQRKCHS 225
           GPH EC   T +KC CG++ KD+FC+Q ++   +  YQC E C L L CGVHKC+R CHS
Sbjct: 165 GPHGECSVITTLKCKCGRNEKDIFCHQLKKSNKNNVYQCNEVCQLPLACGVHKCKRVCHS 224

Query: 226 GPCGNCEETISG------------KIMCYCGMETREQIICKDVKSVAK-SKNKSGEIWIG 272
           G CG C E +S             K  CYCG  ++ +I+CK +      SKN  G+ WIG
Sbjct: 225 GLCGACPEILSSEQIQSVESNENRKFKCYCGENSKNEIMCKKLAITGTFSKNSEGDKWIG 284

Query: 273 VFSCAHLRSVEYSCGHHSFQESCTAPPTNSGELACPFSPRLLKTCPCGSTPLKLLEAPRK 332
            F+C   R V Y+C  HSF E C A  + SG+  CP++P+LL +CPCG T LK L   RK
Sbjct: 285 TFACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKTSLKQLAQKRK 344

Query: 333 KCTDPIPTCENRCNKPLKCGKHSCPFVCHDGPCMDPCVSVDKVSCSCHSKSFLVPCQFHD 392
           KCTDPIPTCENRC K LKCGKH+CP++CH+G CMDPC+ ++  +CSC  K FLVPC F  
Sbjct: 345 KCTDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVTNCSCLQKHFLVPCNFEQ 404

Query: 393 EAHCNTKCESLMSCRRHRCTERCCSGRSLAIKREKTIFLARDRLDESLVEAQHICLKPCN 452
              C  KCESLMSCRRHRC ++CC+G+  A KR+K +    +  DESLVEA HICLK CN
Sbjct: 405 TPKCTFKCESLMSCRRHRCPKKCCTGKPEADKRKKMLLTREELNDESLVEAVHICLKECN 464

Query: 453 LKLSCGIHYCRRKCHPGKCSPCLESDSNDLSCPCGKTVVPAPVRCGTKLPPCRHPCIKTL 512
           LKLSCGIH C RKCHPG+C  CL SDSNDL CPCGKTV+ APVRCG+KLPPC   CIK +
Sbjct: 465 LKLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPVRCGSKLPPCPFECIKVI 524

Query: 513 QADTVCGHPPMPHECHSLEQPCPQCTAPIYKKCKCNKVEKVRTLCFQNDVSCGKICGLPL 572
           +    CGH P PH+CH   +PCP CTA + + CKC K   V+ +CFQ   SCG+IC   L
Sbjct: 525 ERSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVKAVCFQEFGSCGEICNKEL 584

Query: 573 KNCSHTCKRTCHEPGQCQTICKQICGLPRKFCEHKCFARCHPGKDCPDEACQVKVKVTCS 632
           +NC H C+  CHE GQCQ  CKQ+C   R  C H+C ++CH    CPD  C    KV+C 
Sbjct: 585 ENCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKCHGSSPCPDVPCNEVTKVSCK 644

Query: 633 CGRKESILPCDAHADQPSSKLLITLPCDDKCEESKRHRMLMEAFGIKEKLTAP---VEEL 689
           CGRK+    C A  D  S+ + + LPCD+ CE   RH  L +AFG    L      ++++
Sbjct: 645 CGRKQEYRKCYATLDNSSASIEL-LPCDEDCEAHARHLQLRDAFGYDSSLDTSNKNIQDI 703

Query: 690 RDLVESAKSFDELHLPFTESTLSVYSKQRAWCNQIESFLSKLMRDVTRTSLHFKPMKLPQ 749
           + L+E   +++EL LP+ +S +S YSKQ  WC+QIE  L K + D  + +LHFKPMK  Q
Sbjct: 704 QSLMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIEDILRKFVLDKAKNNLHFKPMKPAQ 763

Query: 750 RRFIHELANAYALYSESQDREPKRSVFVKKVENKSHIPLLCLGEALPLYHSFKQLQKERK 809
           R F+ EL+ ++ LYSESQD EPKRSVFVK+  + + IP + L E LPL+  FK+L+KERK
Sbjct: 764 RHFVRELSTSFNLYSESQDPEPKRSVFVKRKVD-TRIPNISLEEVLPLWTGFKKLEKERK 822

Query: 810 VKELEKSTTRRLFNYTVDDANDVPHNAEFNCFLVKGVAPGVTKDELSDCLAEYLQFTLIQ 869
           ++  E ++ R+  NY   +   V  + + N F +K ++PG+T+++LS+   + L+ TLI+
Sbjct: 823 IQHFESTSQRKYINYEPKEV-IVKSSNDTNGFFIKKISPGITEEDLSEVFGKALKSTLIK 881

Query: 870 NPSYQTL-ENGDFLIYPEDHMSISENVENDIKRLAPYISSICKEKQISEGVKLYKIDENL 928
           N  Y+ L E+ D +IYPE + SI+E+V  D++ L  +   I KE  I + + L  ++  +
Sbjct: 882 NVCYKILPESSDAIIYPEQYNSITESVHQDLEVLVGHFDFIGKEALIFDSIMLCNVEGYI 941

Query: 929 KTFT 932
              +
Sbjct: 942 NQIS 945

>SAKL0H05544g Chr8 (497300..499765) [2466 bp, 821 aa] {ON} similar
           to uniprot|P32563 Saccharomyces cerevisiae YOR270C VPH1
           Subunit of vacuolar-ATPase V0 domain one of two isoforms
           (Vph1p and Stv1p) Vph1p is located in V- ATPase
           complexes of the vacuole while Stv1p is located in
           V-ATPase complexes of the Golgi and endosomes
          Length = 821

 Score = 33.1 bits (74), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 33/72 (45%), Gaps = 8/72 (11%)

Query: 900 KRLAPYISSICKEKQISEGVKLYKIDENLKTFTSE--------EYLQEEQPEKQASFEIN 951
           K L  +   I KEK + E + L+  D N KT  +E        E LQE+  E   +  I+
Sbjct: 301 KELDSWARDISKEKAVYETLNLFDRDANRKTLIAEGWIPKDDLESLQEQLGELTTTLGID 360

Query: 952 TDGEVAVINTDK 963
               V V+ T+K
Sbjct: 361 VPSIVNVLETNK 372

>KNAG0G02800 Chr7 complement(619337..621826) [2490 bp, 829 aa] {ON}
           Anc_8.718 YOR270C
          Length = 829

 Score = 33.1 bits (74), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 32/72 (44%), Gaps = 8/72 (11%)

Query: 900 KRLAPYISSICKEKQISEGVKLYKIDENLKTFTSEEY--------LQEEQPEKQASFEIN 951
           + L  +  ++CKEK I E + ++  D N KT  +E +        LQ    E      I+
Sbjct: 305 RELNLWFQTVCKEKAIFESLNMFNFDVNRKTLIAEGWVPQDEIISLQNSLNEMTTLLGID 364

Query: 952 TDGEVAVINTDK 963
               + V+ T+K
Sbjct: 365 VPSIIQVLETNK 376

>Ecym_2355 Chr2 (694551..697061) [2511 bp, 836 aa] {ON} similar to
           Ashbya gossypii ADR177C
          Length = 836

 Score = 33.1 bits (74), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 26/44 (59%)

Query: 900 KRLAPYISSICKEKQISEGVKLYKIDENLKTFTSEEYLQEEQPE 943
           K L  +   ICKEK + + + L+  D N KT T+E ++ +++ E
Sbjct: 315 KELEGWNKQICKEKMVYQTLNLFAYDSNRKTLTAEGWIPKDELE 358

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.135    0.446 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 104,919,936
Number of extensions: 4576252
Number of successful extensions: 13463
Number of sequences better than 10.0: 58
Number of HSP's gapped: 12628
Number of HSP's successfully gapped: 70
Length of query: 974
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 855
Effective length of database: 39,836,145
Effective search space: 34059903975
Effective search space used: 34059903975
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)