Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E07612g2.289ON25225212361e-174
NDAI0G006802.289ON2552607761e-104
Skud_14.3052.289ON2492437296e-97
YNL024C2.289ON2462437289e-97
CAGL0M06897g2.289ON2482547262e-96
KLTH0G10428g2.289ON2512507236e-96
NCAS0G03850singletonON2512467192e-95
NCAS0G037702.289ON2512467192e-95
Suva_14.3232.289ON2532437184e-95
Smik_14.3072.289ON2462437105e-94
Kwal_27.115132.289ON2512507044e-93
KNAG0H019802.289ON2492437002e-92
Ecym_33282.289ON2542526769e-89
KAFR0H032902.289ON2452466513e-85
ADL212W2.289ON2512456463e-84
KLLA0E08295g2.289ON2662516395e-83
NDAI0J028604.352ON347209920.003
KNAG0C018001.325ON42165920.004
Suva_12.2204.352ON337140900.006
Suva_4.5321.325ON416143890.009
NCAS0J021504.352ON32292840.034
Skud_2.4031.325ON41763840.037
KAFR0E042804.352ON315199830.038
Skud_10.3524.352ON336142830.040
YBR271W (EFM2)1.325ON41965810.074
KAFR0C042501.325ON391145800.12
Smik_2.4141.325ON41766780.21
Kwal_47.166354.352ON32282770.23
Kpol_1066.171.325ON43568770.27
Smik_10.4224.352ON340110760.36
KLTH0E08756g4.147ON45560730.86
AER240W1.325ON39061720.97
TPHA0L003404.352ON341108711.4
KLTH0D17996g4.352ON31741702.0
KLLA0E21539g1.325ON40063692.6
Ecym_55131.325ON39660675.0
CAGL0I09438g1.325ON40663665.4
SAKL0D06798g1.325ON42188666.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E07612g
         (252 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E07612g Chr5 complement(614835..615593) [759 bp, 252 aa] {O...   480   e-174
NDAI0G00680 Chr7 (150212..150979) [768 bp, 255 aa] {ON} Anc_2.28...   303   e-104
Skud_14.305 Chr14 complement(557846..558595) [750 bp, 249 aa] {O...   285   6e-97
YNL024C Chr14 complement(587107..587847) [741 bp, 246 aa] {ON} P...   285   9e-97
CAGL0M06897g Chr13 complement(702211..702957) [747 bp, 248 aa] {...   284   2e-96
KLTH0G10428g Chr7 (883191..883946) [756 bp, 251 aa] {ON} similar...   283   6e-96
NCAS0G03850 Chr7 (713255..714010) [756 bp, 251 aa] {ON}               281   2e-95
NCAS0G03770 Chr7 complement(694471..695226) [756 bp, 251 aa] {ON...   281   2e-95
Suva_14.323 Chr14 complement(569944..570705) [762 bp, 253 aa] {O...   281   4e-95
Smik_14.307 Chr14 complement(549501..550241) [741 bp, 246 aa] {O...   278   5e-94
Kwal_27.11513 s27 complement(832028..832783) [756 bp, 251 aa] {O...   275   4e-93
KNAG0H01980 Chr8 complement(348806..349555) [750 bp, 249 aa] {ON...   274   2e-92
Ecym_3328 Chr3 (629428..630192) [765 bp, 254 aa] {ON} similar to...   265   9e-89
KAFR0H03290 Chr8 complement(626525..627262) [738 bp, 245 aa] {ON...   255   3e-85
ADL212W Chr4 (332487..333242) [756 bp, 251 aa] {ON} Syntenic hom...   253   3e-84
KLLA0E08295g Chr5 complement(746166..746966) [801 bp, 266 aa] {O...   250   5e-83
NDAI0J02860 Chr10 complement(713765..714808) [1044 bp, 347 aa] {...    40   0.003
KNAG0C01800 Chr3 (352309..353574) [1266 bp, 421 aa] {ON} Anc_1.3...    40   0.004
Suva_12.220 Chr12 complement(343489..344502) [1014 bp, 337 aa] {...    39   0.006
Suva_4.532 Chr4 (916493..917743) [1251 bp, 416 aa] {ON} YBR271W ...    39   0.009
NCAS0J02150 Chr10 complement(415802..416770) [969 bp, 322 aa] {O...    37   0.034
Skud_2.403 Chr2 (713779..715032) [1254 bp, 417 aa] {ON} YBR271W ...    37   0.037
KAFR0E04280 Chr5 complement(864926..865873) [948 bp, 315 aa] {ON...    37   0.038
Skud_10.352 Chr10 complement(622581..623591) [1011 bp, 336 aa] {...    37   0.040
YBR271W Chr2 (744852..746111) [1260 bp, 419 aa] {ON}  EFM2S-aden...    36   0.074
KAFR0C04250 Chr3 (844020..845195) [1176 bp, 391 aa] {ON} Anc_1.3...    35   0.12 
Smik_2.414 Chr2 (730531..731784) [1254 bp, 417 aa] {ON} YBR271W ...    35   0.21 
Kwal_47.16635 s47 complement(37749..38717) [969 bp, 322 aa] {ON}...    34   0.23 
Kpol_1066.17 s1066 complement(28462..29769) [1308 bp, 435 aa] {O...    34   0.27 
Smik_10.422 Chr10 complement(653045..654067) [1023 bp, 340 aa] {...    34   0.36 
KLTH0E08756g Chr5 (793960..795327) [1368 bp, 455 aa] {ON} highly...    33   0.86 
AER240W Chr5 (1080474..1081646) [1173 bp, 390 aa] {ON} Non-synte...    32   0.97 
TPHA0L00340 Chr12 (45910..46935) [1026 bp, 341 aa] {ON} Anc_4.35...    32   1.4  
KLTH0D17996g Chr4 (1490856..1491809) [954 bp, 317 aa] {ON} simil...    32   2.0  
KLLA0E21539g Chr5 complement(1923103..1924305) [1203 bp, 400 aa]...    31   2.6  
Ecym_5513 Chr5 (1042019..1043209) [1191 bp, 396 aa] {ON} similar...    30   5.0  
CAGL0I09438g Chr9 (904886..906106) [1221 bp, 406 aa] {ON} simila...    30   5.4  
SAKL0D06798g Chr4 complement(564525..565790) [1266 bp, 421 aa] {...    30   6.8  

>SAKL0E07612g Chr5 complement(614835..615593) [759 bp, 252 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 252

 Score =  480 bits (1236), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 237/252 (94%), Positives = 237/252 (94%)

Query: 1   MEDVLQFTACFNDLVPSRPTEHLGDSDLSFGGKLSPPLKIHEDGGESGCGGKVWIAGELL 60
           MEDVLQFTACFNDLVPSRPTEHLGDSDLSFGGKLSPPLKIHEDGGESGCGGKVWIAGELL
Sbjct: 1   MEDVLQFTACFNDLVPSRPTEHLGDSDLSFGGKLSPPLKIHEDGGESGCGGKVWIAGELL 60

Query: 61  CEFLLEKSDQQGLFSQWNSDTRFQSPIKKIVEXXXXXXXXXXXXXXXNKQNKLKDVDIYV 120
           CEFLLEKSDQQGLFSQWNSDTRFQSPIKKIVE               NKQNKLKDVDIYV
Sbjct: 61  CEFLLEKSDQQGLFSQWNSDTRFQSPIKKIVELGSGTGLVGLCLGLLNKQNKLKDVDIYV 120

Query: 121 TDIDQLVTLMDRNIKLNELEHVFPKELWWGEPLKPEFAPTRSNQRQVDLILAADCVYLEK 180
           TDIDQLVTLMDRNIKLNELEHVFPKELWWGEPLKPEFAPTRSNQRQVDLILAADCVYLEK
Sbjct: 121 TDIDQLVTLMDRNIKLNELEHVFPKELWWGEPLKPEFAPTRSNQRQVDLILAADCVYLEK 180

Query: 181 AFPLLEVTLLDLTSCKDPPIILMSYKKRRKADKHFFKQIKKNFDVLEINEFTRFDHYLKQ 240
           AFPLLEVTLLDLTSCKDPPIILMSYKKRRKADKHFFKQIKKNFDVLEINEFTRFDHYLKQ
Sbjct: 181 AFPLLEVTLLDLTSCKDPPIILMSYKKRRKADKHFFKQIKKNFDVLEINEFTRFDHYLKQ 240

Query: 241 KTHLFQLVRKFK 252
           KTHLFQLVRKFK
Sbjct: 241 KTHLFQLVRKFK 252

>NDAI0G00680 Chr7 (150212..150979) [768 bp, 255 aa] {ON} Anc_2.289
           YNL024C
          Length = 255

 Score =  303 bits (776), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 152/260 (58%), Positives = 195/260 (75%), Gaps = 15/260 (5%)

Query: 1   MEDVLQFTACFNDLVPSRPTEHLGDSDLSFGGKLSPPLKIHEDGGESGCGGKVWIAGELL 60
           M+D+  F + F+DLV +RP EHLG+SDLSFGG+L  PLKIHEDGGESGCGGKVWIAGELL
Sbjct: 1   MDDI--FGSGFDDLVVARPLEHLGNSDLSFGGRLKNPLKIHEDGGESGCGGKVWIAGELL 58

Query: 61  CEFLLEKSDQQGLFSQWNSDTRFQSPIKKIVEXXXXXXXXXXXXXXXNKQNKLKDVDIYV 120
           CEF+LEKS+   L + W S+++     +KIVE                K N  KD+D Y+
Sbjct: 59  CEFILEKSNSDDLLNGWASNSK---QFRKIVELGSGTGLVGLCIGLLEKNNFHKDIDAYI 115

Query: 121 TDIDQLVTLMDRNIKLNELEH-VFPKELWWGEPLKPEFAPTRSN---------QRQVDLI 170
           TDIDQ+V LM +NI+LN +E+ V  +ELWWGEPL+  FAP+  +         +++VDLI
Sbjct: 116 TDIDQIVPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEHSRDKEEDFREEKKVDLI 175

Query: 171 LAADCVYLEKAFPLLEVTLLDLTSCKDPPIILMSYKKRRKADKHFFKQIKKNFDVLEINE 230
           LAADCVYLEKAFPLLE TLLDLT  + PP ILM+Y+KRRKADKHFF++IKKNFD++EI +
Sbjct: 176 LAADCVYLEKAFPLLEKTLLDLTEGETPPTILMAYRKRRKADKHFFQKIKKNFDIVEIKD 235

Query: 231 FTRFDHYLKQKTHLFQLVRK 250
           F ++++YLKQ+THLFQL+R+
Sbjct: 236 FEKYEYYLKQRTHLFQLIRQ 255

>Skud_14.305 Chr14 complement(557846..558595) [750 bp, 249 aa] {ON}
           YNL024C (REAL)
          Length = 249

 Score =  285 bits (729), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 145/243 (59%), Positives = 177/243 (72%), Gaps = 7/243 (2%)

Query: 11  FNDLVPSRPTEHLGDSDLSFGGKLSPPLKIHEDGGESGCGGKVWIAGELLCEFLLEKSDQ 70
           F DLV  R TEHLG +DLSFGGKL P LKI EDGGESGCGGKVWIAGELLCE++LEKS  
Sbjct: 8   FEDLVVPRATEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKS-- 65

Query: 71  QGLFSQWNSDTRFQSPIKKIVEXXXXXXXXXXXXXXXNKQNKLKDVDIYVTDIDQLVTLM 130
             L    +  T  +   KK++E                K        +YVTDID+LV L+
Sbjct: 66  --LHHLLSEATHGRRQFKKVLELGSGTGLVGLCVGLLEKNTFHDGSKVYVTDIDKLVPLL 123

Query: 131 DRNIKLNELEH-VFPKELWWGEPLKPEFAPTRSN--QRQVDLILAADCVYLEKAFPLLEV 187
           +RNI+L+++++ V  +ELWWGEPL  +F+P   +     VDL+LAADCVYLEKAFPLLE 
Sbjct: 124 ERNIELDKVQYEVLARELWWGEPLSVDFSPQEGDLQTNNVDLVLAADCVYLEKAFPLLER 183

Query: 188 TLLDLTSCKDPPIILMSYKKRRKADKHFFKQIKKNFDVLEINEFTRFDHYLKQKTHLFQL 247
           TLLDLT+C  PP+ILM+YKKRRKADKHFF +IK+NFDVLEI +F++FDHYLKQ+THLFQL
Sbjct: 184 TLLDLTNCISPPVILMAYKKRRKADKHFFSKIKRNFDVLEITDFSKFDHYLKQRTHLFQL 243

Query: 248 VRK 250
           +RK
Sbjct: 244 IRK 246

>YNL024C Chr14 complement(587107..587847) [741 bp, 246 aa] {ON}
           Putative methyltransferase; has seven beta-strand
           methyltransferase motif; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; despite
           similarity to methyltransferases, null mutant does not
           display alterations in lysine methylation pattern
          Length = 246

 Score =  285 bits (728), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 143/243 (58%), Positives = 176/243 (72%), Gaps = 7/243 (2%)

Query: 11  FNDLVPSRPTEHLGDSDLSFGGKLSPPLKIHEDGGESGCGGKVWIAGELLCEFLLEKSDQ 70
           F DLV  RP EHLG +DLSFGGKL P LKI EDGGESGCGGKVWIAGELLCE++LEKS  
Sbjct: 8   FGDLVVPRPKEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKSVD 67

Query: 71  QGLFSQWNSDTRFQSPIKKIVEXXXXXXXXXXXXXXXNKQNKLKDVDIYVTDIDQLVTLM 130
             L    N   +F    KK++E                K        +YVTDID+L+ L+
Sbjct: 68  HLLSKTVNGTKQF----KKVLELGSGTGLVGLCVGLLEKNTFHDGTKVYVTDIDKLIPLL 123

Query: 131 DRNIKLNELEH-VFPKELWWGEPLKPEFAPTRSNQR--QVDLILAADCVYLEKAFPLLEV 187
            RNI+L+E+++ V  +ELWWGEPL  +F+P     +   VDL+LAADCVYLE+AFPLLE 
Sbjct: 124 KRNIELDEVQYEVLARELWWGEPLSADFSPQEGAMQANNVDLVLAADCVYLEEAFPLLEK 183

Query: 188 TLLDLTSCKDPPIILMSYKKRRKADKHFFKQIKKNFDVLEINEFTRFDHYLKQKTHLFQL 247
           TLLDLT C +PP+ILM+YKKRRKADKHFF +IK+NFDVLEI +F++F+HYLK++THLFQL
Sbjct: 184 TLLDLTHCINPPVILMAYKKRRKADKHFFNKIKRNFDVLEITDFSKFEHYLKERTHLFQL 243

Query: 248 VRK 250
           +RK
Sbjct: 244 IRK 246

>CAGL0M06897g Chr13 complement(702211..702957) [747 bp, 248 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024c
          Length = 248

 Score =  284 bits (726), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 144/254 (56%), Positives = 178/254 (70%), Gaps = 10/254 (3%)

Query: 1   MEDVLQFTACFNDLVPSRPTEHLGDSDLSFGGKLSPPLKIHEDGGESGCGGKVWIAGELL 60
           MED+L F     DL+ SRP EH+G SDL+F G L P LKI+EDGGESGCGGKVWIAGELL
Sbjct: 1   MEDILGF----GDLIESRPVEHMGQSDLTFNGMLVPGLKIYEDGGESGCGGKVWIAGELL 56

Query: 61  CEFLLEKSDQQGLFSQWNSDTRFQSPIKKIVEXXXXXXXXXXXXXXXNKQNKLKDVDIYV 120
           CEF+LEKS    L   W +D         ++E                K+   + V  Y+
Sbjct: 57  CEFILEKSRDGELLKDWINDDSVS--FGNVLELGSGTGLVGLCVGLVTKKQSQRMVKTYI 114

Query: 121 TDIDQLVTLMDRNIKLNEL-EHVFPKELWWGEPLKPEFAPTRSNQ---RQVDLILAADCV 176
           TDIDQLV LM++N++LN + + VF KEL WGE L  EFAP ++       +DL+LAADCV
Sbjct: 115 TDIDQLVPLMEKNVELNLIDQQVFAKELLWGEALPIEFAPVKTGHATTSSLDLVLAADCV 174

Query: 177 YLEKAFPLLEVTLLDLTSCKDPPIILMSYKKRRKADKHFFKQIKKNFDVLEINEFTRFDH 236
           YLEKAFPLLE TLLDLT C +PP+ILM+Y+KRRKADKHFF++I+KNF+V+ IN+F  +D 
Sbjct: 175 YLEKAFPLLEKTLLDLTECDNPPVILMAYRKRRKADKHFFQKIRKNFNVIVINDFKNYDQ 234

Query: 237 YLKQKTHLFQLVRK 250
           YLKQ+THLFQLVRK
Sbjct: 235 YLKQRTHLFQLVRK 248

>KLTH0G10428g Chr7 (883191..883946) [756 bp, 251 aa] {ON} similar to
           uniprot|P53970 Saccharomyces cerevisiae YNL024C Putative
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family
          Length = 251

 Score =  283 bits (723), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 142/250 (56%), Positives = 174/250 (69%), Gaps = 3/250 (1%)

Query: 1   MEDVLQFTACFNDLVPSRPTEHLGDSDLSFGGKLSPPLKIHEDGGESGCGGKVWIAGELL 60
           M ++L FTA F DLVPSRP EH GDSDL+FGG++ P LKIHEDGGESGCGGK+WIAGELL
Sbjct: 1   MAELLDFTAQFTDLVPSRPLEHFGDSDLTFGGRIFPALKIHEDGGESGCGGKLWIAGELL 60

Query: 61  CEFLLEKSDQQGLFSQWNSDTRFQSPIKKIVEXXXXXXXXXXXXXXXNKQNKLKDVDIYV 120
           CE+LLE SD  G+ S+  +      P   I+E                + N   +  +++
Sbjct: 61  CEYLLENSDDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLARANG-GNAKVHI 119

Query: 121 TDIDQLVTLMDRNIKLNELEHVFPKE-LWWGEPLKPEFAPTRSNQRQVDLILAADCVYLE 179
           TDIDQLV LM+ N++LN L  V   E LWWGEPLK EF P   + +  DL+LAADCVYLE
Sbjct: 120 TDIDQLVRLMEGNVELNGLASVVSAEKLWWGEPLKYEFGPDAISNK-TDLVLAADCVYLE 178

Query: 180 KAFPLLEVTLLDLTSCKDPPIILMSYKKRRKADKHFFKQIKKNFDVLEINEFTRFDHYLK 239
            AFPLLE TLLDLT  + PP++LMSY+KRRKAD+ FFK I+KNF V+ I  F R D +LK
Sbjct: 179 TAFPLLEKTLLDLTKGETPPVVLMSYRKRRKADRIFFKAIRKNFKVVPITSFDRCDDFLK 238

Query: 240 QKTHLFQLVR 249
           Q+THLFQL+R
Sbjct: 239 QRTHLFQLIR 248

>NCAS0G03850 Chr7 (713255..714010) [756 bp, 251 aa] {ON}
          Length = 251

 Score =  281 bits (719), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 142/246 (57%), Positives = 175/246 (71%), Gaps = 7/246 (2%)

Query: 11  FNDLVPSRPTEHLGDSDLSFGGKLSPPLKIHEDGGESGCGGKVWIAGELLCEFLLEKSDQ 70
           F  LV  RP EHLG+SDLSFGGKL  PLKIHEDGGESGCGGKVWIAGELLC+F+LEKS  
Sbjct: 8   FEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDFILEKSGT 67

Query: 71  QGLFSQWNSDTRFQSPIKKIVEXXXXXXXXXXXXXXXNKQNKLKDVDIYVTDIDQLVTLM 130
           + L ++W  D   +   + ++E                K    K++ +++TDIDQLV LM
Sbjct: 68  EDLLNKWPHDG--ERRFRNVLELGSGTGLVGLCVGLLEKNRFHKNIGVHITDIDQLVPLM 125

Query: 131 DRNIKLNEL-EHVFPKELWWGEPLKPEFAPTRSNQ----RQVDLILAADCVYLEKAFPLL 185
            RNI+LN + + V  + LWWGEPL   FAP+  +       VDLILAADCVYLE AFPLL
Sbjct: 126 QRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLEDAFPLL 185

Query: 186 EVTLLDLTSCKDPPIILMSYKKRRKADKHFFKQIKKNFDVLEINEFTRFDHYLKQKTHLF 245
           E TLLDLT  + PP+ILMSY+KRRKADKHFF +IKKNFDV+E+ +FT+++ YLK +THLF
Sbjct: 186 ERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKMRTHLF 245

Query: 246 QLVRKF 251
           QL R+F
Sbjct: 246 QLARRF 251

>NCAS0G03770 Chr7 complement(694471..695226) [756 bp, 251 aa] {ON}
           Anc_2.289 YNL024C
          Length = 251

 Score =  281 bits (719), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 142/246 (57%), Positives = 175/246 (71%), Gaps = 7/246 (2%)

Query: 11  FNDLVPSRPTEHLGDSDLSFGGKLSPPLKIHEDGGESGCGGKVWIAGELLCEFLLEKSDQ 70
           F  LV  RP EHLG+SDLSFGGKL  PLKIHEDGGESGCGGKVWIAGELLC+F+LEKS  
Sbjct: 8   FEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDFILEKSGT 67

Query: 71  QGLFSQWNSDTRFQSPIKKIVEXXXXXXXXXXXXXXXNKQNKLKDVDIYVTDIDQLVTLM 130
           + L ++W  D   +   + ++E                K    K++ +++TDIDQLV LM
Sbjct: 68  EDLLNKWPHDG--ERRFRNVLELGSGTGLVGLCVGLLEKNRFHKNIGVHITDIDQLVPLM 125

Query: 131 DRNIKLNEL-EHVFPKELWWGEPLKPEFAPTRSNQ----RQVDLILAADCVYLEKAFPLL 185
            RNI+LN + + V  + LWWGEPL   FAP+  +       VDLILAADCVYLE AFPLL
Sbjct: 126 QRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLEDAFPLL 185

Query: 186 EVTLLDLTSCKDPPIILMSYKKRRKADKHFFKQIKKNFDVLEINEFTRFDHYLKQKTHLF 245
           E TLLDLT  + PP+ILMSY+KRRKADKHFF +IKKNFDV+E+ +FT+++ YLK +THLF
Sbjct: 186 ERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKMRTHLF 245

Query: 246 QLVRKF 251
           QL R+F
Sbjct: 246 QLARRF 251

>Suva_14.323 Chr14 complement(569944..570705) [762 bp, 253 aa] {ON}
           YNL024C (REAL)
          Length = 253

 Score =  281 bits (718), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 146/243 (60%), Positives = 177/243 (72%), Gaps = 7/243 (2%)

Query: 11  FNDLVPSRPTEHLGDSDLSFGGKLSPPLKIHEDGGESGCGGKVWIAGELLCEFLLEKSDQ 70
           F DLV  R  EH G +DLSFGGKL P LKI EDGGESGCGGKVWIAGELLCE++LEKSD 
Sbjct: 8   FEDLVVPRLKEHFGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKSDD 67

Query: 71  QGLFSQWNSDTRFQSPIKKIVEXXXXXXXXXXXXXXXNKQNKLKDVDIYVTDIDQLVTLM 130
             L S+   + R   P  K++E                K     +  +YVTDID+LV LM
Sbjct: 68  H-LLSETVHEKR---PFMKVLELGSGTGLVGLCVGLLEKNKFHDNTKVYVTDIDRLVPLM 123

Query: 131 DRNIKLNELEH-VFPKELWWGEPLKPEFAPTRSNQR--QVDLILAADCVYLEKAFPLLEV 187
           +RNI+L+++++ V  +ELWWGEPL  +F+P   + +   VDL+LAADCVYLEKAFPLLE 
Sbjct: 124 ERNIELDKVQYEVLARELWWGEPLSGDFSPQEGDLQVNNVDLVLAADCVYLEKAFPLLEK 183

Query: 188 TLLDLTSCKDPPIILMSYKKRRKADKHFFKQIKKNFDVLEINEFTRFDHYLKQKTHLFQL 247
           TLLDLT+C  PP+ILM+YKKRRKADK FF +IK+NFDVLEI +F +FD+YLKQKTHLFQL
Sbjct: 184 TLLDLTNCISPPVILMAYKKRRKADKQFFNKIKRNFDVLEIKDFIKFDYYLKQKTHLFQL 243

Query: 248 VRK 250
           VRK
Sbjct: 244 VRK 246

>Smik_14.307 Chr14 complement(549501..550241) [741 bp, 246 aa] {ON}
           YNL024C (REAL)
          Length = 246

 Score =  278 bits (710), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 143/243 (58%), Positives = 173/243 (71%), Gaps = 7/243 (2%)

Query: 11  FNDLVPSRPTEHLGDSDLSFGGKLSPPLKIHEDGGESGCGGKVWIAGELLCEFLLEKSDQ 70
           F DLV  RP EHLG +DLSF GKL P LKI EDGGESGCGGKVWIAGELLCE++LEKS  
Sbjct: 8   FGDLVVPRPKEHLGQTDLSFSGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKSVD 67

Query: 71  QGLFSQWNSDTRFQSPIKKIVEXXXXXXXXXXXXXXXNKQNKLKDVDIYVTDIDQLVTLM 130
             L    +   RF    KK++E                K        +YVTDID+LV L+
Sbjct: 68  HLLSKTVDGKKRF----KKVLELGSGTGLVGLCVGLLEKNVYHDGTKVYVTDIDKLVPLL 123

Query: 131 DRNIKLNELEH-VFPKELWWGEPLKPEFAPTRSN--QRQVDLILAADCVYLEKAFPLLEV 187
            RNI+L+++++ V  +EL WGEPL  +F+P   +     VDL+LAADCVYLEKAFPLLE 
Sbjct: 124 KRNIELDKVQYEVLARELCWGEPLSADFSPQEGDLQTNNVDLVLAADCVYLEKAFPLLEK 183

Query: 188 TLLDLTSCKDPPIILMSYKKRRKADKHFFKQIKKNFDVLEINEFTRFDHYLKQKTHLFQL 247
           TLLDLT C  PP+ILM+YKKRRKADKHFF +IK+NFDVLEI+ F++FD+YLKQ+THLFQL
Sbjct: 184 TLLDLTDCVSPPVILMAYKKRRKADKHFFNKIKRNFDVLEISNFSKFDYYLKQRTHLFQL 243

Query: 248 VRK 250
           +RK
Sbjct: 244 IRK 246

>Kwal_27.11513 s27 complement(832028..832783) [756 bp, 251 aa] {ON}
           YNL024C - Hypothetical ORF [contig 27] FULL
          Length = 251

 Score =  275 bits (704), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 137/250 (54%), Positives = 176/250 (70%), Gaps = 3/250 (1%)

Query: 1   MEDVLQFTACFNDLVPSRPTEHLGDSDLSFGGKLSPPLKIHEDGGESGCGGKVWIAGELL 60
           M ++L FT  F DLVPSRP EHLGDSDLSFGG++ P LKIHEDGGE+GCGGK+W+AGELL
Sbjct: 1   MTELLDFTTQFIDLVPSRPVEHLGDSDLSFGGQVEPALKIHEDGGENGCGGKLWVAGELL 60

Query: 61  CEFLLEKSDQQGLFSQWNSDTRFQSPIKKIVEXXXXXXXXXXXXXXXNKQNKLKDVDIYV 120
           C++LLE SD +G+ S+   +   ++P   I+E                + +  +   +Y+
Sbjct: 61  CDYLLENSDAKGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQLHGDR-TKVYI 119

Query: 121 TDIDQLVTLMDRNIKLNELEHVFPKE-LWWGEPLKPEFAPTRSNQRQVDLILAADCVYLE 179
           TDID+LV LM+ N+ LN L      E L WGEPLK +F P  +   +VDL+LAADCVYLE
Sbjct: 120 TDIDRLVGLMETNVNLNHLAETVSVEILSWGEPLKEKFGPD-AKADKVDLVLAADCVYLE 178

Query: 180 KAFPLLEVTLLDLTSCKDPPIILMSYKKRRKADKHFFKQIKKNFDVLEINEFTRFDHYLK 239
            AFPLLE TLLDLT    PP +LMSY+KRRKADK+FF+ I+KNF ++ I  F R+D+YLK
Sbjct: 179 TAFPLLEKTLLDLTEGDTPPAVLMSYRKRRKADKNFFRLIRKNFKIVPITNFIRYDYYLK 238

Query: 240 QKTHLFQLVR 249
           ++THLFQLVR
Sbjct: 239 KQTHLFQLVR 248

>KNAG0H01980 Chr8 complement(348806..349555) [750 bp, 249 aa] {ON}
           Anc_2.289 YNL024C
          Length = 249

 Score =  274 bits (700), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 135/243 (55%), Positives = 170/243 (69%), Gaps = 6/243 (2%)

Query: 11  FNDLVPSRPTEHLGDSDLSFGGKLSPPLKIHEDGGESGCGGKVWIAGELLCEFLLEKSDQ 70
           F DLV +RP EH G  D+SFGG+L+P L+IHEDGGESGCGGKVW+AGELLC++++EKSD+
Sbjct: 8   FGDLVVARPIEHCGSHDMSFGGRLNPALQIHEDGGESGCGGKVWVAGELLCDYIVEKSDE 67

Query: 71  QGLFSQWNSDTRFQSPIKKIVEXXXXXXXXXXXXXXXNKQNKLKDVDIYVTDIDQLVTLM 130
             L + W  DT      + I+E                KQ   K + + +TDIDQLV LM
Sbjct: 68  DDLLANW--DTSKVQKFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDIDQLVPLM 125

Query: 131 DRNIKLNELE-HVFPKELWWGEPLKPEFAPTR---SNQRQVDLILAADCVYLEKAFPLLE 186
            +NI+LN +   +  +ELWWGEPL   FAP     S    VDLILAADCVYLEKAFPLLE
Sbjct: 126 QKNIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVTSVDLILAADCVYLEKAFPLLE 185

Query: 187 VTLLDLTSCKDPPIILMSYKKRRKADKHFFKQIKKNFDVLEINEFTRFDHYLKQKTHLFQ 246
            TLLDLT+C  PP+ILM+Y+KRR ADK FF++I K+F V EI +F+ +D YLKQ+THLF+
Sbjct: 186 KTLLDLTNCSKPPVILMAYRKRRNADKRFFRKIGKHFTVREITDFSTYDQYLKQRTHLFE 245

Query: 247 LVR 249
           L+R
Sbjct: 246 LIR 248

>Ecym_3328 Chr3 (629428..630192) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ADL212W
          Length = 254

 Score =  265 bits (676), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 137/252 (54%), Positives = 180/252 (71%), Gaps = 10/252 (3%)

Query: 1   MEDVLQFTACFNDLVPSRPTEHLGDSDLSFGGKLSPPLKIHEDGGESGCGGKVWIAGELL 60
           M DV  F + F +LVP+ P EHLG SDLSF G+L PPLKI+EDGGESGCGGKVWIAGELL
Sbjct: 1   MTDV--FASVFEELVPTPPIEHLGASDLSFQGRLDPPLKIYEDGGESGCGGKVWIAGELL 58

Query: 61  CEFLLEKSDQQGLFSQWNSDTRFQSPIKKIVEXXXXXXXXXXXXXXXNKQNKLKDVDIYV 120
           C+FLLEKS    L S++  + +      K++E               N  +++ D+D+Y+
Sbjct: 59  CDFLLEKSKDGQLLSKFVKNGK---QFNKVLELGSGTGLVGLCIGMHNIMHEVNDMDVYI 115

Query: 121 TDIDQLVTLMDRNIKLNELE-HVFPKELWWGEPLKPEFAPTRSNQRQVDLILAADCVYLE 179
           TDID L  LM RN+++N LE  V P+EL+WG+ L  EF   R+    VDLILAADCVYLE
Sbjct: 116 TDIDTLCPLMARNVRMNNLEGRVHPRELFWGDELPAEF---RNKDSPVDLILAADCVYLE 172

Query: 180 KAFPLLEVTLLDLTSCKD-PPIILMSYKKRRKADKHFFKQIKKNFDVLEINEFTRFDHYL 238
           KAFPLLE+ LL+LT+ ++  P++LMSY+KRRKADK FF +IKK+F + E+ +F R+D Y+
Sbjct: 173 KAFPLLEMKLLELTANQEVQPVVLMSYRKRRKADKKFFLKIKKHFVITELTDFKRYDEYI 232

Query: 239 KQKTHLFQLVRK 250
           KQ+TH+FQLVR+
Sbjct: 233 KQRTHIFQLVRR 244

>KAFR0H03290 Chr8 complement(626525..627262) [738 bp, 245 aa] {ON}
           Anc_2.289 YNL024C
          Length = 245

 Score =  255 bits (651), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 130/246 (52%), Positives = 166/246 (67%), Gaps = 14/246 (5%)

Query: 11  FNDLVPSRPTEHLGDSDLSFGGKLSPPLKIHEDGGESGCGGKVWIAGELLCEFLLEKSDQ 70
           +  L+ +RP EHLG +DLSF G+LSP +KI+EDGG SGCGGKVWIAGELLCE+L+EKSD 
Sbjct: 8   YVGLIDTRPIEHLGSADLSFDGQLSPAMKIYEDGGASGCGGKVWIAGELLCEYLIEKSDS 67

Query: 71  QGLFSQWNSDTRFQSPIKKIVEXXXXXXXXXXXXXXXNKQNKLKDVDIYVTDIDQLVTLM 130
           + L             IK I+E                KQ   KD+ + +TDI  LV LM
Sbjct: 68  ENLLCD--------GSIKNILELGSGTGLVGICVGLMEKQRFHKDIKVSITDIGGLVPLM 119

Query: 131 DRNIKLNEL-EHVFPKELWWGEPLKPEFAPTR-----SNQRQVDLILAADCVYLEKAFPL 184
           +RNI LN++ +    KEL WG+ L  E+  T       N   VDL++AADCVY EKAFPL
Sbjct: 120 ERNILLNKIADATVAKELMWGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAEKAFPL 179

Query: 185 LEVTLLDLTSCKDPPIILMSYKKRRKADKHFFKQIKKNFDVLEINEFTRFDHYLKQKTHL 244
           LE  LLDLT+C +PPIILM+Y+KRRKADK FF +I+KNFDV+EI++F+  + Y+KQ+THL
Sbjct: 180 LEKILLDLTNCDNPPIILMAYRKRRKADKRFFVRIRKNFDVIEIDDFSSHEKYMKQRTHL 239

Query: 245 FQLVRK 250
           F+L RK
Sbjct: 240 FELKRK 245

>ADL212W Chr4 (332487..333242) [756 bp, 251 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL024C
          Length = 251

 Score =  253 bits (646), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 136/245 (55%), Positives = 171/245 (69%), Gaps = 9/245 (3%)

Query: 7   FTACFNDLVPSRPTEHLGDSDLSFGGKLSPPLKIHEDGGESGCGGKVWIAGELLCEFLLE 66
           FTA F DLV  RP EHLG SDLS+ G+L PPLKIHEDGGESGCGGKVWIAG LLCEF+LE
Sbjct: 5   FTAVFEDLVEPRPIEHLGQSDLSYQGQLDPPLKIHEDGGESGCGGKVWIAGNLLCEFILE 64

Query: 67  KSDQQGLFSQWNSDTRFQSPIKKIVEXXXXXXXXXXXXXXXNKQNKLKDVDIYVTDIDQL 126
           KS    + SQ+     ++   K I+E                K N   D ++Y+TDI+ L
Sbjct: 65  KSKDGRVLSQFPG---YERQFKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEGL 121

Query: 127 VTLMDRNIKLNELEH-VFPKELWWGEPLKPEFAPTRSNQRQVDLILAADCVYLEKAFPLL 185
             LM +N++LN L+  V P+ L+WGEPL  EF      ++ +DL+LAADCVYLEKAFPLL
Sbjct: 122 CPLMQKNVELNGLDGMVHPRPLFWGEPLSDEF-----TRQPIDLVLAADCVYLEKAFPLL 176

Query: 186 EVTLLDLTSCKDPPIILMSYKKRRKADKHFFKQIKKNFDVLEINEFTRFDHYLKQKTHLF 245
           E TLLDLT+ +  P++LMSYKKRRKADK FF +IKK FD++EI +F  ++ Y +Q+T+LF
Sbjct: 177 EKTLLDLTAGESQPLVLMSYKKRRKADKKFFIKIKKEFDIIEIKDFKSYEDYRRQRTYLF 236

Query: 246 QLVRK 250
           QLVRK
Sbjct: 237 QLVRK 241

>KLLA0E08295g Chr5 complement(746166..746966) [801 bp, 266 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 266

 Score =  250 bits (639), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 138/251 (54%), Positives = 178/251 (70%), Gaps = 11/251 (4%)

Query: 1   MEDVLQFTACFNDLVPSRPTEHLGDSDLSFGGKLSPPLKIHEDGGESGCGGKVWIAGELL 60
           M DV  F++CF +LVP+RP EHLG  D+SF GKL  PL I+EDGGESGCGGKVWIAGELL
Sbjct: 25  MGDV-PFSSCFEELVPARPIEHLGKIDMSFNGKLPSPLIINEDGGESGCGGKVWIAGELL 83

Query: 61  CEFLLEKSDQQGLFSQWNSDTRFQSPIKKIVEXXXXXXXXXXXXXXXNKQNKLKDVDIYV 120
           CE++LEKSD++ L S    D    S    ++E               ++ N+  D ++Y+
Sbjct: 84  CEYILEKSDKEHLLSHLFPDGNCNS----VLELGSGTGLVGLCVGLMDQANEYSDREVYI 139

Query: 121 TDIDQLVTLMDRNIKLNELE-HVFPKELWWGEPLKPEFAPTRSNQRQVDLILAADCVYLE 179
           +DIDQL+ LM+ NI++N L+  V  + LWWG PL   F      ++ VDL+LAADCVYLE
Sbjct: 140 SDIDQLLGLMESNIQVNGLDDKVHAEVLWWGNPLPDVFV-----KKPVDLVLAADCVYLE 194

Query: 180 KAFPLLEVTLLDLTSCKDPPIILMSYKKRRKADKHFFKQIKKNFDVLEINEFTRFDHYLK 239
            AFPLLE TLL+LT  ++ PIILM+YKKRRKADKHFF++IKKNF ++EI +F  FD YLK
Sbjct: 195 AAFPLLEKTLLELTDGENVPIILMAYKKRRKADKHFFQKIKKNFKIVEIRDFINFDKYLK 254

Query: 240 QKTHLFQLVRK 250
           Q+THLFQL+R+
Sbjct: 255 QRTHLFQLMRE 265

>NDAI0J02860 Chr10 complement(713765..714808) [1044 bp, 347 aa] {ON}
           Anc_4.352 YJR129C
          Length = 347

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/209 (22%), Positives = 80/209 (38%), Gaps = 36/209 (17%)

Query: 44  GGESGCGGKVWIAGELLCEFLLEKSDQQGLFSQWNSDTRFQSPIKKIVEXXXXXXXXXXX 103
            G+S  G + W     L +FL+            N+  ++      ++E           
Sbjct: 136 SGKSTTGFRTWEGAVYLSKFLI------------NNCEKYLIEKTDVIELGAGTGLVSLC 183

Query: 104 XXXXNKQNKLKDVDIYVTDIDQ--LVTLMDRNIKLNEL----EHVFPKELWWGEPLKPEF 157
               + Q  +K   +YVTD D   + +++++N +LN +    E+V  ++LWW +P   E 
Sbjct: 184 ILENDLQKGIKRDKVYVTDGDSELVSSILNKNFELNNVNIEDENVILRKLWWNDP--NEK 241

Query: 158 APTRSNQRQVDLILAADCVYLEKAFPLLEVTLLDLTSCKDPPIILMSYKKRRKADKHFFK 217
                N + + L++ AD  Y     P       DL +C      L  +  + +  K    
Sbjct: 242 IAGEDNGK-IGLVVGADITYDNSVIP-------DLCAC------LKQFMDKNRDCKAIIS 287

Query: 218 QIKKNFDVLEINEFTRFDHYLKQKTHLFQ 246
              +N D   IN F R    L  K  + Q
Sbjct: 288 ATVRNIDT--INFFERKCEELGMKVQIIQ 314

>KNAG0C01800 Chr3 (352309..353574) [1266 bp, 421 aa] {ON} Anc_1.325
           YBR271W
          Length = 421

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 38/65 (58%), Gaps = 3/65 (4%)

Query: 114 KDVDIYVTDIDQLVTLMDRNIKLNELEH-VFPKELWWGEPLKPEFAPTRSNQRQVDLILA 172
            ++ IY+TD+ ++V  + +N++LN+LEH V    L W  P    F    + ++  DLIL 
Sbjct: 283 SNLQIYLTDLPEIVDNLKKNVQLNKLEHAVVADVLDWTNPYN--FIERYNGEQSFDLILV 340

Query: 173 ADCVY 177
           AD +Y
Sbjct: 341 ADPIY 345

>Suva_12.220 Chr12 complement(343489..344502) [1014 bp, 337 aa] {ON}
           YJR129C (REAL)
          Length = 337

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 62/140 (44%), Gaps = 20/140 (14%)

Query: 118 IYVTDIDQ--LVTLMDRNIKLNEL-----EHVFPKELWWGEPLKPEFAPTRSNQRQVDLI 170
           +YVTD D   + T + RN +LN+        +  + LWWG    P+         +V+L+
Sbjct: 193 MYVTDGDSDLVETQLRRNFELNDAWREQSPDIRLQRLWWGSDRVPD---------EVNLV 243

Query: 171 LAADCVYLEKAFPLLEVTLLDLTSCKDPPIILMSYKKRR-KADKHFFKQIKK---NFDVL 226
           +AAD  Y    FP L   L +  +     + L+S   R    DK F ++  K    + V+
Sbjct: 244 VAADVTYDSTIFPELCQCLAECLAMSHCKVCLLSATIRSYSTDKEFAQECHKVGLKYSVV 303

Query: 227 EINEFTRFDHYLKQKTHLFQ 246
              E+ R      +++ LF+
Sbjct: 304 TSTEYDRNSEARMEESLLFK 323

>Suva_4.532 Chr4 (916493..917743) [1251 bp, 416 aa] {ON} YBR271W
           (REAL)
          Length = 416

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 62/143 (43%), Gaps = 9/143 (6%)

Query: 113 LKDVDIYVTDIDQLVTLMDRNIKLNELEHVFPKELW-WGEPLKPEFAPTRSNQRQVDLIL 171
           + +++IYVTD+ ++VT + +N+ LN LE     E+  W  P    F     ++   D+IL
Sbjct: 278 IHNIEIYVTDLPEIVTNLKKNVLLNNLEDFVQAEVLDWTNP--QNFINQFGHEMDFDIIL 335

Query: 172 AADCVYL----EKAFPLLEVTLLDLTSCKDPPIILMSYKKRRKADKHFFKQIKKNFDVLE 227
            AD +Y     E    ++   L    +C     +   Y K R+  +   K    N  V+E
Sbjct: 336 VADPIYSPQHPEWVVNMISRFLAPSGTCHLEIPLRAKYAKEREVLRSLLKD--NNLQVVE 393

Query: 228 INEFTRFDHYLKQKTHLFQLVRK 250
            +     D +   K    Q+VR 
Sbjct: 394 ESYSEGMDDWGVVKYLYRQIVRN 416

>NCAS0J02150 Chr10 complement(415802..416770) [969 bp, 322 aa] {ON}
           Anc_4.352
          Length = 322

 Score = 37.0 bits (84), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 47/92 (51%), Gaps = 21/92 (22%)

Query: 109 KQNKLKDVDIYVTDID-QLVT-LMDRNIKLNELE---HVFPKELWWGEPLKPEFAPTRSN 163
           K NKL+   +YVTD D +LV+  M  N ++NE+    H+  ++LWW  P +P   P R  
Sbjct: 172 KDNKLRR--MYVTDGDSELVSGQMQDNFQMNEVNVDNHIKLQKLWWNSPDQP--IPER-- 225

Query: 164 QRQVDLILAADCVYLEKAFPLLEVTLLDLTSC 195
              V++++ AD  Y    F        DL SC
Sbjct: 226 ---VNVVIGADVTYDSTCFT-------DLCSC 247

>Skud_2.403 Chr2 (713779..715032) [1254 bp, 417 aa] {ON} YBR271W
           (REAL)
          Length = 417

 Score = 37.0 bits (84), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 37/63 (58%), Gaps = 3/63 (4%)

Query: 116 VDIYVTDIDQLVTLMDRNIKLNELEHVFPKELW-WGEPLKPEFAPTRSNQRQVDLILAAD 174
           ++I+VTD+ ++VT + +N+ LN L+     E+  W  P   +F     ++ + D+IL AD
Sbjct: 282 MEIFVTDLPEIVTNLKKNVSLNNLQDFVQAEILDWTNP--QDFIDRFGHENEFDIILVAD 339

Query: 175 CVY 177
            +Y
Sbjct: 340 PIY 342

>KAFR0E04280 Chr5 complement(864926..865873) [948 bp, 315 aa] {ON}
           Anc_4.352 YJR129C
          Length = 315

 Score = 36.6 bits (83), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 79/199 (39%), Gaps = 35/199 (17%)

Query: 47  SGCGGKVWIAGELLCEFLLEKSDQQGLFSQWNSDTRFQSPIKKIVEXXXXXXXXXXXXXX 106
           S  G + W A   LC+++             N DT   +    ++E              
Sbjct: 113 STTGFRTWEAASYLCDYI------------SNVDTESLNGCSTVLELGAGTGLCSLTLLK 160

Query: 107 XNKQNKLKDVDIYVTDID-QLVT-LMDRNIKLNELEH-----VFPKELWWGEPLKPEFAP 159
              Q+ LK V  YVTD D +L++  +  N KLNE+EH     V  + L WGE   P    
Sbjct: 161 GKFQDDLKKV--YVTDGDTELISGQLLSNFKLNEMEHEIGQKVKLQRLLWGEDSIP---- 214

Query: 160 TRSNQRQVDLILAADCVYLEKAFPLLEVTL---LDLTSCKDPPIILMSYKKRRKADKHFF 216
                  +D ++ AD  Y +  F  L   L    ++ SCK    ++ S  +  + D+ F 
Sbjct: 215 -----NDIDCVIGADVTYDDTLFDDLFKCLRQCFEIESCK--MCLIASTIRNVETDRKFL 267

Query: 217 KQIKKNFDVLEINEFTRFD 235
           +    +   +EI + T  D
Sbjct: 268 EHCHDSDFKVEIIQSTELD 286

>Skud_10.352 Chr10 complement(622581..623591) [1011 bp, 336 aa] {ON}
           YJR129C (REAL)
          Length = 336

 Score = 36.6 bits (83), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 59/142 (41%), Gaps = 25/142 (17%)

Query: 118 IYVTDIDQLVTLMDRNIKLN-ELEHVFP--------KELWWGEPLKPEFAPTRSNQRQVD 168
           +YVTD D    L++R +K N EL             + LWWG    P+          +D
Sbjct: 193 MYVTDGDS--NLVERQLKRNFELNDALCENGPDVKLQRLWWGSDRIPD---------DID 241

Query: 169 LILAADCVYLEKAFPLLEVTLLDLTSCKDPPIILMSYKKRRKADKHFFKQ----IKKNFD 224
           L++AAD  Y    FP L   L +  +     + L+S   R ++    F Q    I  N+ 
Sbjct: 242 LVVAADVTYDSTIFPELCQCLAECLAISRCKMCLLSATIRSESTDKLFAQECNKIGLNYT 301

Query: 225 VLEINEFTRFDHYLKQKTHLFQ 246
           V+   E  + D   + KT  F+
Sbjct: 302 VVSSTEHDK-DSESRMKTLTFK 322

>YBR271W Chr2 (744852..746111) [1260 bp, 419 aa] {ON}
           EFM2S-adenosylmethionine-dependent methyltransferase;
           methylates translation elongation factors EF2 (Eft1p and
           Eft2p) and EF3A (Yef3p); belongs to the seven
           beta-strand family; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm;
           predicted to be involved in ribosome biogenesis
          Length = 419

 Score = 35.8 bits (81), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 38/65 (58%), Gaps = 3/65 (4%)

Query: 114 KDVDIYVTDIDQLVTLMDRNIKLNELEHVFPKELW-WGEPLKPEFAPTRSNQRQVDLILA 172
           ++++I+VTD+ ++VT + +N+ LN L      E+  W  P   +F     ++ + D+IL 
Sbjct: 282 ENIEIFVTDLPEIVTNLKKNVSLNNLGDFVQAEILDWTNP--HDFIDKFGHENEFDVILI 339

Query: 173 ADCVY 177
           AD +Y
Sbjct: 340 ADPIY 344

>KAFR0C04250 Chr3 (844020..845195) [1176 bp, 391 aa] {ON} Anc_1.325
           YBR271W
          Length = 391

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 72/145 (49%), Gaps = 11/145 (7%)

Query: 113 LKDVDIYVTDIDQLVTLMDRNIKLNELEH-VFPKELWWGEPLKPEFAPTRSNQRQVDLIL 171
           L + +IY+TD+ ++VT +++NI +N+L + V    L W  P    F     + R  D++L
Sbjct: 249 LDEYEIYLTDLPEIVTNLEKNISINQLANRVVSDVLDWTNP--ESFVSNYGDTR-FDVLL 305

Query: 172 AADCVYLEKAFPLLEVTLLDLTSCKDPP----IILMSYKKRRKADKHFFKQ--IKKNFDV 225
            +D +Y  K  P   V ++D    +D       + +  + +   ++   K+  + KNF+V
Sbjct: 306 ISDPIYSSK-HPQWVVNMIDNFLSQDNHQARCYLQIPIRDKFANERENLKKLLVDKNFEV 364

Query: 226 LEINEFTRFDHYLKQKTHLFQLVRK 250
           ++      FD + + K +  +L RK
Sbjct: 365 VKEMYSKGFDDWGEVKYYYRELKRK 389

>Smik_2.414 Chr2 (730531..731784) [1254 bp, 417 aa] {ON} YBR271W
           (REAL)
          Length = 417

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 3/66 (4%)

Query: 113 LKDVDIYVTDIDQLVTLMDRNIKLNELEHVFPKELW-WGEPLKPEFAPTRSNQRQVDLIL 171
           + + +I+VTD+  +VT + +N+ LN L+     E+  W  P    F      + + D+IL
Sbjct: 279 IDNTEIFVTDLPDIVTNLKKNVSLNNLQDFVQAEILDWTNP--QSFIDRFGYENEFDIIL 336

Query: 172 AADCVY 177
            AD +Y
Sbjct: 337 IADPIY 342

>Kwal_47.16635 s47 complement(37749..38717) [969 bp, 322 aa] {ON}
           YJR129C - Hypothetical ORF [contig 376] FULL
          Length = 322

 Score = 34.3 bits (77), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 39/82 (47%), Gaps = 25/82 (30%)

Query: 117 DIYVTDIDQLVTLMDRNIKLN-ELEHVFP------------KELWWGEPLKPEFAPTRSN 163
           ++YVTD D   TL+++ I+ N +L +V              + LWWGE + P+       
Sbjct: 187 ELYVTDGDS--TLVEQAIRYNFQLNNVTAAPANTLDCQYKFQRLWWGEDVVPD------- 237

Query: 164 QRQVDLILAADCVYLEKAFPLL 185
              VD++LAAD  Y     P L
Sbjct: 238 ---VDIVLAADVTYDASVVPSL 256

>Kpol_1066.17 s1066 complement(28462..29769) [1308 bp, 435 aa] {ON}
           complement(28462..29769) [1308 nt, 436 aa]
          Length = 435

 Score = 34.3 bits (77), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 36/68 (52%), Gaps = 4/68 (5%)

Query: 111 NKLKDVDIYVTDIDQLVTLMDRNIKLNELEHVFPKE-LWWGEPLKPEFAPTRSNQRQVDL 169
           N L + +I +TD+ ++V  + RNI +N L  +     L W  P    F    SN++  D+
Sbjct: 294 NNLPNTEIILTDLPEIVGNLQRNISINNLNDIARASVLDWTNP--KSFIQEYSNEK-FDI 350

Query: 170 ILAADCVY 177
           IL AD +Y
Sbjct: 351 ILVADPIY 358

>Smik_10.422 Chr10 complement(653045..654067) [1023 bp, 340 aa] {ON}
           YJR129C (REAL)
          Length = 340

 Score = 33.9 bits (76), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 45/110 (40%), Gaps = 20/110 (18%)

Query: 118 IYVTDIDQLVTLMDRNIKLN-ELEHVFP--------KELWWGEPLKPEFAPTRSNQRQVD 168
           +YVTD D    L++R +K N EL             + LWWG    P+          +D
Sbjct: 196 MYVTDGDS--DLVERQLKKNFELNDALSEHKPDIRFQRLWWGSDKVPD---------DID 244

Query: 169 LILAADCVYLEKAFPLLEVTLLDLTSCKDPPIILMSYKKRRKADKHFFKQ 218
           L++ AD  Y    FP L   L +  +     + L+S   R ++    F Q
Sbjct: 245 LVVGADVTYDSTIFPELCKCLAECLAINRCKMCLLSATIRSESTDKLFAQ 294

>KLTH0E08756g Chr5 (793960..795327) [1368 bp, 455 aa] {ON} highly
           similar to uniprot|Q06178 Saccharomyces cerevisiae
           YLR328W NMA1 Nicotinic acid mononucleotide
           adenylyltransferase involved in NAD( ) salvage pathway
          Length = 455

 Score = 32.7 bits (73), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 2/60 (3%)

Query: 155 PEFAPTRSNQRQVDLILAADCVYLEKAFPLLEVTLLDLTSCKDPPIILMSYKKRRKADKH 214
           P+F P   N R  +  LA     + K+ P++   L D  +  D PI   +YKK  KA +H
Sbjct: 7   PDFEPPSEN-RTPNPPLAPQST-IPKSGPIMPYVLADYNASIDAPIHPRTYKKHSKAGRH 64

>AER240W Chr5 (1080474..1081646) [1173 bp, 390 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YBR271W
          Length = 390

 Score = 32.3 bits (72), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 3/61 (4%)

Query: 117 DIYVTDIDQLVTLMDRNIKLNELEHVFPKELWWGEPLKPEFAPTRSNQRQVDLILAADCV 176
           D++VTD+ ++V  +  N+ LN L +V    L W +P    F      + Q D I  AD +
Sbjct: 255 DVFVTDLPEIVPNLRHNLALNNLTNVRASVLDWSDPTS--FL-HEHGELQFDAIFVADPI 311

Query: 177 Y 177
           Y
Sbjct: 312 Y 312

>TPHA0L00340 Chr12 (45910..46935) [1026 bp, 341 aa] {ON} Anc_4.352
           YJR129C
          Length = 341

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 49/108 (45%), Gaps = 16/108 (14%)

Query: 118 IYVTDIDQ--LVTLMDRNIKLNELEH---VFPKELWWGEPLKPEFAPTRSNQRQVDLILA 172
           +Y+TD D   L   + RN+ LN ++    V  ++L W E   P+          +DLI+A
Sbjct: 195 LYITDGDSQLLEGQLSRNVMLNGIDSSDSVKLQKLRWNEDHIPD---------NLDLIVA 245

Query: 173 ADCVYLEKAFPLLEVTLLDL--TSCKDPPIILMSYKKRRKADKHFFKQ 218
           AD  Y     P L   +LD   +S K   +  ++  +R +     F+Q
Sbjct: 246 ADVTYDSSVIPSLCHCILDCFKSSNKCSTVCYLAATRRNQETIAVFEQ 293

>KLTH0D17996g Chr4 (1490856..1491809) [954 bp, 317 aa] {ON} similar
           to uniprot|P47163 Saccharomyces cerevisiae YJR129C
           Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 317

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 19/41 (46%), Gaps = 10/41 (24%)

Query: 145 KELWWGEPLKPEFAPTRSNQRQVDLILAADCVYLEKAFPLL 185
           + LWWGE   PE          VD++LAAD  Y     P L
Sbjct: 215 QRLWWGEDAVPE----------VDIVLAADVTYDSSVIPSL 245

>KLLA0E21539g Chr5 complement(1923103..1924305) [1203 bp, 400 aa]
           {ON} similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 400

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 3/63 (4%)

Query: 115 DVDIYVTDIDQLVTLMDRNIKLNELEHVFPKELWWGEPLKPEFAPTRSNQRQVDLILAAD 174
           D  I++TD+ +++  +  N++LN L  V    L W +PL   F     N+   D I+ AD
Sbjct: 263 DSVIFLTDLPEILPNLQYNVRLNNLNDVTADVLDWTDPLS--FTEKYGNE-PFDTIVIAD 319

Query: 175 CVY 177
            +Y
Sbjct: 320 PIY 322

>Ecym_5513 Chr5 (1042019..1043209) [1191 bp, 396 aa] {ON} similar to
           Ashbya gossypii AER240W
          Length = 396

 Score = 30.4 bits (67), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 3/60 (5%)

Query: 118 IYVTDIDQLVTLMDRNIKLNELEHVFPKELWWGEPLKPEFAPTRSNQRQVDLILAADCVY 177
           I +TD+  +V  +  NIKLN L++V   EL W +     F       +  D+IL +D +Y
Sbjct: 265 IILTDLPDIVPNLRSNIKLNNLKNVHAAELDWTD--HSTFIAQHGGDK-FDMILVSDPIY 321

>CAGL0I09438g Chr9 (904886..906106) [1221 bp, 406 aa] {ON} similar
           to uniprot|P38347 Saccharomyces cerevisiae YBR271w
          Length = 406

 Score = 30.0 bits (66), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 4/63 (6%)

Query: 116 VDIYVTDIDQLVTLMDRNIKLNELEHVFPKE-LWWGEPLKPEFAPTRSNQRQVDLILAAD 174
            +IY+TD+ ++V  +  N+K+N L+ +   + L W  P    F     N+R  D I+ AD
Sbjct: 271 TEIYLTDLPEIVDNLKDNVKINNLQDIATADVLDWTNP--DTFTEKYGNER-FDYIVIAD 327

Query: 175 CVY 177
            +Y
Sbjct: 328 PIY 330

>SAKL0D06798g Chr4 complement(564525..565790) [1266 bp, 421 aa] {ON}
           similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 421

 Score = 30.0 bits (66), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 43/88 (48%), Gaps = 9/88 (10%)

Query: 109 KQNKLKDVDIYVTDIDQLVTLMDRNIKLNELEH-----VFPKELWWGEPLKPEFAPTRSN 163
            +  L   ++Y+TD+ ++V  + +N+++N L       V    L W  P+   F     +
Sbjct: 272 SKTALGSCEMYLTDLPEIVPNLQKNVEINNLNSQSGLAVCADVLDWTNPVS--FTEKYGD 329

Query: 164 QRQVDLILAADCVYLEKAFPLLEVTLLD 191
            +  D+IL AD +Y     P+  VT++D
Sbjct: 330 DK-FDVILIADPIY-SPQHPVWVVTMID 355

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.139    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 27,356,824
Number of extensions: 1167840
Number of successful extensions: 2648
Number of sequences better than 10.0: 44
Number of HSP's gapped: 2646
Number of HSP's successfully gapped: 44
Length of query: 252
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 145
Effective length of database: 41,212,137
Effective search space: 5975759865
Effective search space used: 5975759865
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)