Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E07590g2.290ON26026012701e-179
KLTH0G10450g2.290ON2612619181e-125
Kwal_27.115092.290ON2612359111e-124
KLLA0E08273g2.290ON2612618401e-113
Ecym_33292.290ON2582348281e-111
Kpol_1003.402.290ON2612628221e-111
ZYRO0A01958g2.290ON2632368201e-110
NDAI0B035402.290ON2612378191e-110
Skud_9.802.290ON2642388171e-110
Smik_9.862.290ON2642388111e-109
YIL093C (RSM25)2.290ON2642388051e-108
Suva_9.1062.290ON2642388031e-108
TBLA0B059602.290ON2662347981e-107
NCAS0B062402.290ON2602367801e-104
TDEL0G022002.290ON2612367781e-104
KAFR0J013502.290ON2642377741e-103
KNAG0A054102.290ON2662367449e-99
TPHA0C034202.290ON2682397441e-98
CAGL0D04158g2.290ON2722327059e-93
ADL211C2.290ON2251906173e-80
NCAS0B02500singletonON33657730.87
NCAS0A007801.111ON54959702.0
KLTH0H02662g6.280ON36869666.7
KNAG0B010503.442ON70761667.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E07590g
         (260 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E07590g Chr5 (613875..614657) [783 bp, 260 aa] {ON} similar...   493   e-179
KLTH0G10450g Chr7 complement(884037..884822) [786 bp, 261 aa] {O...   358   e-125
Kwal_27.11509 s27 (831150..831935) [786 bp, 261 aa] {ON} YIL093C...   355   e-124
KLLA0E08273g Chr5 (745145..745930) [786 bp, 261 aa] {ON} similar...   328   e-113
Ecym_3329 Chr3 complement(630346..631122) [777 bp, 258 aa] {ON} ...   323   e-111
Kpol_1003.40 s1003 complement(97903..98688) [786 bp, 261 aa] {ON...   321   e-111
ZYRO0A01958g Chr1 complement(162742..163533) [792 bp, 263 aa] {O...   320   e-110
NDAI0B03540 Chr2 (890148..890933) [786 bp, 261 aa] {ON} Anc_2.29...   320   e-110
Skud_9.80 Chr9 complement(164635..165429) [795 bp, 264 aa] {ON} ...   319   e-110
Smik_9.86 Chr9 complement(167101..167895) [795 bp, 264 aa] {ON} ...   317   e-109
YIL093C Chr9 complement(187990..188784) [795 bp, 264 aa] {ON}  R...   314   e-108
Suva_9.106 Chr9 complement(182086..182880) [795 bp, 264 aa] {ON}...   313   e-108
TBLA0B05960 Chr2 complement(1408779..1409579) [801 bp, 266 aa] {...   311   e-107
NCAS0B06240 Chr2 (1178232..1179014) [783 bp, 260 aa] {ON} Anc_2....   305   e-104
TDEL0G02200 Chr7 complement(433032..433817) [786 bp, 261 aa] {ON...   304   e-104
KAFR0J01350 Chr10 (247931..248725) [795 bp, 264 aa] {ON} Anc_2.2...   302   e-103
KNAG0A05410 Chr1 (798238..799038) [801 bp, 266 aa] {ON} Anc_2.29...   291   9e-99
TPHA0C03420 Chr3 complement(750353..751159) [807 bp, 268 aa] {ON...   291   1e-98
CAGL0D04158g Chr4 complement(410309..411127) [819 bp, 272 aa] {O...   276   9e-93
ADL211C Chr4 complement(333418..334095) [678 bp, 225 aa] {ON} Sy...   242   3e-80
NCAS0B02500 Chr2 complement(416748..417758) [1011 bp, 336 aa] {O...    33   0.87 
NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {O...    32   2.0  
KLTH0H02662g Chr8 complement(233610..234716) [1107 bp, 368 aa] {...    30   6.7  
KNAG0B01050 Chr2 complement(189006..191129) [2124 bp, 707 aa] {O...    30   7.1  

>SAKL0E07590g Chr5 (613875..614657) [783 bp, 260 aa] {ON} similar to
           uniprot|P40496 Saccharomyces cerevisiae YIL093C RSM25
           Mitochondrial ribosomal protein of the small subunit
          Length = 260

 Score =  493 bits (1270), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 244/260 (93%), Positives = 244/260 (93%)

Query: 1   MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL 60
           MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL
Sbjct: 1   MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL 60

Query: 61  SEYSETVGIKNGTYKTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSRPKV 120
           SEYSETVGIKNGTYKTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSRPKV
Sbjct: 61  SEYSETVGIKNGTYKTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSRPKV 120

Query: 121 LIENTGEESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRVRVQ 180
           LIENTGEESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRVRVQ
Sbjct: 121 LIENTGEESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRVRVQ 180

Query: 181 QEIHEQVAQEEAEMFGSVFGSSSIEYGLEKEQKVIETWKKKAIQQTELMAARSSGPXXXX 240
           QEIHEQVAQEEAEMFGSVFGSSSIEYGLEKEQKVIETWKKKAIQQTELMAARSSGP    
Sbjct: 181 QEIHEQVAQEEAEMFGSVFGSSSIEYGLEKEQKVIETWKKKAIQQTELMAARSSGPSAAW 240

Query: 241 XXXXXXXXXXXXQDVEELQL 260
                       QDVEELQL
Sbjct: 241 ENAAEANEESVEQDVEELQL 260

>KLTH0G10450g Chr7 complement(884037..884822) [786 bp, 261 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093C RSM25 Mitochondrial ribosomal protein of the
           small subunit
          Length = 261

 Score =  358 bits (918), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 170/261 (65%), Positives = 207/261 (79%), Gaps = 1/261 (0%)

Query: 1   MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL 60
           MKVQ NAVN+LERTS+YL+AGLL K PAWY+VVA VPPSK F REP++ NPS NK  A L
Sbjct: 1   MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL 60

Query: 61  SEYSETVGIKNGTYKTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSRPKV 120
           SE++E   ++N +YKTR S S+R+VS +KL+ APKL YAEDKLRE+FY+QHPWELSRPK+
Sbjct: 61  SEFAEQYSVENRSYKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELSRPKM 120

Query: 121 LIENTGEESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRVRVQ 180
           L+EN+G   YDWSTIQQLGKPLDGESVVQRTLYLL+ K    L+ AYDQARFEFYR+R+Q
Sbjct: 121 LVENSGTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYRLRIQ 180

Query: 181 QEIHEQVAQEEAEMFGSVFGSSSIEYGLEKEQKVIETWKKKAIQQTELMAARSSGPXXX- 239
           +E+  QVAQEEAEMFGSVFG S+I++GLEKEQK+I+ WK+KAI QTE+M+AR+  P    
Sbjct: 181 EEVQNQVAQEEAEMFGSVFGPSAIDFGLEKEQKIIDVWKQKAIDQTEVMSARNINPSESW 240

Query: 240 XXXXXXXXXXXXXQDVEELQL 260
                        +D +ELQL
Sbjct: 241 SAQESQPQSDAKAEDTKELQL 261

>Kwal_27.11509 s27 (831150..831935) [786 bp, 261 aa] {ON} YIL093C
           (RSM25) - mitochondrial ribosome small subunit component
           [contig 27] FULL
          Length = 261

 Score =  355 bits (911), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 163/235 (69%), Positives = 199/235 (84%)

Query: 1   MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL 60
           MKVQ NAVN+LERTS+YLRAG+L K PAWY VVA +PPSK F REP++ NPS N  IA L
Sbjct: 1   MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL 60

Query: 61  SEYSETVGIKNGTYKTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSRPKV 120
           SE+ E+   +N +YKTR S  D++VS NKLYKAPKL YAEDKLRELF++QHPWELSRPK+
Sbjct: 61  SEFRESYNFENRSYKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSRPKM 120

Query: 121 LIENTGEESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRVRVQ 180
           L+EN+G + YDWST+QQLGKPLDGESVVQRTLYLLK KK   L+ AYDQARFEFYR+R+Q
Sbjct: 121 LVENSGIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRLRIQ 180

Query: 181 QEIHEQVAQEEAEMFGSVFGSSSIEYGLEKEQKVIETWKKKAIQQTELMAARSSG 235
           +E+  QVAQEEAEM GSVFG S+I++GL+KEQK+I+ WK+KAI Q+EL++AR++ 
Sbjct: 181 EEVQNQVAQEEAEMLGSVFGPSAIDFGLKKEQKIIDVWKQKAIDQSELLSARNTN 235

>KLLA0E08273g Chr5 (745145..745930) [786 bp, 261 aa] {ON} similar to
           uniprot|P40496 Saccharomyces cerevisiae YIL093C RSM25
           Mitochondrial ribosomal protein of the small subunit
          Length = 261

 Score =  328 bits (840), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 165/261 (63%), Positives = 205/261 (78%), Gaps = 1/261 (0%)

Query: 1   MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL 60
           MKVQ  AVN+LERTSAYL++G+L K PAWYNV+A VPP+K FAR P++T+P N K+  +L
Sbjct: 1   MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRTAL 60

Query: 61  SEYSETVGIKNGTYKTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSRPKV 120
            +YS      +G YKTR +  ++K   +KLY++PKL Y EDKLR+LF+QQHPWELSRPK+
Sbjct: 61  PDYSNWKANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSRPKI 120

Query: 121 LIENTGE-ESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRVRV 179
           L+ENT E + YDWS IQQLGKPLDGESVVQRTL+LLK  ++  L++AYDQARFEFYR+R+
Sbjct: 121 LVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYDQARFEFYRLRI 180

Query: 180 QQEIHEQVAQEEAEMFGSVFGSSSIEYGLEKEQKVIETWKKKAIQQTELMAARSSGPXXX 239
           QQEI +QVAQEEAEMFGSVF ++SIEYG+ KEQKVI+TWK+KA+QQ ELMAAR+S P   
Sbjct: 181 QQEIQDQVAQEEAEMFGSVFHTTSIEYGIAKEQKVIDTWKRKALQQAELMAARASSPSAS 240

Query: 240 XXXXXXXXXXXXXQDVEELQL 260
                        QDVEE+QL
Sbjct: 241 WTNETEEEQKPIDQDVEEIQL 261

>Ecym_3329 Chr3 complement(630346..631122) [777 bp, 258 aa] {ON}
           similar to Ashbya gossypii ADL211C
          Length = 258

 Score =  323 bits (828), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 147/234 (62%), Positives = 186/234 (79%)

Query: 1   MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL 60
           MK+QTNA N+LERTS++LR GLL + P WY+V+   PPS  FAR+PK+ NPS     A L
Sbjct: 1   MKIQTNATNILERTSSFLRVGLLARTPVWYDVIVKSPPSTKFARQPKLVNPSTGAYTAKL 60

Query: 61  SEYSETVGIKNGTYKTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSRPKV 120
            E+S+     +GTYKTR +  +++VS + +Y+APKL Y EDKLR LFY+QHPWELSRPK+
Sbjct: 61  REFSDNRNSSSGTYKTRANKHEKRVSTSAVYRAPKLYYFEDKLRSLFYKQHPWELSRPKI 120

Query: 121 LIENTGEESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRVRVQ 180
           L+EN G+E +DWS IQQLGKPLDGESVVQRTLYLL   +   L++AYDQARFEFYR+R+Q
Sbjct: 121 LVENQGDEKHDWSRIQQLGKPLDGESVVQRTLYLLGSGEHTNLIDAYDQARFEFYRLRMQ 180

Query: 181 QEIHEQVAQEEAEMFGSVFGSSSIEYGLEKEQKVIETWKKKAIQQTELMAARSS 234
           QE+ EQVAQEEA M GSVFG S++E+GL KEQ+VI+ WKKKA++Q ELM+A+ S
Sbjct: 181 QELEEQVAQEEAGMLGSVFGPSAVEFGLRKEQEVIDDWKKKALKQVELMSAKRS 234

>Kpol_1003.40 s1003 complement(97903..98688) [786 bp, 261 aa] {ON}
           complement(97903..98688) [786 nt, 262 aa]
          Length = 261

 Score =  321 bits (822), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 167/262 (63%), Positives = 199/262 (75%), Gaps = 3/262 (1%)

Query: 1   MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL 60
           MK+Q NAVN+LERTSAYLRAGLLTK PAWYNVVASVPP K F R PK+TNPSN++    L
Sbjct: 1   MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQL 60

Query: 61  SEYSETVGIKNGTYKTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSRPKV 120
                + G  NG +KTR +  DR  +  +LY A KL Y ED+LRE+FY+QHPWELSRPK+
Sbjct: 61  HSLDSSAG-NNGMFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSRPKI 119

Query: 121 LIENTGEESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRVRVQ 180
           LIEN G+E YDWS +QQ+GKPLDGESVVQRTLYL+K K+  +LV AYD AR+EFYR+R+Q
Sbjct: 120 LIENNGDEKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYDMARYEFYRLRMQ 179

Query: 181 QEIHEQVAQEEAEMFGSVFGSSSIEYGLEKEQKVIETWKKKAIQQTELMAARSSGPXX-- 238
           Q I EQVAQEEAEMFGSVFG S+IEYG++KEQKVI+TWK+KAI QTE+MAAR   P    
Sbjct: 180 QHIEEQVAQEEAEMFGSVFGPSAIEYGIQKEQKVIDTWKRKAIIQTEIMAARRINPSESW 239

Query: 239 XXXXXXXXXXXXXXQDVEELQL 260
                         +DVEE++L
Sbjct: 240 ATDEKDPKKNDDIEEDVEEIKL 261

>ZYRO0A01958g Chr1 complement(162742..163533) [792 bp, 263 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093C RSM25 Mitochondrial ribosomal protein of the
           small subunit
          Length = 263

 Score =  320 bits (820), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 148/236 (62%), Positives = 190/236 (80%), Gaps = 1/236 (0%)

Query: 1   MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL 60
           MK+QTNAVN+LERTSAYLR+GLL + PAWY VVASVPP+  F RE +  NPS  K     
Sbjct: 1   MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQW 60

Query: 61  SEYSETVGIKNGTYKTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSRPKV 120
            E+ E +  + G YKTR S  DRK   ++LYKAPKL + ED+LRE+FYQQHPWE SRPK+
Sbjct: 61  KEFDEGIN-RKGFYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSRPKM 119

Query: 121 LIENTGEESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRVRVQ 180
           L+EN   E++DWS + QLGKPLDGESVVQRT+YLL++  +L +++AYD+ RFEFYR+R+Q
Sbjct: 120 LVENEINENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRLRMQ 179

Query: 181 QEIHEQVAQEEAEMFGSVFGSSSIEYGLEKEQKVIETWKKKAIQQTELMAARSSGP 236
           +EI +QVAQEEAEMFGSVF SS+I+YG+E+EQ+VI+ WK+KAI++TEL+AAR + P
Sbjct: 180 EEIEQQVAQEEAEMFGSVFSSSAIDYGVEQEQRVIDVWKQKAIEETELLAARRASP 235

>NDAI0B03540 Chr2 (890148..890933) [786 bp, 261 aa] {ON} Anc_2.290
           YIL093C
          Length = 261

 Score =  320 bits (819), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 153/237 (64%), Positives = 189/237 (79%), Gaps = 3/237 (1%)

Query: 1   MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL 60
           MK+QTNAVNL+ERTSAYL +GLL   PAWY+VVAS+PP+K F REPKITNP+  +N    
Sbjct: 1   MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGRNKTFF 60

Query: 61  SEYSETVGIKN-GTYKTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSRPK 119
            +  + + + N G YKTR +  DRK S N LYK PKL Y ED+LR LF++QHPWELSRPK
Sbjct: 61  KD--DRIRVNNKGLYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSRPK 118

Query: 120 VLIENTGEESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRVRV 179
           +LIEN+ EE++DWS IQQ  K LDGESVVQRTLYLLK +  + ++ AY++ARFEFYR+R+
Sbjct: 119 ILIENSLEENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRLRI 178

Query: 180 QQEIHEQVAQEEAEMFGSVFGSSSIEYGLEKEQKVIETWKKKAIQQTELMAARSSGP 236
           QQ+I +QVAQEEAEMFGS+F  +S E+G+EKEQKVIE WKKKAIQ+T+LM  RSS P
Sbjct: 179 QQDISQQVAQEEAEMFGSIFRQTSFEHGIEKEQKVIEQWKKKAIQETQLMEVRSSNP 235

>Skud_9.80 Chr9 complement(164635..165429) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  319 bits (817), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 148/238 (62%), Positives = 190/238 (79%), Gaps = 2/238 (0%)

Query: 1   MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL 60
           MK+QTNAVN+L+RTSAYL++GLL + PAWYNVVAS+PPS  F REP+  NPSN   I  L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL 60

Query: 61  SEYSETVGI-KNGTYKTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSRPK 119
            + ++     KNG YKTR + +D++VS  KLYK PKL Y ED+LR LFY+QHPWELSRPK
Sbjct: 61  DDVTQRQHANKNGLYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSRPK 120

Query: 120 VLIEN-TGEESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRVR 178
           +L+EN  G+E YDW  + QLGKPLDGESVVQRT++LLK K+   +V AYD AR+EFY +R
Sbjct: 121 ILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYALR 180

Query: 179 VQQEIHEQVAQEEAEMFGSVFGSSSIEYGLEKEQKVIETWKKKAIQQTELMAARSSGP 236
           +Q+E  +QVA EEAEMFGS+FG S+IE+G++KEQ+V++ W+KK I++TELMAA+SS P
Sbjct: 181 MQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLDVWEKKVIEETELMAAKSSNP 238

>Smik_9.86 Chr9 complement(167101..167895) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  317 bits (811), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 148/238 (62%), Positives = 184/238 (77%), Gaps = 2/238 (0%)

Query: 1   MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL 60
           MK+QTNAVN+L+RTSAYL++GLL   PAWYNVVAS+PPS  F REP   NPSN   I  L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKDTPAWYNVVASIPPSTKFTREPHFENPSNGHTIGRL 60

Query: 61  SEYSETVGIK-NGTYKTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSRPK 119
            +  E      NG YKTR + +D+++   KLYK PKL Y ED+LR LFY+QHPWELSRPK
Sbjct: 61  VDVIENQHTNSNGLYKTRPNTNDKRIGVKKLYKPPKLTYVEDRLRTLFYKQHPWELSRPK 120

Query: 120 VLIEN-TGEESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRVR 178
           +L+EN  G+E YDWS + QLGKPLDGESV+QRT+YLLK K+    V AYD AR+EFY +R
Sbjct: 121 ILVENEIGDEDYDWSHMLQLGKPLDGESVIQRTMYLLKTKQYENTVEAYDHARYEFYALR 180

Query: 179 VQQEIHEQVAQEEAEMFGSVFGSSSIEYGLEKEQKVIETWKKKAIQQTELMAARSSGP 236
           +Q+E  +QVA EEAEMFGS+FG S+IE+G++KEQ+V+  W+KK I++TELMAARSS P
Sbjct: 181 MQEETQQQVALEEAEMFGSIFGKSAIEHGIQKEQEVLNIWEKKVIEETELMAARSSNP 238

>YIL093C Chr9 complement(187990..188784) [795 bp, 264 aa] {ON}
           RSM25Mitochondrial ribosomal protein of the small
           subunit
          Length = 264

 Score =  314 bits (805), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 143/238 (60%), Positives = 190/238 (79%), Gaps = 2/238 (0%)

Query: 1   MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL 60
           MK+QTNAVN+L+RTSAYL++GLL + PAWYNVVAS+PPS  F REP+  NPSN   I  L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFKNPSNGHIIGKL 60

Query: 61  SEYSETVGIKN-GTYKTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSRPK 119
            + +E     N G YKTR + SD++V   +LY+ PKL Y ED+LR LFY+QHPWELSRPK
Sbjct: 61  VDVTEQPHANNKGLYKTRPNSSDKRVGVKRLYRPPKLTYVEDRLRSLFYKQHPWELSRPK 120

Query: 120 VLIEN-TGEESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRVR 178
           +L+EN  G+E+YDWS + Q+G+PLDGESV+QRT+YL+K K+   +V AYD AR+EFY +R
Sbjct: 121 ILVENEIGDENYDWSHMLQIGRPLDGESVIQRTMYLIKTKQYGDMVEAYDHARYEFYALR 180

Query: 179 VQQEIHEQVAQEEAEMFGSVFGSSSIEYGLEKEQKVIETWKKKAIQQTELMAARSSGP 236
           +Q+E  +QVA EEAEMFGS+FG S+IE+G++KEQ+V++ W+KK +++TELMAAR+S P
Sbjct: 181 MQEETEQQVALEEAEMFGSLFGVSAIEHGIQKEQEVLDVWEKKVVEETELMAARTSNP 238

>Suva_9.106 Chr9 complement(182086..182880) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  313 bits (803), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 147/238 (61%), Positives = 189/238 (79%), Gaps = 2/238 (0%)

Query: 1   MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL 60
           MK+QTNAVN+L+RTSAYL++GLL   PAWYNVVAS+PPS  F REP+  NPSN + I  L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKDTPAWYNVVASIPPSTKFTREPRFKNPSNGRIIGKL 60

Query: 61  SEYSE-TVGIKNGTYKTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSRPK 119
            + +E      NG YKTR + +DR+V   KLYK PKL Y ED+LR LFY+QHPWELSRPK
Sbjct: 61  VDVTERQQANANGLYKTRPNPNDRRVGVKKLYKPPKLTYVEDRLRVLFYKQHPWELSRPK 120

Query: 120 VLIEN-TGEESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRVR 178
           +L+EN  G+E+YDWS + QLGK LDGESV+QRT++LLK ++   +V AYD AR+EFY +R
Sbjct: 121 ILVENEVGDENYDWSHMLQLGKVLDGESVIQRTMHLLKTQQYKDMVEAYDHARYEFYALR 180

Query: 179 VQQEIHEQVAQEEAEMFGSVFGSSSIEYGLEKEQKVIETWKKKAIQQTELMAARSSGP 236
           +++E  +QVA EEAEMFGS+FG SSIE+G++KEQ+V++ W+KK I++TELMAARSS P
Sbjct: 181 MEEETQQQVALEEAEMFGSIFGVSSIEHGIQKEQEVLDVWEKKVIEETELMAARSSNP 238

>TBLA0B05960 Chr2 complement(1408779..1409579) [801 bp, 266 aa] {ON}
           Anc_2.290 YIL093C
          Length = 266

 Score =  311 bits (798), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 142/234 (60%), Positives = 186/234 (79%)

Query: 1   MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL 60
           MK+Q NAVN+LERTSAYL+AG++ K P WY+VVA+ PPSK F REPK  NPS NK     
Sbjct: 1   MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPSTNKRTVEF 60

Query: 61  SEYSETVGIKNGTYKTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSRPKV 120
               + +    G YKTR +  D+K + + LYK PKL Y EDKLR+LFY+QHPWEL+RPK+
Sbjct: 61  KPLKDYLNRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELTRPKI 120

Query: 121 LIENTGEESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRVRVQ 180
           ++EN GE +YDWS + QLGKPLDGESVVQRTL+LLK K+   L++AY+QARFEFYR+R+ 
Sbjct: 121 VMENHGEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYNQARFEFYRLRMA 180

Query: 181 QEIHEQVAQEEAEMFGSVFGSSSIEYGLEKEQKVIETWKKKAIQQTELMAARSS 234
           +EI EQVAQEE+EMFG+VFGS++IE+G+EKEQ++I++WK +AI++TE+  A+ S
Sbjct: 181 EEIQEQVAQEESEMFGAVFGSTTIEFGIEKEQEMIDSWKVEAIKETEINEAKRS 234

>NCAS0B06240 Chr2 (1178232..1179014) [783 bp, 260 aa] {ON} Anc_2.290
           YIL093C
          Length = 260

 Score =  305 bits (780), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 156/236 (66%), Positives = 192/236 (81%), Gaps = 2/236 (0%)

Query: 1   MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL 60
           M+VQTNA+N++ERTSAYL++GLL   PAWY VVA +PP+K F REP++ NPS N+++A L
Sbjct: 1   MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNEDLAVL 60

Query: 61  SEYSETVGIKNGTYKTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSRPKV 120
            +  E V  K G YKTR +  DRKV+ NKLYK PKL Y ED+LR LF+ QHPWELSRPK+
Sbjct: 61  RDNREAVN-KKGFYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELSRPKI 119

Query: 121 LIENTGEESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRVRVQ 180
           L+EN+ EE +DWS IQQLGKPLDGESVVQRT+YLLK  K + ++ AY+QARFEFYR R+Q
Sbjct: 120 LVENSLEERFDWSHIQQLGKPLDGESVVQRTMYLLKTDK-MDMITAYNQARFEFYRFRIQ 178

Query: 181 QEIHEQVAQEEAEMFGSVFGSSSIEYGLEKEQKVIETWKKKAIQQTELMAARSSGP 236
           QE+ EQVAQEEAEMFGSVF  S I++G+EKEQKVI+ WKKKA Q+TEL+AAR + P
Sbjct: 179 QEVEEQVAQEEAEMFGSVFNQSMIDFGIEKEQKVIQQWKKKAEQETELVAARRANP 234

>TDEL0G02200 Chr7 complement(433032..433817) [786 bp, 261 aa] {ON}
           Anc_2.290 YIL093C
          Length = 261

 Score =  304 bits (778), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 147/236 (62%), Positives = 194/236 (82%), Gaps = 1/236 (0%)

Query: 1   MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL 60
           MK+QTNAVN+LERTSAYLR+GLL   PAWY+VVAS+PP   F REP++ NPSN K +A L
Sbjct: 1   MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL 60

Query: 61  SEYSETVGIKNGTYKTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSRPKV 120
            ++++    K G +KTR S  D+K++  KLY+APKL + ED+LRE+FY+QHPWELSRPKV
Sbjct: 61  KDHADEPNAK-GFFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSRPKV 119

Query: 121 LIENTGEESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRVRVQ 180
           L+EN  EE +DWS IQQL KPLDGESV+QRTL+LLK  +  +L  AYDQARFEFYR+R+Q
Sbjct: 120 LVENDAEEEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRLRMQ 179

Query: 181 QEIHEQVAQEEAEMFGSVFGSSSIEYGLEKEQKVIETWKKKAIQQTELMAARSSGP 236
           QE+ +QVAQEE+EMFGS++G S+I++G+++EQK I+ WK+KAI++T+L+AAR + P
Sbjct: 180 QEVEQQVAQEESEMFGSIYGPSAIDFGVQQEQKFIDIWKQKAIEETDLLAARRANP 235

>KAFR0J01350 Chr10 (247931..248725) [795 bp, 264 aa] {ON} Anc_2.290
           YIL093C
          Length = 264

 Score =  302 bits (774), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 140/237 (59%), Positives = 182/237 (76%), Gaps = 2/237 (0%)

Query: 1   MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL 60
           MK+QTNA N+LERTSAYL+AGLL  APA+Y+V+A VPPS  F REPK+ NPS  ++    
Sbjct: 1   MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF 60

Query: 61  SEYSETVGIKNGTYKTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSRPKV 120
            E ++ V  + G YKTR + SDR  S ++LYKA +L Y ED LR+LFY QHPWELSRPK+
Sbjct: 61  RELTDKVNWR-GLYKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSRPKI 119

Query: 121 LIENT-GEESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRVRV 179
           +IEN     S DWS IQQLGKP+DGESVVQRTL+L+K KK   L + YDQARFEFY+VR+
Sbjct: 120 VIENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQVRM 179

Query: 180 QQEIHEQVAQEEAEMFGSVFGSSSIEYGLEKEQKVIETWKKKAIQQTELMAARSSGP 236
           Q++  EQ+A EEA MFGS+FG +++EYG+++EQ VI  WK++AI++TEL+ A+ + P
Sbjct: 180 QRDSEEQIATEEAAMFGSIFGPTALEYGIQREQDVIAKWKQRAIRETELLDAKRANP 236

>KNAG0A05410 Chr1 (798238..799038) [801 bp, 266 aa] {ON} Anc_2.290
           YIL093C
          Length = 266

 Score =  291 bits (744), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 138/236 (58%), Positives = 177/236 (75%)

Query: 1   MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL 60
           MK+QTNAVN+LERTSA+L +G++ K PAWYNVVA+ PP K F R+P   NPS  K   +L
Sbjct: 1   MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL 60

Query: 61  SEYSETVGIKNGTYKTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSRPKV 120
             + ++    +  YKTR S +D++VS N LY+ PKL Y ED+LR+LFY QHPWE SRP +
Sbjct: 61  KSFLDSKRNAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSRPMI 120

Query: 121 LIENTGEESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRVRVQ 180
           LIEN     +DWS IQQLGK LDGESVVQR L+LL+     +L  AYD+ARFEFYR+R+Q
Sbjct: 121 LIENNVTPKFDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRIRMQ 180

Query: 181 QEIHEQVAQEEAEMFGSVFGSSSIEYGLEKEQKVIETWKKKAIQQTELMAARSSGP 236
           QE+ EQ++QEEA M+GSV+  S+IE+GLEKE KVIETWK++ I++TE M AR + P
Sbjct: 181 QELEEQISQEEAAMYGSVYTQSAIEFGLEKEGKVIETWKRRVIKETEAMLARRASP 236

>TPHA0C03420 Chr3 complement(750353..751159) [807 bp, 268 aa] {ON}
           Anc_2.290 YIL093C
          Length = 268

 Score =  291 bits (744), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 149/239 (62%), Positives = 187/239 (78%), Gaps = 3/239 (1%)

Query: 1   MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL 60
           MK+Q NAVN+LERTS+YLR+GLLTK PAWYNVVA +PPSK F R PK TNPSNNK +  L
Sbjct: 1   MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL 60

Query: 61  SEYSE-TVGIKNGTY--KTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSR 117
               E  V  +NGT+  K+R +  D+K S   +YK  KL+Y ED+LRE+FY QHPWELSR
Sbjct: 61  RIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELSR 120

Query: 118 PKVLIENTGEESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRV 177
           PK+++EN G+E+YDWS IQQLGK LDGE+VVQR +YL+K+K  +       +AR+EFYRV
Sbjct: 121 PKIVVENNGDETYDWSHIQQLGKALDGENVVQRAMYLMKKKLIMIFQKHTIKARYEFYRV 180

Query: 178 RVQQEIHEQVAQEEAEMFGSVFGSSSIEYGLEKEQKVIETWKKKAIQQTELMAARSSGP 236
           R+Q EI EQVAQEEAEMFGSVFG S+IE+G+++EQKVI+ WK+KAI +TELM A+ + P
Sbjct: 181 RMQSEIEEQVAQEEAEMFGSVFGPSTIEFGMDQEQKVIDVWKRKAIAETELMEAKRTNP 239

>CAGL0D04158g Chr4 complement(410309..411127) [819 bp, 272 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093c RSM25
          Length = 272

 Score =  276 bits (705), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 139/232 (59%), Positives = 179/232 (77%)

Query: 1   MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL 60
           MK+QTNAVN+LERTSAYLR G++ + PAWYNVVAS+PP   F REP   NPS +K ++ L
Sbjct: 1   MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL 60

Query: 61  SEYSETVGIKNGTYKTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSRPKV 120
            +       +NG YKTR +  +RKV+  ++YK PKL Y EDK+R LFY+QHPWEL+RPK+
Sbjct: 61  KDPDLESVNRNGLYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELARPKI 120

Query: 121 LIENTGEESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRVRVQ 180
           + EN    + DW  + QLG+PLDGE+VVQRTLYLLK K+Q  + +AYDQAR EFYR+R+Q
Sbjct: 121 VSENEINTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRLRMQ 180

Query: 181 QEIHEQVAQEEAEMFGSVFGSSSIEYGLEKEQKVIETWKKKAIQQTELMAAR 232
           QE+ EQVA EEAEMFGSVFG S+IE+G+ KEQ+VIE WK+ A  Q+EL++A+
Sbjct: 181 QELEEQVAAEEAEMFGSVFGPSTIEHGVTKEQQVIEKWKRDAELQSELLSAK 232

>ADL211C Chr4 complement(333418..334095) [678 bp, 225 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL093C
           (RSM25)
          Length = 225

 Score =  242 bits (617), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 141/190 (74%), Gaps = 2/190 (1%)

Query: 1   MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL 60
           MK+QTNAVN+L+RTS YL+AGLL K PAWYNVVA +PP   FAREPK+ +P + K    L
Sbjct: 1   MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL 60

Query: 61  SEYSETVGIKNGTYKTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSRPKV 120
              ++ +     TYKTR   SDR+ +   ++K  KL + EDKLR LF+QQHPWELSRPKV
Sbjct: 61  DIMTDRLNRNTETYKTRAGSSDRQTA--AVHKPSKLRFIEDKLRSLFFQQHPWELSRPKV 118

Query: 121 LIENTGEESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRVRVQ 180
           L+EN G E YDWS + QLGKPLDGESVVQRTLYLLK      ++ AYDQARFEFYR+R+Q
Sbjct: 119 LVENMGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYRLRMQ 178

Query: 181 QEIHEQVAQE 190
           QE+ EQ+A E
Sbjct: 179 QELEEQIAYE 188

>NCAS0B02500 Chr2 complement(416748..417758) [1011 bp, 336 aa] {ON} 
          Length = 336

 Score = 32.7 bits (73), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 3/57 (5%)

Query: 73  TYKTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQH-PWELSRPKV--LIENTG 126
           TY +    +D +  FN L+  P +      +R++FY ++  W LS P +  L E TG
Sbjct: 86  TYASNLGWTDVQAEFNHLHVHPSITGLSPGVRQIFYAKYCAWFLSWPLLVFLTEMTG 142

>NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {ON}
           Anc_1.111 YNL249C
          Length = 549

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 7/59 (11%)

Query: 94  PKLNYAEDKLRELFYQQ-HPWELSRPKVLIENTGEESYDWSTIQQLGKP------LDGE 145
           PKL+   + ++E FY+  H  E+    V I  T  + YDW+T+    KP      +DGE
Sbjct: 161 PKLSRLINLIKEGFYETPHILEVYDLHVYIAQTLAQKYDWNTVHLQNKPNVNGIGIDGE 219

>KLTH0H02662g Chr8 complement(233610..234716) [1107 bp, 368 aa] {ON}
           weakly similar to uniprot|P42933 Saccharomyces
           cerevisiae YMR191W SPG5 Protein required for survival at
           high temperature during stationary phase not required
           for growth on nonfermentable carbon sources
          Length = 368

 Score = 30.0 bits (66), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 28/69 (40%), Gaps = 12/69 (17%)

Query: 38  PSKSFAREPKITNPSNNKNIASLSEYSETVGIKNGTYKTRQSGSDRKV------------ 85
           P KS  R P  T PS      S   +++T  +  GT   +  G  R V            
Sbjct: 39  PQKSLVRIPVSTRPSAGFRNGSRYIHTQTQNVARGTGNAQSVGYARSVQGGARGTRPVLS 98

Query: 86  SFNKLYKAP 94
           SFN +Y+AP
Sbjct: 99  SFNGMYRAP 107

>KNAG0B01050 Chr2 complement(189006..191129) [2124 bp, 707 aa] {ON}
           Anc_3.442 YGR099W
          Length = 707

 Score = 30.0 bits (66), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 3/61 (4%)

Query: 162 TLVNAYDQARFEFYRVRVQQEIHEQVAQEEAEMFGSVFGSSSIEYGLEKEQKVIETWKKK 221
           TL N++D+  FE +R+     I   V Q+ A+MF  +F S   E  L++   ++ +    
Sbjct: 503 TLNNSFDEKDFEQWRINALVSIAVVVPQKIADMFTILFNS---ELSLQQRMAILSSIGMA 559

Query: 222 A 222
           A
Sbjct: 560 A 560

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.127    0.352 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,297,973
Number of extensions: 1075039
Number of successful extensions: 3139
Number of sequences better than 10.0: 47
Number of HSP's gapped: 3178
Number of HSP's successfully gapped: 47
Length of query: 260
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 153
Effective length of database: 41,212,137
Effective search space: 6305456961
Effective search space used: 6305456961
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 64 (29.3 bits)