Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E07568g2.291ON72723802e-49
NDAI0G006902.291ON72723301e-41
Smik_14.3062.291ON72723282e-41
YNL024C-A (KSH1)2.291ON72723282e-41
Cgla_YGOB_Anc_2.2912.291ON72723263e-41
Suva_14.3222.291ON72723221e-40
NCAS0G037602.291ON72723222e-40
KLLA0E08251g2.291ON72723222e-40
KNAG0H019702.291ON72723142e-39
TBLA0B069702.291ON72723134e-39
TPHA0C034302.291ON72723056e-38
Kpol_1003.412.291ON72723049e-38
ADL210W2.291ON72723013e-37
Skud_14.3042.291ON72722864e-35
Kwal_YGOB_Anc_2.2912.291ON72722804e-34
ZYRO0A01980g2.291ON72722805e-34
TDEL0G022102.291ON72722795e-34
KAFR0H032802.291ON72722771e-33
KLTH0G10472g2.291ON72722761e-33
Ecym_33302.291ON72722571e-30
TBLA0D056601.221ON75034640.66
TDEL0H010301.221ON73634630.82
NDAI0G061901.221ON75733611.7
SAKL0F09702g7.283ON67638575.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E07568g
         (72 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E07568g Chr5 complement(613454..613672) [219 bp, 72 aa] {ON...   150   2e-49
NDAI0G00690 Chr7 (151360..151578) [219 bp, 72 aa] {ON} Anc_2.291...   131   1e-41
Smik_14.306 Chr14 complement(548999..549214) [216 bp, 72 aa] {ON...   130   2e-41
YNL024C-A Chr14 complement(586602..586820) [219 bp, 72 aa] {ON} ...   130   2e-41
Cgla_YGOB_Anc_2.291 Chr13 complement(701547..701765) [219 bp, 72...   130   3e-41
Suva_14.322 Chr14 complement(569440..569655) [216 bp, 72 aa] {ON...   128   1e-40
NCAS0G03760 Chr7 complement(693645..693863) [219 bp, 72 aa] {ON}...   128   2e-40
KLLA0E08251g Chr5 complement(744523..744741) [219 bp, 72 aa] {ON...   128   2e-40
KNAG0H01970 Chr8 complement(347994..348212) [219 bp, 72 aa] {ON}...   125   2e-39
TBLA0B06970 Chr2 (1648736..1648954) [219 bp, 72 aa] {ON} Anc_2.2...   125   4e-39
TPHA0C03430 Chr3 (751723..751941) [219 bp, 72 aa] {ON} Anc_2.291...   122   6e-38
Kpol_1003.41 s1003 (99502..99720) [219 bp, 72 aa] {ON} (99502..9...   121   9e-38
ADL210W Chr4 (334320..334538) [219 bp, 72 aa] {ON} Syntenic homo...   120   3e-37
Skud_14.304 Chr14 complement(557335..557550) [216 bp, 72 aa] {ON...   114   4e-35
Kwal_YGOB_Anc_2.291 s27 complement(830525..830743) [219 bp, 72 a...   112   4e-34
ZYRO0A01980g Chr1 (164037..164255) [219 bp, 72 aa] {ON} highly s...   112   5e-34
TDEL0G02210 Chr7 (434303..434521) [219 bp, 72 aa] {ON} Anc_2.291...   112   5e-34
KAFR0H03280 Chr8 complement(626054..626272) [219 bp, 72 aa] {ON}...   111   1e-33
KLTH0G10472g Chr7 (885262..885480) [219 bp, 72 aa] {ON} highly s...   110   1e-33
Ecym_3330 Chr3 (631388..631606) [219 bp, 72 aa] {ON} similar to ...   103   1e-30
TBLA0D05660 Chr4 complement(1387319..1389571) [2253 bp, 750 aa] ...    29   0.66 
TDEL0H01030 Chr8 (177680..179890) [2211 bp, 736 aa] {ON} Anc_1.2...    29   0.82 
NDAI0G06190 Chr7 complement(1535627..1537900) [2274 bp, 757 aa] ...    28   1.7  
SAKL0F09702g Chr6 complement(743532..745562) [2031 bp, 676 aa] {...    27   5.4  

>SAKL0E07568g Chr5 complement(613454..613672) [219 bp, 72 aa] {ON}
          similar to uniprot|Q8TGJ3 Saccharomyces cerevisiae
          YNL024C-A Identified by gene-trapping, microarray-based
          expression analysis, and genome-wide homology searching
          Length = 72

 Score =  150 bits (380), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 72/72 (100%), Positives = 72/72 (100%)

Query: 1  MSALFNFRSLLQVILLLICSCTYIHTQWPSLLDRYKNHGMLNVFWKFARVGERASPYVSL 60
          MSALFNFRSLLQVILLLICSCTYIHTQWPSLLDRYKNHGMLNVFWKFARVGERASPYVSL
Sbjct: 1  MSALFNFRSLLQVILLLICSCTYIHTQWPSLLDRYKNHGMLNVFWKFARVGERASPYVSL 60

Query: 61 ACICMAISQFKS 72
          ACICMAISQFKS
Sbjct: 61 ACICMAISQFKS 72

>NDAI0G00690 Chr7 (151360..151578) [219 bp, 72 aa] {ON} Anc_2.291
          YNL024C-A
          Length = 72

 Score =  131 bits (330), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 66/72 (91%)

Query: 1  MSALFNFRSLLQVILLLICSCTYIHTQWPSLLDRYKNHGMLNVFWKFARVGERASPYVSL 60
          MSALFNFRSLLQVILLLICSCTY+H+QWPS+LDRYK+HG L  FWK AR+GERASPYVSL
Sbjct: 1  MSALFNFRSLLQVILLLICSCTYVHSQWPSILDRYKDHGALGAFWKMARIGERASPYVSL 60

Query: 61 ACICMAISQFKS 72
          ACI MAI+QF S
Sbjct: 61 ACIIMAINQFNS 72

>Smik_14.306 Chr14 complement(548999..549214) [216 bp, 72 aa] {ON}
          YNL024C-A (REAL)
          Length = 72

 Score =  130 bits (328), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 65/72 (90%)

Query: 1  MSALFNFRSLLQVILLLICSCTYIHTQWPSLLDRYKNHGMLNVFWKFARVGERASPYVSL 60
          MSALFNFRSLLQVILLLICSC+Y+H QWPSLLDRYKNH +L  FWK ARVGERASPYVSL
Sbjct: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL 60

Query: 61 ACICMAISQFKS 72
          ACI MAISQF S
Sbjct: 61 ACILMAISQFNS 72

>YNL024C-A Chr14 complement(586602..586820) [219 bp, 72 aa] {ON}
          KSH1Essential protein suggested to function early in
          the secretory pathway; inviability is suppressed by
          overexpression of Golgi protein Tvp23p; ortholog of
          human Kish
          Length = 72

 Score =  130 bits (328), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 65/72 (90%)

Query: 1  MSALFNFRSLLQVILLLICSCTYIHTQWPSLLDRYKNHGMLNVFWKFARVGERASPYVSL 60
          MSALFNFRSLLQVILLLICSC+Y+H QWPSLLDRYKNH +L  FWK ARVGERASPYVSL
Sbjct: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL 60

Query: 61 ACICMAISQFKS 72
          ACI MAISQF S
Sbjct: 61 ACILMAISQFNS 72

>Cgla_YGOB_Anc_2.291 Chr13 complement(701547..701765) [219 bp, 72
          aa] {ON} ANNOTATED BY YGOB -
          Length = 72

 Score =  130 bits (326), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 61/72 (84%), Positives = 65/72 (90%)

Query: 1  MSALFNFRSLLQVILLLICSCTYIHTQWPSLLDRYKNHGMLNVFWKFARVGERASPYVSL 60
          MSALFNF SLLQVILLLICSCTYIHTQWPSLLDRYKNH +L  FWK AR+GERASPYVS+
Sbjct: 1  MSALFNFASLLQVILLLICSCTYIHTQWPSLLDRYKNHDILGAFWKMARIGERASPYVSV 60

Query: 61 ACICMAISQFKS 72
          ACI MAI+QF S
Sbjct: 61 ACILMAINQFNS 72

>Suva_14.322 Chr14 complement(569440..569655) [216 bp, 72 aa] {ON}
          YNL024C-A (REAL)
          Length = 72

 Score =  128 bits (322), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 64/72 (88%)

Query: 1  MSALFNFRSLLQVILLLICSCTYIHTQWPSLLDRYKNHGMLNVFWKFARVGERASPYVSL 60
          MSALFNFRSLLQVILLLICSC+Y+H QWPSLLDRYKNH +   FWK AR+GERASPYVSL
Sbjct: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVFGAFWKMARIGERASPYVSL 60

Query: 61 ACICMAISQFKS 72
          ACI MAISQF S
Sbjct: 61 ACILMAISQFNS 72

>NCAS0G03760 Chr7 complement(693645..693863) [219 bp, 72 aa] {ON}
          Anc_2.291 YNL024C-A
          Length = 72

 Score =  128 bits (322), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 64/72 (88%)

Query: 1  MSALFNFRSLLQVILLLICSCTYIHTQWPSLLDRYKNHGMLNVFWKFARVGERASPYVSL 60
          MSALFNF SLLQVILLLICSCTY+HTQWPSLLDRYK+H  L  FWK AR+GERASPYVSL
Sbjct: 1  MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKDHEALGAFWKMARIGERASPYVSL 60

Query: 61 ACICMAISQFKS 72
          ACI MAI+QF S
Sbjct: 61 ACIIMAINQFNS 72

>KLLA0E08251g Chr5 complement(744523..744741) [219 bp, 72 aa] {ON}
          highly similar to uniprot|Q8TGJ3 Saccharomyces
          cerevisiae YNL024C-A Identified by gene-trapping
          microarray-based expression analysis and genome-wide
          homology searching
          Length = 72

 Score =  128 bits (322), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 65/72 (90%)

Query: 1  MSALFNFRSLLQVILLLICSCTYIHTQWPSLLDRYKNHGMLNVFWKFARVGERASPYVSL 60
          MSALFNF+SLLQVILL ICSCTYIH Q PSLLDRYK+ G+L VFWKFAR+GERASPYVSL
Sbjct: 1  MSALFNFKSLLQVILLFICSCTYIHAQRPSLLDRYKDSGILGVFWKFARIGERASPYVSL 60

Query: 61 ACICMAISQFKS 72
          ACI MA+SQF S
Sbjct: 61 ACIAMAVSQFNS 72

>KNAG0H01970 Chr8 complement(347994..348212) [219 bp, 72 aa] {ON}
          Anc_2.291 YNL024C-A
          Length = 72

 Score =  125 bits (314), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 59/72 (81%), Positives = 63/72 (87%)

Query: 1  MSALFNFRSLLQVILLLICSCTYIHTQWPSLLDRYKNHGMLNVFWKFARVGERASPYVSL 60
          MSALFNF SLLQVILLLICSCTY+HTQWPSLLDRYK H  L  FWK AR+GERASPYVSL
Sbjct: 1  MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKEHEALGAFWKMARLGERASPYVSL 60

Query: 61 ACICMAISQFKS 72
          ACI MA++QF S
Sbjct: 61 ACILMALNQFMS 72

>TBLA0B06970 Chr2 (1648736..1648954) [219 bp, 72 aa] {ON}
          Anc_2.291 YNL024C-A
          Length = 72

 Score =  125 bits (313), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 59/72 (81%), Positives = 62/72 (86%)

Query: 1  MSALFNFRSLLQVILLLICSCTYIHTQWPSLLDRYKNHGMLNVFWKFARVGERASPYVSL 60
          MSALF+FRS+LQVILLLICS TYIH QWPSLLDRYKNH  L  FWK AR+GERASPYVSL
Sbjct: 1  MSALFSFRSMLQVILLLICSSTYIHCQWPSLLDRYKNHSTLGAFWKMARIGERASPYVSL 60

Query: 61 ACICMAISQFKS 72
          ACI MAISQF  
Sbjct: 61 ACIAMAISQFNE 72

>TPHA0C03430 Chr3 (751723..751941) [219 bp, 72 aa] {ON} Anc_2.291
          YNL024C-A
          Length = 72

 Score =  122 bits (305), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 64/72 (88%)

Query: 1  MSALFNFRSLLQVILLLICSCTYIHTQWPSLLDRYKNHGMLNVFWKFARVGERASPYVSL 60
          MSALFNF SLLQVILLLICS TYIH+QWPSL DRYK+ G+L+ FWK +R+GERASPYVS+
Sbjct: 1  MSALFNFSSLLQVILLLICSSTYIHSQWPSLFDRYKDTGVLSTFWKLSRIGERASPYVSI 60

Query: 61 ACICMAISQFKS 72
          ACI MA++QF S
Sbjct: 61 ACIIMAVNQFNS 72

>Kpol_1003.41 s1003 (99502..99720) [219 bp, 72 aa] {ON}
          (99502..99720) [219 nt, 73 aa]
          Length = 72

 Score =  121 bits (304), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 56/72 (77%), Positives = 62/72 (86%)

Query: 1  MSALFNFRSLLQVILLLICSCTYIHTQWPSLLDRYKNHGMLNVFWKFARVGERASPYVSL 60
          MSALFNF SLLQVILLLICS TYIH+QWPS LDRYK+  +L  FWK AR+GERASPYVSL
Sbjct: 1  MSALFNFTSLLQVILLLICSSTYIHSQWPSFLDRYKDQSVLGAFWKLARIGERASPYVSL 60

Query: 61 ACICMAISQFKS 72
          ACI MA++QF S
Sbjct: 61 ACIIMAVNQFNS 72

>ADL210W Chr4 (334320..334538) [219 bp, 72 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL024CX; YNL024CX
          was overlooked in Saccharomyces cerevisiae
          Length = 72

 Score =  120 bits (301), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 62/72 (86%)

Query: 1  MSALFNFRSLLQVILLLICSCTYIHTQWPSLLDRYKNHGMLNVFWKFARVGERASPYVSL 60
          MSALF F +LLQVILLLICS TY+H QWPSLL+RYK H +L +FWKFAR+GERASPYVS+
Sbjct: 1  MSALFKFSALLQVILLLICSSTYVHAQWPSLLERYKEHSVLGIFWKFARIGERASPYVSI 60

Query: 61 ACICMAISQFKS 72
          ACI MAI+Q  S
Sbjct: 61 ACIAMAINQINS 72

>Skud_14.304 Chr14 complement(557335..557550) [216 bp, 72 aa] {ON}
          YNL024C-A (REAL)
          Length = 72

 Score =  114 bits (286), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 65/72 (90%)

Query: 1  MSALFNFRSLLQVILLLICSCTYIHTQWPSLLDRYKNHGMLNVFWKFARVGERASPYVSL 60
          MSALFNFRSLLQV+LLLICSC+Y+H QWPSLLDRYKNH +L  FWK AR+GERASPYVSL
Sbjct: 1  MSALFNFRSLLQVLLLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARIGERASPYVSL 60

Query: 61 ACICMAISQFKS 72
          ACI MAISQF S
Sbjct: 61 ACILMAISQFNS 72

>Kwal_YGOB_Anc_2.291 s27 complement(830525..830743) [219 bp, 72
          aa] {ON} ANNOTATED BY YGOB -
          Length = 72

 Score =  112 bits (280), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 67/72 (93%)

Query: 1  MSALFNFRSLLQVILLLICSCTYIHTQWPSLLDRYKNHGMLNVFWKFARVGERASPYVSL 60
          MSALFNF++LLQV+LLLICSCTYIH+QWPSLLDRYK+H ML  FWK AR+GERASPYVSL
Sbjct: 1  MSALFNFQALLQVLLLLICSCTYIHSQWPSLLDRYKDHSMLGAFWKCARIGERASPYVSL 60

Query: 61 ACICMAISQFKS 72
          ACI MA++QF++
Sbjct: 61 ACIIMAVNQFQT 72

>ZYRO0A01980g Chr1 (164037..164255) [219 bp, 72 aa] {ON} highly
          similar to uniprot|Q8TGJ3 Saccharomyces cerevisiae
          YNL024C-A Identified by gene-trapping microarray-based
          expression analysis and genome-wide homology searching
          Length = 72

 Score =  112 bits (280), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 59/72 (81%), Positives = 65/72 (90%)

Query: 1  MSALFNFRSLLQVILLLICSCTYIHTQWPSLLDRYKNHGMLNVFWKFARVGERASPYVSL 60
          MSALFNF+SLLQVILLL+CSCTY+H QWPSLLDRYK HG+L+ FWK ARVGERASPYVSL
Sbjct: 1  MSALFNFKSLLQVILLLLCSCTYVHAQWPSLLDRYKGHGVLSAFWKMARVGERASPYVSL 60

Query: 61 ACICMAISQFKS 72
          ACI MA+SQ  S
Sbjct: 61 ACILMALSQLNS 72

>TDEL0G02210 Chr7 (434303..434521) [219 bp, 72 aa] {ON} Anc_2.291
          YNL024C-A
          Length = 72

 Score =  112 bits (279), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 58/72 (80%), Positives = 65/72 (90%)

Query: 1  MSALFNFRSLLQVILLLICSCTYIHTQWPSLLDRYKNHGMLNVFWKFARVGERASPYVSL 60
          MSALFNF+SLLQVILLL+CSCTY+H QWPSLLDRYK+HG+   FWK ARVGERASPYVS+
Sbjct: 1  MSALFNFKSLLQVILLLLCSCTYVHAQWPSLLDRYKDHGVFGAFWKMARVGERASPYVSV 60

Query: 61 ACICMAISQFKS 72
          ACI MAI+QF S
Sbjct: 61 ACILMAINQFNS 72

>KAFR0H03280 Chr8 complement(626054..626272) [219 bp, 72 aa] {ON}
          Anc_2.291 YNL024C-A
          Length = 72

 Score =  111 bits (277), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 58/72 (80%), Positives = 64/72 (88%)

Query: 1  MSALFNFRSLLQVILLLICSCTYIHTQWPSLLDRYKNHGMLNVFWKFARVGERASPYVSL 60
          MSALFNF SLLQV+LLLICSCTYIHTQWPSLL+RYK+H  L +FWK ARVGER SPYVSL
Sbjct: 1  MSALFNFSSLLQVLLLLICSCTYIHTQWPSLLERYKDHEALGIFWKMARVGERGSPYVSL 60

Query: 61 ACICMAISQFKS 72
          ACI MA++QF S
Sbjct: 61 ACILMAVNQFNS 72

>KLTH0G10472g Chr7 (885262..885480) [219 bp, 72 aa] {ON} highly
          similar to uniprot|Q8TGJ3 Saccharomyces cerevisiae
          YNL024C-A Identified by gene-trapping microarray-based
          expression analysis and genome-wide homology searching
          Length = 72

 Score =  110 bits (276), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 56/72 (77%), Positives = 66/72 (91%)

Query: 1  MSALFNFRSLLQVILLLICSCTYIHTQWPSLLDRYKNHGMLNVFWKFARVGERASPYVSL 60
          MSALFNF++LLQV+LLLICSCTYIH+QWPSLLDRYK H ML  FWK AR+GERASPYVS+
Sbjct: 1  MSALFNFQALLQVLLLLICSCTYIHSQWPSLLDRYKEHSMLGAFWKCARIGERASPYVSI 60

Query: 61 ACICMAISQFKS 72
          ACI MA++QF++
Sbjct: 61 ACIIMAVNQFQT 72

>Ecym_3330 Chr3 (631388..631606) [219 bp, 72 aa] {ON} similar to
          Ashbya gossypii ADL210W
          Length = 72

 Score =  103 bits (257), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 63/72 (87%)

Query: 1  MSALFNFRSLLQVILLLICSCTYIHTQWPSLLDRYKNHGMLNVFWKFARVGERASPYVSL 60
          MSALF F SLLQ+ILLLICS TY+H QWPSLL+RYK HG+L++FWKFAR+GERASPYVSL
Sbjct: 1  MSALFKFSSLLQIILLLICSSTYVHCQWPSLLERYKQHGVLSIFWKFARIGERASPYVSL 60

Query: 61 ACICMAISQFKS 72
          ACI M  +QF S
Sbjct: 61 ACIVMVANQFNS 72

>TBLA0D05660 Chr4 complement(1387319..1389571) [2253 bp, 750 aa]
           {ON} Anc_1.221 YJL132W
          Length = 750

 Score = 29.3 bits (64), Expect = 0.66,   Method: Composition-based stats.
 Identities = 12/34 (35%), Positives = 19/34 (55%)

Query: 11  LQVILLLICSCTYIHTQWPSLLDRYKNHGMLNVF 44
           LQ  L  + +     T W SL+D Y++HG++ V 
Sbjct: 107 LQAFLTGVLTHQISDTSWHSLVDNYRDHGLIKVL 140

>TDEL0H01030 Chr8 (177680..179890) [2211 bp, 736 aa] {ON} Anc_1.221
           YJL132W
          Length = 736

 Score = 28.9 bits (63), Expect = 0.82,   Method: Composition-based stats.
 Identities = 12/34 (35%), Positives = 20/34 (58%)

Query: 11  LQVILLLICSCTYIHTQWPSLLDRYKNHGMLNVF 44
           LQ  L  + S   + + W SL+D +++HG+L V 
Sbjct: 104 LQAFLTGVFSHQIVDSSWHSLVDGFRSHGLLRVL 137

>NDAI0G06190 Chr7 complement(1535627..1537900) [2274 bp, 757 aa]
           {ON} Anc_1.221 YJL132W
          Length = 757

 Score = 28.1 bits (61), Expect = 1.7,   Method: Composition-based stats.
 Identities = 13/33 (39%), Positives = 20/33 (60%)

Query: 11  LQVILLLICSCTYIHTQWPSLLDRYKNHGMLNV 43
           L+ +LL +     + T W SL+  +KNHG+L V
Sbjct: 110 LKSLLLGVFIHQIVDTSWHSLVPDWKNHGLLKV 142

>SAKL0F09702g Chr6 complement(743532..745562) [2031 bp, 676 aa] {ON}
           similar to uniprot|Q12027 Saccharomyces cerevisiae
           YDL176W Hypothetical ORF
          Length = 676

 Score = 26.6 bits (57), Expect = 5.4,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 2/38 (5%)

Query: 3   ALFNFRSLLQVILLLICSCTYIHTQWPSLLDRYK--NH 38
           AL NF S  ++ ++  C C    T    L+DRYK  NH
Sbjct: 519 ALSNFSSFKKLFMVNDCLCLIFDTHGVLLVDRYKISNH 556

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.333    0.139    0.461 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,504,782
Number of extensions: 192700
Number of successful extensions: 748
Number of sequences better than 10.0: 24
Number of HSP's gapped: 753
Number of HSP's successfully gapped: 24
Length of query: 72
Length of database: 53,481,399
Length adjustment: 45
Effective length of query: 27
Effective length of database: 48,321,429
Effective search space: 1304678583
Effective search space used: 1304678583
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.6 bits)
S2: 59 (27.3 bits)