Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E07546g2.292ON71871836000.0
KLTH0G10494g2.292ON74774323630.0
Skud_9.822.292ON72272723430.0
Suva_9.1082.292ON72272723290.0
KLLA0E08229g2.292ON70470623270.0
Kwal_27.115032.292ON72773823170.0
Smik_9.882.292ON72473323160.0
YIL091C (UTP25)2.292ON72171723080.0
NCAS0B062302.292ON72373023020.0
Ecym_33312.292ON70871822640.0
KAFR0J013402.292ON72872222660.0
NDAI0B035302.292ON73973922500.0
KNAG0A054002.292ON72172522230.0
TBLA0B059702.292ON71964821960.0
TDEL0G022202.292ON71071621860.0
Kpol_1039.462.292ON70471321370.0
ZYRO0A02002g2.292ON70970521350.0
CAGL0D04180g2.292ON70070621330.0
ADL209C2.292ON70470221170.0
TPHA0D015202.292ON71673320940.0
Suva_2.4098.469ON589132810.43
ZYRO0G15708g8.758ON147076790.88
TDEL0B035208.758ON146276781.0
CAGL0H01243g5.301ON109482742.8
NCAS0C034308.295ON493469743.8
KLLA0A06842gna 1ON65671724.4
TDEL0B050502.143ON93483725.0
KNAG0J023503.309ON100548725.3
CAGL0M11616g8.295ON488059709.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E07546g
         (718 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} simila...  1391   0.0  
KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {...   914   0.0  
Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}...   907   0.0  
Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON...   901   0.0  
KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} simila...   900   0.0  
Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091...   897   0.0  
Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}...   896   0.0  
YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}  ...   893   0.0  
NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON} Anc_2...   891   0.0  
Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}...   876   0.0  
KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2....   877   0.0  
NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.2...   871   0.0  
KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.2...   860   0.0  
TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa] ...   850   0.0  
TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {O...   846   0.0  
Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa] ...   827   0.0  
ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {...   827   0.0  
CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {...   826   0.0  
ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON} S...   820   0.0  
TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.2...   811   0.0  
Suva_2.409 Chr2 complement(727948..729717) [1770 bp, 589 aa] {ON...    36   0.43 
ZYRO0G15708g Chr7 complement(1277152..1281564) [4413 bp, 1470 aa...    35   0.88 
TDEL0B03520 Chr2 complement(626658..631046) [4389 bp, 1462 aa] {...    35   1.0  
CAGL0H01243g Chr8 (117461..120745) [3285 bp, 1094 aa] {ON} highl...    33   2.8  
NCAS0C03430 Chr3 (672540..687344) [14805 bp, 4934 aa] {ON} Anc_8...    33   3.8  
KLLA0A06842g Chr1 complement(618848..620818) [1971 bp, 656 aa] {...    32   4.4  
TDEL0B05050 Chr2 (882443..885247) [2805 bp, 934 aa] {ON} Anc_2.1...    32   5.0  
KNAG0J02350 Chr10 (440853..443870) [3018 bp, 1005 aa] {ON} Anc_3...    32   5.3  
CAGL0M11616g Chr13 complement(1143091..1157733) [14643 bp, 4880 ...    32   9.5  

>SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 718

 Score = 1391 bits (3600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 680/718 (94%), Positives = 680/718 (94%)

Query: 1   MNNVSKRSNRDESHGGYKKAKKTGRKELRTITRANARHANESKDDFENEPDMXXXXXXLA 60
           MNNVSKRSNRDESHGGYKKAKKTGRKELRTITRANARHANESKDDFENEPDM      LA
Sbjct: 1   MNNVSKRSNRDESHGGYKKAKKTGRKELRTITRANARHANESKDDFENEPDMSSEEEELA 60

Query: 61  DNKPRSXXXXXXXXXTKKQKVYNALLTLLESEHPHKKSKKNREGGKEKQGNLQEGVETYS 120
           DNKPRS         TKKQKVYNALLTLLESEHPHKKSKKNREGGKEKQGNLQEGVETYS
Sbjct: 61  DNKPRSDEEEEEDIETKKQKVYNALLTLLESEHPHKKSKKNREGGKEKQGNLQEGVETYS 120

Query: 121 DEDEEEAIENALVETNDDEDDVGSDINGDEDDEDKADSFELHFNNVSELQATKLASAFRD 180
           DEDEEEAIENALVETNDDEDDVGSDINGDEDDEDKADSFELHFNNVSELQATKLASAFRD
Sbjct: 121 DEDEEEAIENALVETNDDEDDVGSDINGDEDDEDKADSFELHFNNVSELQATKLASAFRD 180

Query: 181 KKIRYKSVKVPVNEDEFFIYSRPTVEGEDGSSVVAPSCKKSLHSYFIKQKLKIQNNLLDD 240
           KKIRYKSVKVPVNEDEFFIYSRPTVEGEDGSSVVAPSCKKSLHSYFIKQKLKIQNNLLDD
Sbjct: 181 KKIRYKSVKVPVNEDEFFIYSRPTVEGEDGSSVVAPSCKKSLHSYFIKQKLKIQNNLLDD 240

Query: 241 KKEALAPLQKNLVDPMFQYQDLLXXXXXXXXXXXXXDLYALHVLNHVYKTRDRILRNSQK 300
           KKEALAPLQKNLVDPMFQYQDLL             DLYALHVLNHVYKTRDRILRNSQK
Sbjct: 241 KKEALAPLQKNLVDPMFQYQDLLYEYRSYEQEEEYRDLYALHVLNHVYKTRDRILRNSQK 300

Query: 301 LQDNSDQELLDQGFTRPKVLIVVPTRDVAYQIVTKIIEKSGLDQVDKRGKFQDQFFDASL 360
           LQDNSDQELLDQGFTRPKVLIVVPTRDVAYQIVTKIIEKSGLDQVDKRGKFQDQFFDASL
Sbjct: 301 LQDNSDQELLDQGFTRPKVLIVVPTRDVAYQIVTKIIEKSGLDQVDKRGKFQDQFFDASL 360

Query: 361 XXXXXXXXXXHIFKGNTNDFFVLGAKFTRKTLKLYSNFYQSDVIFCSPLGIQLILENTDK 420
                     HIFKGNTNDFFVLGAKFTRKTLKLYSNFYQSDVIFCSPLGIQLILENTDK
Sbjct: 361 PPSSKPKSFKHIFKGNTNDFFVLGAKFTRKTLKLYSNFYQSDVIFCSPLGIQLILENTDK 420

Query: 421 KKRQDDFLSSIELMVIDQLHSIEYQNLSHITTIFQHINKIPQQQHDADFSRIRMWYINEQ 480
           KKRQDDFLSSIELMVIDQLHSIEYQNLSHITTIFQHINKIPQQQHDADFSRIRMWYINEQ
Sbjct: 421 KKRQDDFLSSIELMVIDQLHSIEYQNLSHITTIFQHINKIPQQQHDADFSRIRMWYINEQ 480

Query: 481 ATLFRQTMVFTKYASPFANSLINGKCRNHAGRWKNHNIVLPEKSSINQLGLKVRQIFQRF 540
           ATLFRQTMVFTKYASPFANSLINGKCRNHAGRWKNHNIVLPEKSSINQLGLKVRQIFQRF
Sbjct: 481 ATLFRQTMVFTKYASPFANSLINGKCRNHAGRWKNHNIVLPEKSSINQLGLKVRQIFQRF 540

Query: 541 DLVGGSAMDEPDYRFKFFTSVIIASIIKSTGYEDGILLYIPDYTDYVRVRNHLREKTTLL 600
           DLVGGSAMDEPDYRFKFFTSVIIASIIKSTGYEDGILLYIPDYTDYVRVRNHLREKTTLL
Sbjct: 541 DLVGGSAMDEPDYRFKFFTSVIIASIIKSTGYEDGILLYIPDYTDYVRVRNHLREKTTLL 600

Query: 601 FGDINEYSEQKQLTSNRALFQQGKVKVLLYTERLHHFRRYEIKGVKSVIFYKPPTNPEFY 660
           FGDINEYSEQKQLTSNRALFQQGKVKVLLYTERLHHFRRYEIKGVKSVIFYKPPTNPEFY
Sbjct: 601 FGDINEYSEQKQLTSNRALFQQGKVKVLLYTERLHHFRRYEIKGVKSVIFYKPPTNPEFY 660

Query: 661 REVVRYIGKSAFLGSADLNISTVRCVYCKLDGLSLERVVGTKRAAVLTHGQNEIYEFK 718
           REVVRYIGKSAFLGSADLNISTVRCVYCKLDGLSLERVVGTKRAAVLTHGQNEIYEFK
Sbjct: 661 REVVRYIGKSAFLGSADLNISTVRCVYCKLDGLSLERVVGTKRAAVLTHGQNEIYEFK 718

>KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 747

 Score =  914 bits (2363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/743 (61%), Positives = 556/743 (74%), Gaps = 56/743 (7%)

Query: 19  KAKKTGRKELRTITRANA-------RHANESKDDFENEPDMXXXXXXLADNKPRSXXXXX 71
           ++ K+GRK+LRTI +A+          ANE  +  E E +       L  N+P       
Sbjct: 18  RSSKSGRKQLRTIRKASGPRRGLAEESANEENNGSETEAEDKLAAPEL--NEPAQDQRAG 75

Query: 72  XXXXTKKQKVYNALLTLLESEHPHKKSKKNREGGKEKQGNLQEGVETYSDEDEEE----- 126
                   + Y ALLTLL++EH     +K +   K+   +    V+   DE+E E     
Sbjct: 76  G-------EAYAALLTLLKAEHGGPARRKTKTDDKKTSADPTSNVK---DEEESESRDNE 125

Query: 127 ----------AIENALVETNDD------------EDDV---------GSDINGDEDDEDK 155
                     AIENAL++ +              +DD+          +++    ++EDK
Sbjct: 126 DEEEDEDEEAAIENALMDEHTSGDEDDEGDDGSHQDDINGVTREGGDATELAAGFEEEDK 185

Query: 156 ADSFELHFNNVSELQATKLASAFRDKKIRYKSVKVPVNEDEFFIYSRPTVEGEDGSSVVA 215
            D+ E+HFN+VSE     L +AF+ K++RY+S K+ V++++ FIYSRPT+  E  S+V A
Sbjct: 186 PDTLEIHFNSVSEKDTNALDAAFKAKEVRYRSCKLHVDKNQEFIYSRPTLVNEPASAVSA 245

Query: 216 PSCKKSLHSYFIKQKLKIQNNLLDDKKEALAPLQKNLVDPMFQYQDLLXXXXXXXXXXXX 275
           P   +SL+SYFIKQ+LKIQN+LLD  ++ L PLQK +VDPMFQYQDLL            
Sbjct: 246 PDGSQSLNSYFIKQRLKIQNDLLD-SQDKLTPLQKQIVDPMFQYQDLLYEYEDYDKETEY 304

Query: 276 XDLYALHVLNHVYKTRDRILRNSQKLQDNSDQELLDQGFTRPKVLIVVPTRDVAYQIVTK 335
            DLYALHVLNH+YKTRDRIL+N+Q+LQ+N DQELLDQGFTRPKVLIV PTRD AY I++K
Sbjct: 305 RDLYALHVLNHIYKTRDRILKNNQRLQENPDQELLDQGFTRPKVLIVAPTRDAAYDILSK 364

Query: 336 IIEKSGLDQVDKRGKFQDQFFDASLXXXXXXXXXXHIFKGNTNDFFVLGAKFTRKTLKLY 395
           II+KSGLDQVDK+ KF+DQFF  +L           +FKGNTNDFFVLGAKFTRKT+KLY
Sbjct: 365 IIQKSGLDQVDKKAKFKDQFFQEALPPSYKPKSFQQLFKGNTNDFFVLGAKFTRKTIKLY 424

Query: 396 SNFYQSDVIFCSPLGIQLILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNLSHITTIFQ 455
           SNFYQSD+I CSPLGIQLILENTDKKKRQDDFLSSIEL+V+DQLHSIE+QN+ H+T+IF+
Sbjct: 425 SNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIELLVVDQLHSIEFQNMLHLTSIFE 484

Query: 456 HINKIPQQQHDADFSRIRMWYINEQATLFRQTMVFTKYASPFANSLINGKCRNHAGRWKN 515
           HINKIPQQQHDADFSRI+MWYIN+QA LFRQT++FTK++SPFANSLINGKCRN+AGRWKN
Sbjct: 485 HINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSSPFANSLINGKCRNYAGRWKN 544

Query: 516 HNIVLPEKSSINQLGLKVRQIFQRFDLVGGSAMDEPDYRFKFFTSVIIASIIKSTGYEDG 575
           H ++ PE SS+ QLG++ R IFQRFDLVG S  +EPD RFK F SVI+ +I+KSTGYEDG
Sbjct: 545 HRVIFPENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRFKHFCSVIVPNIVKSTGYEDG 604

Query: 576 ILLYIPDYTDYVRVRNHLREKTTLLFGDINEYSEQKQLTSNRALFQQGKVKVLLYTERLH 635
           ILLYIPDYTD+VRVRN+LREKTT+LFGDINEYSEQ+QLTSNRA+FQQG+VKVLLYTERLH
Sbjct: 605 ILLYIPDYTDFVRVRNYLREKTTILFGDINEYSEQRQLTSNRAMFQQGRVKVLLYTERLH 664

Query: 636 HFRRYEIKGVKSVIFYKPPTNPEFYREVVRYIGKSAFLGSADLNISTVRCVYCKLDGLSL 695
           HFRRYEIKGVK+VIFYKPPTNPEF+ EV RY+GKSAFLG ADLNIS VRC++ KLDGLSL
Sbjct: 665 HFRRYEIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGLADLNISVVRCLFSKLDGLSL 724

Query: 696 ERVVGTKRAAVLTHGQNEIYEFK 718
           ER+VGT+RAAVLTHG NE YEFK
Sbjct: 725 ERIVGTERAAVLTHGPNETYEFK 747

>Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score =  907 bits (2343), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/727 (62%), Positives = 543/727 (74%), Gaps = 14/727 (1%)

Query: 1   MNNVSKRSNRDESHGGYKKAKKTGRKELRTITRANARHANE---SKDDFENEPDMXXXXX 57
           M++ S R N D   G     +K GR+ELR I R++ R   +    K D+  E  +     
Sbjct: 1   MSSNSVRENEDHHRG----HRKRGRQELRKIKRSSGRRTEDVDADKIDYVAEEPVGRNDN 56

Query: 58  XLADNKPRSXXXXXXXXXTKKQKVYNALLTLLESEHPHKKSKKNREGGKEKQGNLQEGVE 117
               +              KK+KVY+ALLT+L+SEHP  K  K +      +    +G E
Sbjct: 57  DAVSDVGSEDDLDVGDEDEKKKKVYDALLTILKSEHPEPKRMKTKAEESSDRTTQSDGNE 116

Query: 118 TYSDE--DEEEAIENALVETNDDE--DDVGSDINGDE-DDEDKADSFELHFNNVSELQAT 172
               E  D++  IEN L+   +DE  DD   D   D+ D ED+ D FE HFN V E    
Sbjct: 117 NAESEPVDDQLEIENGLLGDREDESEDDGSEDEKHDDVDSEDEQDPFESHFNQVPEKDVD 176

Query: 173 KLASAFRDKKIRYKSVKVPVNEDEFFIYSRPTVEGEDGSSVVAPSCKKSLHSYFIKQKLK 232
            L++AF+ K IRYKSVK P+N DE +IY++P V GE+ SSV +P    S++SYF+KQ+LK
Sbjct: 177 DLSNAFKSKNIRYKSVKAPLNGDESYIYAQPVVVGEE-SSVESPYKSSSIYSYFLKQRLK 235

Query: 233 IQNNLLDDKKEALAPLQKNLVDPMFQYQDLLXXXXXXXXXXXX-XDLYALHVLNHVYKTR 291
           IQN L D K + L  LQ+ LVDPMFQY+D+L              DLY LHVLNH+YKTR
Sbjct: 236 IQNGLQDKKIDPLNALQRKLVDPMFQYKDILYEYDSYEKDEDEYRDLYTLHVLNHIYKTR 295

Query: 292 DRILRNSQKLQDNSDQELLDQGFTRPKVLIVVPTRDVAYQIVTKIIEKSGLDQVDKRGKF 351
           DRIL+N+Q+LQDN D E LDQGFTRPKVLIVVPTRDVAY++V KII KSG+DQVDK+GKF
Sbjct: 296 DRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTRDVAYRVVDKIISKSGIDQVDKKGKF 355

Query: 352 QDQFFDASLXXXXXXXXXXHIFKGNTNDFFVLGAKFTRKTLKLYSNFYQSDVIFCSPLGI 411
            DQF D SL          HIFKGNTNDFFV+G KFTRK +KLYSNFYQSD+I CSPLGI
Sbjct: 356 YDQFRDDSLPPKSKPRSFQHIFKGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGI 415

Query: 412 QLILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNLSHITTIFQHINKIPQQQHDADFSR 471
           Q+ILENTDKKKRQDDFLSSIE+MVIDQLHSIEYQN+SHI TIF H+NKIP QQH+ADFSR
Sbjct: 416 QMILENTDKKKRQDDFLSSIEIMVIDQLHSIEYQNISHILTIFDHLNKIPDQQHEADFSR 475

Query: 472 IRMWYINEQATLFRQTMVFTKYASPFANSLINGKCRNHAGRWKNHNIVLPEKSSINQLGL 531
           IRMWYINEQA  FRQTMVFTKY SP  NSLING+CRN AGRWKNH  + PE SSI QLGL
Sbjct: 476 IRMWYINEQAKFFRQTMVFTKYISPTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGL 535

Query: 532 KVRQIFQRFDLVGGSAMDEPDYRFKFFTSVIIASIIKSTGYEDGILLYIPDYTDYVRVRN 591
           K+RQIFQRFD +G S ++EPDYRFKFFTSV+I SI+KSTGYEDGIL+YIPDYTD++R+RN
Sbjct: 536 KIRQIFQRFDTIGNSIVEEPDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDYTDFIRIRN 595

Query: 592 HLREKTTLLFGDINEYSEQKQLTSNRALFQQGKVKVLLYTERLHHFRRYEIKGVKSVIFY 651
           +++EKTT+LFGDINEYS Q+QL +NR+LFQQG++KV+LYTERLHH+RRY+IKGVKSVIFY
Sbjct: 596 YMKEKTTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFY 655

Query: 652 KPPTNPEFYREVVRYIGKSAFLGSADLNISTVRCVYCKLDGLSLERVVGTKRAAVLTHGQ 711
           KPP NPEFY E VR+IGK+AF G+ DLNISTVRC+Y KLDG+SLER+VGTKRAAVL+H Q
Sbjct: 656 KPPNNPEFYSETVRFIGKNAFSGNTDLNISTVRCIYSKLDGISLERIVGTKRAAVLSHAQ 715

Query: 712 NEIYEFK 718
            E+YEFK
Sbjct: 716 KEVYEFK 722

>Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score =  901 bits (2329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/727 (62%), Positives = 543/727 (74%), Gaps = 14/727 (1%)

Query: 1   MNNVSKRSNRDESHGGYKKAKKTGRKELRTITRANARHANE---SKDDFENEPDMXXXXX 57
           M+  S R N DE   G++K    GR+E+R I R  AR   +   ++ D   E  +     
Sbjct: 1   MSGKSAREN-DEHFRGHRKR---GRQEMRKIKRTTARRTEDVDTNEVDHVAEESVETKAE 56

Query: 58  XLADNKPRSXXXXXXXXXTKKQKVYNALLTLLESEHPHKKSKKNREGGKEKQGNLQEGVE 117
               +              K++KVY+ALLT+L+SEHP  K KK +  G+  +   Q GV 
Sbjct: 57  DAISDAGSESDLDIGDEEEKQEKVYDALLTILKSEHPEPKRKKTKATGENNEAVDQTGVN 116

Query: 118 TYSDE---DEEEAIENALVETNDDEDDVGSDINGDE--DDEDKADSFELHFNNVSELQAT 172
             +D    D++  IEN L+   +D+ D   D N  +  D ED+ D FE HFN VSE    
Sbjct: 117 ENTDSEPVDDQLEIENGLLSDQEDDSDDDGDENEQDEVDSEDEQDPFESHFNQVSEKYVD 176

Query: 173 KLASAFRDKKIRYKSVKVPVNEDEFFIYSRPTVEGEDGSSVVAPSCKKSLHSYFIKQKLK 232
            +++AF+   I+YKSVK P+ +DE  IYS+P V G D + V  P    S++SYF+KQ+LK
Sbjct: 177 DVSNAFKANNIKYKSVKSPLGDDESCIYSKPVVNG-DETPVERPYKSSSIYSYFLKQRLK 235

Query: 233 IQNNLLDDKKEALAPLQKNLVDPMFQYQDLLXXXXXXXXXXXX-XDLYALHVLNHVYKTR 291
           IQN LLD K + L  LQK LVDPMFQY+D+L              DLY LH LNH+YKTR
Sbjct: 236 IQNGLLDKKIDPLTSLQKKLVDPMFQYKDILYEYDSYEKDEDEYRDLYTLHALNHIYKTR 295

Query: 292 DRILRNSQKLQDNSDQELLDQGFTRPKVLIVVPTRDVAYQIVTKIIEKSGLDQVDKRGKF 351
           DRIL+N+Q+LQDN D E LDQGFTRPKVLIVVPTRD AY +V KII+KSG+DQVDK+GKF
Sbjct: 296 DRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTRDAAYHVVDKIIKKSGIDQVDKKGKF 355

Query: 352 QDQFFDASLXXXXXXXXXXHIFKGNTNDFFVLGAKFTRKTLKLYSNFYQSDVIFCSPLGI 411
            DQF D SL          HIF+GNT+DFFV+G KFTRK +KLYSNFYQSD+I CSPLGI
Sbjct: 356 YDQFRDDSLPPSSKPKSFQHIFRGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGI 415

Query: 412 QLILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNLSHITTIFQHINKIPQQQHDADFSR 471
           Q+ILENTDKKKRQDDFLSSIELMVIDQLHSIEYQN+SHI TIF HINKIP QQH+ADFSR
Sbjct: 416 QMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSR 475

Query: 472 IRMWYINEQATLFRQTMVFTKYASPFANSLINGKCRNHAGRWKNHNIVLPEKSSINQLGL 531
           IRMWYINEQA L RQTMVFTKY SP ANSLING+CRN AGRWKNH ++  E SSI QLGL
Sbjct: 476 IRMWYINEQAKLLRQTMVFTKYISPAANSLINGRCRNLAGRWKNHKVIESETSSIGQLGL 535

Query: 532 KVRQIFQRFDLVGGSAMDEPDYRFKFFTSVIIASIIKSTGYEDGILLYIPDYTDYVRVRN 591
           K+RQIFQRFD++G S ++EPDYRFKFFTSVII SI+KSTGYEDGIL+YIPDYTD++R+RN
Sbjct: 536 KIRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSTGYEDGILIYIPDYTDFIRIRN 595

Query: 592 HLREKTTLLFGDINEYSEQKQLTSNRALFQQGKVKVLLYTERLHHFRRYEIKGVKSVIFY 651
           +++EKTT+LFGDINEYS QKQL +NR+LFQQG+VKVLLYTERLHH+RRYEIKGVK+VIFY
Sbjct: 596 YMKEKTTILFGDINEYSSQKQLNANRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVIFY 655

Query: 652 KPPTNPEFYREVVRYIGKSAFLGSADLNISTVRCVYCKLDGLSLERVVGTKRAAVLTHGQ 711
           KPP NPEFY E VRYIGK+AFLG+ DLNISTVRCVY KLDGLSLER+VGTKRA VL+H Q
Sbjct: 656 KPPNNPEFYNETVRYIGKNAFLGNTDLNISTVRCVYSKLDGLSLERIVGTKRAGVLSHAQ 715

Query: 712 NEIYEFK 718
            E+YEFK
Sbjct: 716 KEVYEFK 722

>KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 704

 Score =  900 bits (2327), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/706 (63%), Positives = 544/706 (77%), Gaps = 11/706 (1%)

Query: 18  KKAKKTGRKELRTITRANARHANESKDDFENEPDMXXXXXXLADNKPRSXXXXXXXXXTK 77
           +   K+GRK+LR ITRA  +      DD     D+       +DN   S           
Sbjct: 5   RAGPKSGRKQLREITRAGQKRVR--YDDEATVADLTPDNESDSDNAEPSVAAEREDVEQH 62

Query: 78  KQKVYNALLTLLESEHPHKKSKKNREGGKEKQGNLQEGVET--YSDEDEEEAIENALVET 135
           + + YNALLTLL+SEHP +K K N++  K+ Q   ++  E    + EDE++ IENAL + 
Sbjct: 63  RGQAYNALLTLLKSEHPERKHKSNKKIKKDSQRAEEDSPENDGINSEDEQQNIENALDDV 122

Query: 136 ND---DEDDVGSDINGDEDDEDKADSFELHFNNVSELQATKLASAFRDKKIRYKSVKVPV 192
           +    DE+D+   ++  ++ ED++D FE HF+  SE +       F+DK ++YKS K  V
Sbjct: 123 SGGVVDEEDMEDSLSDVDESEDESDPFESHFSKYSESRLYAFDKGFKDKTVKYKSSKTDV 182

Query: 193 NEDEFFIYSRPTVEGEDGSSVVAPSCKKSLHSYFIKQKLKIQNNLLDDKKEALAPLQKNL 252
           +E+E  IYS+P ++ E+   V+    K++L SYFIKQKLK+ N+  ++    L  +QK L
Sbjct: 183 SEEESLIYSKPCLDDEE---VLPVKGKQTLSSYFIKQKLKLANDFQNNGL-PLTEIQKEL 238

Query: 253 VDPMFQYQDLLXXXXXXXXXXXXXDLYALHVLNHVYKTRDRILRNSQKLQDNSDQELLDQ 312
           VDPMFQY+D+L             DLY+LH LNHVYKTRDRIL+N+QKLQ+N+D+ELLDQ
Sbjct: 239 VDPMFQYKDMLYEYDDYADEDQYRDLYSLHALNHVYKTRDRILKNNQKLQENNDEELLDQ 298

Query: 313 GFTRPKVLIVVPTRDVAYQIVTKIIEKSGLDQVDKRGKFQDQFFDASLXXXXXXXXXXHI 372
           GFTRPKVLIVVPTRD A++IV KI+EKSGLDQ DK+ KF+DQFF+ SL          HI
Sbjct: 299 GFTRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPTSKPKSFQHI 358

Query: 373 FKGNTNDFFVLGAKFTRKTLKLYSNFYQSDVIFCSPLGIQLILENTDKKKRQDDFLSSIE 432
           F+GNTNDFFVLG KFTRK+LK+YSNFYQSD+I CSPLGIQLILENTDKKKRQDDFLSSIE
Sbjct: 359 FQGNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIE 418

Query: 433 LMVIDQLHSIEYQNLSHITTIFQHINKIPQQQHDADFSRIRMWYINEQATLFRQTMVFTK 492
           +M+IDQLHSIEYQN  H+TTIFQHINKIP+QQ +ADFSRIRMWYINEQA  FRQT+VFTK
Sbjct: 419 VMIIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAKFFRQTIVFTK 478

Query: 493 YASPFANSLINGKCRNHAGRWKNHNIVLPEKSSINQLGLKVRQIFQRFDLVGGSAMDEPD 552
           Y SPFANS++NGKCRN AGRWKNH  + PE+SSI QLGLKVRQIFQRFDL GG+A+DEPD
Sbjct: 479 YISPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDLAGGTALDEPD 538

Query: 553 YRFKFFTSVIIASIIKSTGYEDGILLYIPDYTDYVRVRNHLREKTTLLFGDINEYSEQKQ 612
           YRFKFFTSVI+ SI+KSTGYEDGILLYIPDYTD++RVRN+L+EKTT++FG+INEYS QKQ
Sbjct: 539 YRFKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFGEINEYSNQKQ 598

Query: 613 LTSNRALFQQGKVKVLLYTERLHHFRRYEIKGVKSVIFYKPPTNPEFYREVVRYIGKSAF 672
           LTSNRA FQ GKVKVLLYTERLHHFRRYEIK VKSVIFYKPP NPEFY EVVR IGK+ F
Sbjct: 599 LTSNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSEVVRNIGKNVF 658

Query: 673 LGSADLNISTVRCVYCKLDGLSLERVVGTKRAAVLTHGQNEIYEFK 718
           LG+ D+NISTVRC+Y K+DGLSLERVVG+KRAAVL HGQNE+YEFK
Sbjct: 659 LGNCDINISTVRCIYSKMDGLSLERVVGSKRAAVLAHGQNEVYEFK 704

>Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091C -
           Protein required for cell viability [contig 27] FULL
          Length = 727

 Score =  897 bits (2317), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/738 (60%), Positives = 557/738 (75%), Gaps = 31/738 (4%)

Query: 1   MNNVSKRSNRDESHGGYKKAKKTGRKELRTITRANARHANESKDDFENEPDMXXXXXXLA 60
           M++  +R    + H G +K  K GRK+LR+I +A+   + + +D+    P+         
Sbjct: 1   MSSSKRRYTDHDRHDG-EKFTKGGRKQLRSIRKASRYDSKKPEDEPVETPEEEI------ 53

Query: 61  DNKPRSXXXXXXXXXTKKQ---KVYNALLTLLESEHPHKKSKKNREGGKEKQGNLQEGVE 117
            N+             K++   + Y ALLTLL++EH     KK  + G + +G+ +  + 
Sbjct: 54  -NEVEDVHEERTEVSRKQESNGEAYAALLTLLKAEH--GTGKKKVKAGPQGEGSGESQIS 110

Query: 118 TYSDEDEEE-----------AIENALVETNDDEDDVGSDINGDEDD------EDKADSFE 160
             S E E++           AIEN L E  D + D  ++I  +EDD      E+ +D  E
Sbjct: 111 EISPEAEQDEEEEEEEEEETAIENGLAEHLDSDGDEAAEIGDEEDDNNGDQDENASDPLE 170

Query: 161 LHFNNVSELQATKLASAFRDKKIRYKSVKVPVNEDEFFIYSRPTVEGEDGSSVVAPSCKK 220
            HFN+V E     L  AF+ K++RY+S K+ ++++E FIYSRP +  E  + +  P   +
Sbjct: 171 AHFNSVPEKDTDALDQAFKTKQVRYRSSKIKISKNEEFIYSRPDLNLESRTPIQVPQGTQ 230

Query: 221 SLHSYFIKQKLKIQNNLLDDKKEALAPLQKNLVDPMFQYQDLLXXXXXXXXXXXXXDLYA 280
           SL  YFIKQ+LKIQN+LLD K   L PLQK +VDP+FQYQDLL             DLYA
Sbjct: 231 SLSPYFIKQRLKIQNDLLDSKNN-LTPLQKKIVDPIFQYQDLLYEYENYDQETEYRDLYA 289

Query: 281 LHVLNHVYKTRDRILRNSQKLQDNSDQELLDQGFTRPKVLIVVPTRDVAYQIVTKIIEKS 340
           LH L+H+YKTRDRIL+N+Q+LQDN DQE+LDQGFTRPKVLIVVPTRDVAY +++KIIEKS
Sbjct: 290 LHALDHIYKTRDRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRDVAYSVLSKIIEKS 349

Query: 341 GLDQVDKRGKFQDQFFDASLXXXXXXXXXXHIFKGNTNDFFVLGAKFTRKTLKLYSNFYQ 400
           GLDQVDK+ KF+DQF+  SL           +FKGNTNDFFVLGAKFTRKT+KLYSNFYQ
Sbjct: 350 GLDQVDKKSKFRDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKFTRKTIKLYSNFYQ 409

Query: 401 SDVIFCSPLGIQLILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNLSHITTIFQHINKI 460
           SD+I CSPLGIQLILENTDKKKRQDDFLSSIEL+VIDQLHSIE+QN+ H+T+IF+HINKI
Sbjct: 410 SDIIVCSPLGIQLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNVLHLTSIFEHINKI 469

Query: 461 PQQQHDADFSRIRMWYINEQATLFRQTMVFTKYASPFANSLINGKCRNHAGRWKNHNIVL 520
           PQQQHDADFSRI+MWYIN+QA LFRQT++FT++++PFANSLINGKCRN+AGRWKNH IV 
Sbjct: 470 PQQQHDADFSRIKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGRWKNHTIVG 529

Query: 521 PEKSSINQLGLKVRQIFQRFDLVGGSAMDEPDYRFKFFTSVIIASIIKSTGYEDGILLYI 580
            EKSS++QLG++ R +FQRFD+ GG+A DEPD+RFK F SVI+ +I++STGYEDGILLYI
Sbjct: 530 AEKSSLSQLGMRTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGYEDGILLYI 589

Query: 581 PDYTDYVRVRNHLREKTTLLFGDINEYSEQKQLTSNRALFQQGKVKVLLYTERLHHFRRY 640
           PDYTD++RVRN+LREKTT+LFGDI+EYSEQ+QLT+NRALFQQG+VKVLLYTERLHHFRRY
Sbjct: 590 PDYTDFIRVRNYLREKTTILFGDISEYSEQRQLTANRALFQQGRVKVLLYTERLHHFRRY 649

Query: 641 EIKGVKSVIFYKPPTNPEFYREVVRYIGKSAFLGSADLNISTVRCVYCKLDGLSLERVVG 700
           EIKGVK+VIFYKPPTNPEF+ E VRY+ KSAFLG ADLNIS VRC+Y KLDGL+LER+VG
Sbjct: 650 EIKGVKTVIFYKPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLYSKLDGLALERIVG 709

Query: 701 TKRAAVLTHGQNEIYEFK 718
           T+RAA+LTHG NE YEFK
Sbjct: 710 TERAAILTHGPNETYEFK 727

>Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}
           YIL091C (REAL)
          Length = 724

 Score =  896 bits (2316), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/733 (62%), Positives = 550/733 (75%), Gaps = 24/733 (3%)

Query: 1   MNNVSKRSNRDESHGGYKKAKKTGRKELRTITRANARHANESKDDFENEPDM-------X 53
           MN  S R   D   G     +K GR+ELR I R++ R    +KD+  NE D         
Sbjct: 1   MNGESVREKNDHFRG----YRKRGRQELRKIKRSSVRR---TKDESVNEVDHVADEIVHS 53

Query: 54  XXXXXLADNKPRSXXXXXXXXXTKKQKVYNALLTLLESEHPHKKSKKNR-----EGGKEK 108
                ++D               KK+KVY+ALLT+L+SEHP  K +K +     +   + 
Sbjct: 54  TGEDKISDIGSEEDNLDVEDEEGKKEKVYDALLTILKSEHPEPKRRKTQADEDNKAAAKP 113

Query: 109 QGNLQEGVETYSDEDEEEAIENALV--ETNDDEDDVGSDINGDEDDEDKADSFELHFNNV 166
            GN    VE Y   DE+  IEN L+    +D++DD   +   D D ED+ D FE HFN V
Sbjct: 114 AGNENVNVE-YEPVDEQLEIENGLLGDREDDNDDDSNENEKDDMDSEDEQDPFESHFNQV 172

Query: 167 SELQATKLASAFRDKKIRYKSVKVPVNEDEFFIYSRPTVEGEDGSSVVAPSCKKSLHSYF 226
           SE     L++AF+ K I+YKSVK  + +DE +IY++P + GE+ + V +P    S++SYF
Sbjct: 173 SEKYVDDLSNAFKSKSIKYKSVKASLGDDESYIYAKPFMVGEE-ALVESPYRSSSIYSYF 231

Query: 227 IKQKLKIQNNLLDDKKEALAPLQKNLVDPMFQYQDLLXXXXXXXX-XXXXXDLYALHVLN 285
           +KQ+LK+QN LLD K + L  +QK L+DPMFQY+D+L              DLYALHVLN
Sbjct: 232 LKQRLKVQNGLLDKKIDPLTCMQKKLIDPMFQYKDILYEYDSYEKDESEYRDLYALHVLN 291

Query: 286 HVYKTRDRILRNSQKLQDNSDQELLDQGFTRPKVLIVVPTRDVAYQIVTKIIEKSGLDQV 345
           H+YKTRDRIL+N+Q+LQDN D E LDQGFTRPKVLIVVPTR+VAY++V KII KSG+DQV
Sbjct: 292 HIYKTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQV 351

Query: 346 DKRGKFQDQFFDASLXXXXXXXXXXHIFKGNTNDFFVLGAKFTRKTLKLYSNFYQSDVIF 405
           DK+GKF DQF D SL          HIFKGNT+DFFV+G KFTRK +KLYSNFYQSD+I 
Sbjct: 352 DKKGKFYDQFRDDSLPPESKPKSFQHIFKGNTSDFFVVGLKFTRKAIKLYSNFYQSDIII 411

Query: 406 CSPLGIQLILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNLSHITTIFQHINKIPQQQH 465
           CSPLGIQ+ILENTDKKKRQDDFLSSIELMVIDQLHSIEYQN+SHI TIF HINKIP QQH
Sbjct: 412 CSPLGIQMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQH 471

Query: 466 DADFSRIRMWYINEQATLFRQTMVFTKYASPFANSLINGKCRNHAGRWKNHNIVLPEKSS 525
           +ADFSRIRMWYINEQA LFRQTMVFTKY SP ANSLING+C N AGRWKNH ++  E SS
Sbjct: 472 EADFSRIRMWYINEQAKLFRQTMVFTKYISPAANSLINGRCCNMAGRWKNHKVIGSESSS 531

Query: 526 INQLGLKVRQIFQRFDLVGGSAMDEPDYRFKFFTSVIIASIIKSTGYEDGILLYIPDYTD 585
           I QLGLKVRQIFQRFD++G S ++EPDYRFKFFTSVII SI+KS GYEDGIL+YIPDYTD
Sbjct: 532 IGQLGLKVRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSVGYEDGILVYIPDYTD 591

Query: 586 YVRVRNHLREKTTLLFGDINEYSEQKQLTSNRALFQQGKVKVLLYTERLHHFRRYEIKGV 645
           ++R+RN+++EKTT+LFGDINEYS Q+QL +NR+LFQQG++KV+LYTERLHH+RRYEIKGV
Sbjct: 592 FIRIRNYMKEKTTILFGDINEYSNQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGV 651

Query: 646 KSVIFYKPPTNPEFYREVVRYIGKSAFLGSADLNISTVRCVYCKLDGLSLERVVGTKRAA 705
           KSV+FYKPP NPEFY E VR+IGK+AFLG+ DLNISTVRC+Y KLDGLSLER+VGTKRAA
Sbjct: 652 KSVVFYKPPNNPEFYNETVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAA 711

Query: 706 VLTHGQNEIYEFK 718
           VL+H Q E+YEFK
Sbjct: 712 VLSHAQKEVYEFK 724

>YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}
           UTP25Nucleolar protein required for 35S pre-RNA
           processing and 40S ribosomal subunit biogenesis
          Length = 721

 Score =  893 bits (2308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/717 (62%), Positives = 552/717 (76%), Gaps = 13/717 (1%)

Query: 12  ESHGGYKKAKKTGRKELRTITRANAR---HANESKDDFENEPDMXXXXXXLADNKPRSXX 68
           E +  ++  +K GR+ELR I R++AR    + E+ +D   + D       ++D       
Sbjct: 8   EKNDNFRGYRKRGRQELRKIKRSSARTEGGSTETLEDVAEDIDHRSDEDEVSDVDS-GDD 66

Query: 69  XXXXXXXTKKQKVYNALLTLLESEHPHKKSKKNREGGKEKQGNLQEGVETYSDE-----D 123
                   KK+KVY+ALLT+L+SEHP  K ++ RE  +  +   + G + + +      D
Sbjct: 67  FDIEDEEGKKEKVYDALLTILKSEHPEPK-RRRREADESNKAPAEVGEDEHENTEHGPVD 125

Query: 124 EEEAIENALVETNDDEDDVGSDING-DEDDEDKADSFELHFNNVSELQATKLASAFRDKK 182
           ++  IEN L+  ++D++D  S  +  D D ED+ D FE HFN V E    KL++AF+ K 
Sbjct: 126 DQLEIENGLLGNHEDDNDDDSSGDEKDIDSEDEQDPFESHFNQVPEKFVDKLSNAFKTKS 185

Query: 183 IRYKSVKVPVNEDEFFIYSRPTVEGEDGSSVVAPSCKKSLHSYFIKQKLKIQNNLLDDKK 242
           ++YKSVK  +++ E +IY++P V GE+ + V +P    S++SYF+KQ+LK+QN LLD K 
Sbjct: 186 VKYKSVKGSLSDSESYIYAKPVVIGEE-ALVESPYRSSSIYSYFLKQRLKVQNGLLDKKT 244

Query: 243 EALAPLQKNLVDPMFQYQDLLXXXXXXXXXXXX-XDLYALHVLNHVYKTRDRILRNSQKL 301
           + L  LQK LVDPMFQY+D+L              DLYALHVLNH+YKTRDRIL+N+Q+L
Sbjct: 245 DPLTALQKKLVDPMFQYKDILYEYDSYEKDEDEYRDLYALHVLNHIYKTRDRILKNNQRL 304

Query: 302 QDNSDQELLDQGFTRPKVLIVVPTRDVAYQIVTKIIEKSGLDQVDKRGKFQDQFFDASLX 361
           QDN D E LDQGFTRPKVLIVVPTR+VAY++V KII KSG+DQVDK+GKF DQF D SL 
Sbjct: 305 QDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLP 364

Query: 362 XXXXXXXXXHIFKGNTNDFFVLGAKFTRKTLKLYSNFYQSDVIFCSPLGIQLILENTDKK 421
                    HIF+GNTNDFFV+G KFTRK +KLYSNFYQSD+I CSPLGIQ+ILENTDKK
Sbjct: 365 PKSKPKSFQHIFRGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKK 424

Query: 422 KRQDDFLSSIELMVIDQLHSIEYQNLSHITTIFQHINKIPQQQHDADFSRIRMWYINEQA 481
           KRQDDFLSSIELMVIDQLHSIEYQN+SHI TIF H+NKIP QQH+ADFSRIRMWYINEQA
Sbjct: 425 KRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHLNKIPDQQHEADFSRIRMWYINEQA 484

Query: 482 TLFRQTMVFTKYASPFANSLINGKCRNHAGRWKNHNIVLPEKSSINQLGLKVRQIFQRFD 541
            LFRQTMVFTKY SP ANSLING+CRN AGRWKNH ++  E SSI Q GLK+RQIFQRFD
Sbjct: 485 KLFRQTMVFTKYISPAANSLINGRCRNMAGRWKNHKVIGSENSSIGQSGLKIRQIFQRFD 544

Query: 542 LVGGSAMDEPDYRFKFFTSVIIASIIKSTGYEDGILLYIPDYTDYVRVRNHLREKTTLLF 601
           ++G S ++EPDYRFKFFTSVII  I+KSTGYEDGIL+YIPDYTD++R+RN+++EKTT+LF
Sbjct: 545 IIGNSIIEEPDYRFKFFTSVIIPGIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILF 604

Query: 602 GDINEYSEQKQLTSNRALFQQGKVKVLLYTERLHHFRRYEIKGVKSVIFYKPPTNPEFYR 661
           GDINEYS Q+QL +NR+LFQQG++KV+LYTERLHH+RRYEIKGVKSV+FYKPP NPEFY 
Sbjct: 605 GDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPPNNPEFYN 664

Query: 662 EVVRYIGKSAFLGSADLNISTVRCVYCKLDGLSLERVVGTKRAAVLTHGQNEIYEFK 718
           EVVR+IGK+AFLG+ DLNISTVRC+Y KLDGLSLER+VGTKRAAVL+H Q EIYEFK
Sbjct: 665 EVVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEIYEFK 721

>NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON}
           Anc_2.292 YIL091C
          Length = 723

 Score =  891 bits (2302), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/730 (61%), Positives = 548/730 (75%), Gaps = 22/730 (3%)

Query: 4   VSKRSNRDESHGGYKKAKKTGRKELRTITRANARHANESKDDFENEPDMXXXXXXLADNK 63
           +SKRS+    H G   +KK GR+ELRTI R+    A  S  +  N   +      L ++ 
Sbjct: 1   MSKRSHEGSQHAG---SKKRGRQELRTIRRSAG--AKVSSQEVFNSSIVDDEEQELNESN 55

Query: 64  PRSXXXXXXXXXTKKQKVYNALLTLLESEHPHKKSKKNREGGKEKQGNLQEGVETYSDE- 122
             S          KK KVY ALLT+L+SEHP  K KK +     K G   +G E  SD+ 
Sbjct: 56  -ESEQEEDIDEEEKKNKVYGALLTILKSEHPELKKKKKKRVDDSKSGE-DKGSELASDDG 113

Query: 123 -----DEEEAIENALV-----ETNDDEDDVGSDIN-GDEDDEDKADSFELHFNNVSELQA 171
                DE + IE+ L      + +DDE+D  +  N  D D ED+ D FE HFN VSE  A
Sbjct: 114 KDDEIDEAQQIEDGLARGSDGQPSDDEEDNDAHSNVEDIDSEDEQDPFESHFNQVSEKTA 173

Query: 172 TKLASAFRDKKIRYKSVKVPVNEDEFFIYSRPTVEGEDGSSVVAPSCKKS--LHSYFIKQ 229
             L +AF    ++YKS K  + +++  I S PT+ G++ +     S  KS  +HSYF+KQ
Sbjct: 174 DDLNTAFNTGSVKYKSTKSVIGDNKTVISSIPTIIGKENTEEEKDSAPKSSSIHSYFLKQ 233

Query: 230 KLKIQNNLLDDKKEALAPLQKNLVDPMFQYQDLLXXXXXXXXXXXX-XDLYALHVLNHVY 288
           +L++ N++LD KK+ L PLQK LVDPMFQY+D+L              DLYALH LNHVY
Sbjct: 234 RLRVANDMLDSKKDPLGPLQKELVDPMFQYRDILCEYSSYEKDEDEYRDLYALHALNHVY 293

Query: 289 KTRDRILRNSQKLQDNSDQELLDQGFTRPKVLIVVPTRDVAYQIVTKIIEKSGLDQVDKR 348
           KTRDRIL+++ +LQDNSD E  DQGFTRPKVLIVVPTRD AY++++KII KSGLDQVDK+
Sbjct: 294 KTRDRILKDNGRLQDNSDTEYFDQGFTRPKVLIVVPTRDTAYEVISKIISKSGLDQVDKK 353

Query: 349 GKFQDQFFDASLXXXXXXXXXXHIFKGNTNDFFVLGAKFTRKTLKLYSNFYQSDVIFCSP 408
           GKF DQF D +L          HIFKGNTNDFFVLG KFTRK +KLYSNFYQSD+I CSP
Sbjct: 354 GKFNDQFHDETLPPSSKPKSFQHIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIVCSP 413

Query: 409 LGIQLILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNLSHITTIFQHINKIPQQQHDAD 468
           LG+Q+I+ENTDKK RQDDFLSSIE+++IDQLHSIEYQNL+H+ TIF H+NKIP+QQH+AD
Sbjct: 414 LGMQMIVENTDKKNRQDDFLSSIEVLIIDQLHSIEYQNLAHVFTIFDHLNKIPEQQHEAD 473

Query: 469 FSRIRMWYINEQATLFRQTMVFTKYASPFANSLINGKCRNHAGRWKNHNIVLPEKSSINQ 528
           FSRIRMWYIN+QA LFRQTM+FTKY +P AN+LIN +CRN AGRWKNH I+ PE S+I+Q
Sbjct: 474 FSRIRMWYINDQARLFRQTMIFTKYVTPAANALINNRCRNWAGRWKNHEIIEPEASAISQ 533

Query: 529 LGLKVRQIFQRFDLVGGSAMDEPDYRFKFFTSVIIASIIKSTGYEDGILLYIPDYTDYVR 588
           LGLKV+Q FQRFD++GGS +DEPDYRFK F+SVII SI+KST Y DGIL+YIPDYTDYVR
Sbjct: 534 LGLKVKQTFQRFDMMGGSVIDEPDYRFKHFSSVIIPSIVKSTSYSDGILIYIPDYTDYVR 593

Query: 589 VRNHLREKTTLLFGDINEYSEQKQLTSNRALFQQGKVKVLLYTERLHHFRRYEIKGVKSV 648
           +RN+L+EKTTLLFGDINEYSEQ++L SNR+LFQQG+VKVLLYTERLHH+RRYE+KGVKSV
Sbjct: 594 IRNYLKEKTTLLFGDINEYSEQRELNSNRSLFQQGRVKVLLYTERLHHYRRYELKGVKSV 653

Query: 649 IFYKPPTNPEFYREVVRYIGKSAFLGSADLNISTVRCVYCKLDGLSLERVVGTKRAAVLT 708
           +FYKPPTNPEFY EVVRYIGKSAFLG+ADLNISTVR +YCKLDGLSLER+VG+KRA +L 
Sbjct: 654 VFYKPPTNPEFYNEVVRYIGKSAFLGNADLNISTVRTLYCKLDGLSLERIVGSKRAGILC 713

Query: 709 HGQNEIYEFK 718
           H QNE+YEF+
Sbjct: 714 HAQNEVYEFQ 723

>Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}
           similar to Ashbya gossypii ADL209C
          Length = 708

 Score =  876 bits (2264), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/718 (61%), Positives = 542/718 (75%), Gaps = 34/718 (4%)

Query: 22  KTGRKELRTITR---------ANA----RHANESKDDFENEPDMXXXXXXLADNKPRSXX 68
           K GRK+LR ITR         AN     +  N   D++  E  M        D++     
Sbjct: 4   KRGRKQLRKITRIGRNRSEDKANGSALEKRGNNDGDEYA-EIAMGEHEKAADDDQ----- 57

Query: 69  XXXXXXXTKKQKVYNALLTLLESEHPHKKSK-----KNREGGKEKQGNLQEGVETYSDED 123
                   +   VY ALL++L S HP  + K     K  +   E++ N     ET     
Sbjct: 58  ------EERTAHVYGALLSILNSAHPEIRRKRVKVEKTTDAVVEERKNGSRNYETDEVAT 111

Query: 124 EEEAIENALVETNDDEDDVGSDINGDEDDEDKADSFELHFNNVSELQATKLASAFRDKKI 183
              ++++++ +  + E+D G   +G ED ED+ D FE HFN +SE+   KL +AF++K +
Sbjct: 112 ISASLDDSVDKDEEVEEDDGVYSDG-EDSEDERDPFEYHFNQISEMDTNKLDAAFKEKTV 170

Query: 184 RYKSVKVP-VNEDEFFIYSRPTVEGEDGSSVV--APSCKKSLHSYFIKQKLKIQNNLLDD 240
           +Y+S K+P ++++E FI+S+P +EG  GS  V   P CK ++HSYF+K+KLK+ N LLDD
Sbjct: 171 QYESTKLPYMHDNEGFIFSKPVIEGLKGSDAVNDTPVCKGNIHSYFMKKKLKVHNGLLDD 230

Query: 241 KKEALAPLQKNLVDPMFQYQDLLXXXXXXXXXXXXXDLYALHVLNHVYKTRDRILRNSQK 300
           KK+ L PL K LVDP+FQY+DLL             DLY LH+LNH+YKTRDRIL+N+ K
Sbjct: 231 KKKPLTPLSKTLVDPIFQYRDLLFEYEDFSQETEYRDLYTLHILNHIYKTRDRILKNNHK 290

Query: 301 LQDNSDQELLDQGFTRPKVLIVVPTRDVAYQIVTKIIEKSGLDQVDKRGKFQDQFFDASL 360
           LQ+N DQELLDQGFTRPKVL+V PTR+ AY I+ KII+KSGLDQVDK+ KF+DQF++ SL
Sbjct: 291 LQENDDQELLDQGFTRPKVLVVAPTRNTAYDIIEKIIDKSGLDQVDKKSKFKDQFYEDSL 350

Query: 361 XXXXXXXXXXHIFKGNTNDFFVLGAKFTRKTLKLYSNFYQSDVIFCSPLGIQLILENTDK 420
                     H+FKGNTNDFFVLG KFTRKTLKLYSNFYQSDVI CSPLGIQLILENTDK
Sbjct: 351 PPTSKPKSFQHVFKGNTNDFFVLGMKFTRKTLKLYSNFYQSDVIVCSPLGIQLILENTDK 410

Query: 421 KKRQDDFLSSIELMVIDQLHSIEYQNLSHITTIFQHINKIPQQQHDADFSRIRMWYINEQ 480
           KKRQDDFLSSIE++V+DQLHS+E+QN +H+ +IFQHINKIPQ+QHD+DFSRIRMWYIN+Q
Sbjct: 411 KKRQDDFLSSIEMLVVDQLHSLEFQNPAHVLSIFQHINKIPQKQHDSDFSRIRMWYINDQ 470

Query: 481 ATLFRQTMVFTKYASPFANSLINGKCRNHAGRWKNHNIVLPEKSSINQLGLKVRQIFQRF 540
           A LFRQT++FTKY SPFANSLINGKC N +GR+KN   + PEKS+INQLGLKVRQ+F RF
Sbjct: 471 ARLFRQTLIFTKYVSPFANSLINGKCCNWSGRFKNRRYISPEKSAINQLGLKVRQVFHRF 530

Query: 541 DLVGGSAMDEPDYRFKFFTSVIIASIIKSTGYEDGILLYIPDYTDYVRVRNHLREKTTLL 600
           DL  GS++DEPDYRFKFFTSV +  I KSTGYEDGILLYIPDYTD++RVRN+ +++T +L
Sbjct: 531 DLFTGSSVDEPDYRFKFFTSVTVPIIQKSTGYEDGILLYIPDYTDFLRVRNYFKDQTRIL 590

Query: 601 FGDINEYSEQKQLTSNRALFQQGKVKVLLYTERLHHFRRYEIKGVKSVIFYKPPTNPEFY 660
           FG+I EYS+Q+Q+TSNRALFQQGKVKVLLYTERLHHFRRY+IKGVKSVIFYKPP+NPEFY
Sbjct: 591 FGEITEYSDQRQVTSNRALFQQGKVKVLLYTERLHHFRRYQIKGVKSVIFYKPPSNPEFY 650

Query: 661 REVVRYIGKSAFLGSADLNISTVRCVYCKLDGLSLERVVGTKRAAVLTHGQNEIYEFK 718
           +E++R IGK+AFLG+ADLNISTVRC YCKLD LSLER+VG+KRAAVLT  QNEIYEFK
Sbjct: 651 QELIRCIGKNAFLGNADLNISTVRCTYCKLDSLSLERIVGSKRAAVLTRSQNEIYEFK 708

>KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2.292
           YIL091C
          Length = 728

 Score =  877 bits (2266), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/722 (60%), Positives = 547/722 (75%), Gaps = 22/722 (3%)

Query: 16  GYKKAKKTGRKELRTITRANAR------------HANESKDDFENEPDMXXXXXXLADNK 63
           GY   +K GRKELR I RA  R              +E+  + E EP        + D  
Sbjct: 10  GYDGVRKRGRKELRNIRRAGGRKPRDAQENGNGISVSENTGEVEEEPSSAANGDDVGD-- 67

Query: 64  PRSXXXXXXXXXTKKQKVYNALLTLLESEHPHKKSKKNREGGKEKQGNLQEGVETYSDED 123
                         K++VY ALLT+L+SEHP  K +K  +  K    N Q+     S+E+
Sbjct: 68  -EVGDEASDDEEEMKKQVYGALLTILKSEHPEPKKQKKEKVNKVLLDNEQQDESDASEEE 126

Query: 124 EE--EAIENALVETNDD---EDDVGSDINGDEDDEDKADSFELHFNNVSELQATKLASAF 178
           E+  + IENAL+ ++ D   EDD     + +E+ +++ D FE HFN+V E    KL  +F
Sbjct: 127 EDETQQIENALMGSHADDASEDDDKEHGDDNEESDEEQDPFETHFNSVDEKFTDKLDVSF 186

Query: 179 RDKKIRYKSVKVPVNEDEFFIYSRPTVEGEDGSSVVAPSC-KKSLHSYFIKQKLKIQNNL 237
           ++  I+YKS K+P++EDE+ I+S+P ++ ++  S V  S  K S+HSYF+KQ+LK+QNNL
Sbjct: 187 KNNDIKYKSTKLPISEDEYAIFSKPVIKSDEIESPVELSVNKSSIHSYFLKQRLKMQNNL 246

Query: 238 LDDKKEALAPLQKNLVDPMFQYQDLLXXXXXXXXXXXX-XDLYALHVLNHVYKTRDRILR 296
           +D K + L PLQK LVDPMFQY+D+L              DLY+LHVLNH+YKTRD+IL+
Sbjct: 247 MDPKVDPLTPLQKQLVDPMFQYKDILYQYDSYGKDEDEYRDLYSLHVLNHLYKTRDKILK 306

Query: 297 NSQKLQDNSDQELLDQGFTRPKVLIVVPTRDVAYQIVTKIIEKSGLDQVDKRGKFQDQFF 356
           N+Q+LQDN+D E LDQGFTRPKVLIVVPTRD AYQ++ KII KSG+DQVDK+GKF+DQFF
Sbjct: 307 NNQRLQDNNDTECLDQGFTRPKVLIVVPTRDTAYQVIEKIIAKSGIDQVDKKGKFKDQFF 366

Query: 357 DASLXXXXXXXXXXHIFKGNTNDFFVLGAKFTRKTLKLYSNFYQSDVIFCSPLGIQLILE 416
           + SL           IFKGNTNDFFVLG KFTRK +KLYSNFYQSD+I CSPLGIQ+ILE
Sbjct: 367 EDSLPPSSKPKSFQDIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQMILE 426

Query: 417 NTDKKKRQDDFLSSIELMVIDQLHSIEYQNLSHITTIFQHINKIPQQQHDADFSRIRMWY 476
           NTDKKKRQDDFLSSIELM+IDQLHSIEYQN+SH+ TI  HINKIPQ+QHDADFSR+RMWY
Sbjct: 427 NTDKKKRQDDFLSSIELMIIDQLHSIEYQNISHLFTICNHINKIPQEQHDADFSRVRMWY 486

Query: 477 INEQATLFRQTMVFTKYASPFANSLINGKCRNHAGRWKNHNIVLPEKSSINQLGLKVRQI 536
           IN+QA LFRQTM+FTKY SP ANSL+NGKC+N +GRWKNH ++    SSI+++G+K+RQI
Sbjct: 487 INDQAKLFRQTMLFTKYISPMANSLLNGKCQNWSGRWKNHKVISTNSSSISKVGIKIRQI 546

Query: 537 FQRFDLVGGSAMDEPDYRFKFFTSVIIASIIKSTGYEDGILLYIPDYTDYVRVRNHLREK 596
           FQRF+ V GS +DEPDYRFKFFTSV + +I+K+TGYEDG L+YIP+YTDY+RVRN+L++K
Sbjct: 547 FQRFETVNGSVVDEPDYRFKFFTSVTVPNIVKTTGYEDGTLIYIPEYTDYIRVRNYLKDK 606

Query: 597 TTLLFGDINEYSEQKQLTSNRALFQQGKVKVLLYTERLHHFRRYEIKGVKSVIFYKPPTN 656
           TT+LFGDINEYS+QKQL SNR+LFQQG+VKVLLYTERLHH+RRYEIKGVK+V+FY+PP N
Sbjct: 607 TTILFGDINEYSDQKQLNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVVFYQPPKN 666

Query: 657 PEFYREVVRYIGKSAFLGSADLNISTVRCVYCKLDGLSLERVVGTKRAAVLTHGQNEIYE 716
           PEFY EVVRYIGK+AFLG+ DLNISTVRC+Y KLD LSLE +VG+KRA VL H QNE+YE
Sbjct: 667 PEFYTEVVRYIGKNAFLGNTDLNISTVRCLYSKLDALSLENIVGSKRAGVLCHAQNEVYE 726

Query: 717 FK 718
           FK
Sbjct: 727 FK 728

>NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.292
           YIL091C
          Length = 739

 Score =  871 bits (2250), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/739 (60%), Positives = 544/739 (73%), Gaps = 38/739 (5%)

Query: 5   SKRSNRDESHGGYKKAKKTGRKELRTITRANARHA----NESKDDFENEPDMXXXXXXLA 60
           S +SN    H      +K GR+ELRTI R+ A+ +    N ++ +   E           
Sbjct: 14  SYKSNNSNDH-----HRKRGRQELRTIRRSAAKKSRYDSNVTEHNDTEELLQEESEEGEE 68

Query: 61  DNKPRSXXXXXXXXXTKKQKVYNALLTLLESEHPHKKSKKNREGGKEKQ----GNL---- 112
           D +             +K KVY ALLT+LE+EHP  K K+  +    K+     NL    
Sbjct: 69  DEEDDQSEQEEVDEDERKGKVYGALLTILETEHPEPKHKRQPKEKLLKEQVSDSNLNNTG 128

Query: 113 -QEGVETYSDEDEEEAIENALVETN---------DDEDDVGSDINGDEDDEDKADSFELH 162
            +E  ++  +EDE E IEN L++ +         +D +DV SD        D+ D FE H
Sbjct: 129 DRETEDSIIEEDETEQIENGLLDRDDEQSDDDQLNDSNDVESD--------DEQDPFESH 180

Query: 163 FNNVSELQATKLASAFRDKKIRYKSVKVPVNEDEFFIYSRPTVEGEDGSSVVAPSCK--K 220
           FN  +E    KL +AF  ++I+YK+ K+ +++    I S+PT+ GE+  +    S K  +
Sbjct: 181 FNKPTEQFVDKLHAAFESREIKYKATKIVIDDSHSVISSKPTIFGEELETNRLSSSKHGQ 240

Query: 221 SLHSYFIKQKLKIQNNLLDDKKEALAPLQKNLVDPMFQYQDLLXXXXXX-XXXXXXXDLY 279
           S+ SYFIKQ+LKIQNNLL+ K + L PLQK L+DPMFQY+D+L              DLY
Sbjct: 241 SIFSYFIKQRLKIQNNLLNPKVDPLTPLQKELLDPMFQYKDILYEYDSYGKDEDEYRDLY 300

Query: 280 ALHVLNHVYKTRDRILRNSQKLQDNSDQELLDQGFTRPKVLIVVPTRDVAYQIVTKIIEK 339
           ALH LNHVYKTRDRIL+N+Q+LQDN+D E LDQGFTRPKVLIVVPTRD AY++  KII+K
Sbjct: 301 ALHALNHVYKTRDRILKNNQRLQDNTDTEYLDQGFTRPKVLIVVPTRDTAYEVTDKIIKK 360

Query: 340 SGLDQVDKRGKFQDQFFDASLXXXXXXXXXXHIFKGNTNDFFVLGAKFTRKTLKLYSNFY 399
           SGLDQVDK+GKF DQF D SL           IFKGNTNDFFVLG KFTRK +KLYSNFY
Sbjct: 361 SGLDQVDKKGKFYDQFKDDSLPPSSKPKSFQQIFKGNTNDFFVLGLKFTRKAIKLYSNFY 420

Query: 400 QSDVIFCSPLGIQLILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNLSHITTIFQHINK 459
           QSD+I CSPLG+Q+I+ENTDKKKRQDDFLSSIEL+++DQLHS+EYQNL+HI TIF H+NK
Sbjct: 421 QSDIIVCSPLGMQMIVENTDKKKRQDDFLSSIELLIVDQLHSLEYQNLAHIFTIFDHLNK 480

Query: 460 IPQQQHDADFSRIRMWYINEQATLFRQTMVFTKYASPFANSLINGKCRNHAGRWKNHNIV 519
           IP +QHDADFSRIRMWYIN+QA LFRQTMVFTKY SP AN++IN +CRN  GRWKNH IV
Sbjct: 481 IPTEQHDADFSRIRMWYINDQAKLFRQTMVFTKYVSPAANAIINNRCRNWEGRWKNHKIV 540

Query: 520 LPEKSSINQLGLKVRQIFQRFDLVGGSAMDEPDYRFKFFTSVIIASIIKSTGYEDGILLY 579
            PE SSI +LGLK++QIFQRFD++GGS +DEPDYRFK FTSVII SI+KST Y+DGIL+Y
Sbjct: 541 APEVSSIGKLGLKIKQIFQRFDIMGGSIVDEPDYRFKHFTSVIIPSIVKSTSYDDGILIY 600

Query: 580 IPDYTDYVRVRNHLREKTTLLFGDINEYSEQKQLTSNRALFQQGKVKVLLYTERLHHFRR 639
           IPDYTDYVR+RN+L+EKT +LFGDINEYSEQ++L SNR+L QQG+VKVLLYTERLHH+RR
Sbjct: 601 IPDYTDYVRIRNYLKEKTRILFGDINEYSEQRELNSNRSLLQQGRVKVLLYTERLHHYRR 660

Query: 640 YEIKGVKSVIFYKPPTNPEFYREVVRYIGKSAFLGSADLNISTVRCVYCKLDGLSLERVV 699
           YEIKGVKSV+FYKPPTNPEFY EVVR+IGK+AFLG+ DLNISTVR VYCKLDGLSLER+V
Sbjct: 661 YEIKGVKSVVFYKPPTNPEFYNEVVRFIGKNAFLGNTDLNISTVRTVYCKLDGLSLERIV 720

Query: 700 GTKRAAVLTHGQNEIYEFK 718
           GTKRA +L H QNE+YEFK
Sbjct: 721 GTKRAGILCHAQNEVYEFK 739

>KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.292
           YIL091C
          Length = 721

 Score =  860 bits (2223), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/725 (61%), Positives = 546/725 (75%), Gaps = 32/725 (4%)

Query: 19  KAKKTGRKELRTITRANARHA-----NES---KDDFENEPDMXXXXXXLADNKPRSXXXX 70
           ++ K GRKELR + R   R A      ES   +DDF    D        A++   S    
Sbjct: 4   RSGKRGRKELRHLKRTTKRPAIDDPPRESAPVEDDFVGPADQMVNVSDSAEDGDGSDSDA 63

Query: 71  XXXXXTKKQKVYNALLTLLESEHPH---KKSKKNREGGK-EKQGNLQEGVETYSDEDEEE 126
                 +K KVY ALLT+L+SEHP    +K+KK+ +GG+ +K     +  E   +E+EEE
Sbjct: 64  E----ARKGKVYGALLTILKSEHPEAKKRKTKKSSDGGEVDKILVHDDNHEELEEENEEE 119

Query: 127 AIENALVET-----NDDEDDVGSDINGDEDDEDKADSFELHFNNVSELQATKLASAFRDK 181
            I+NA+++      ++DE DV ++   + D ED+ D FE HFN   E +   L +AF+ K
Sbjct: 120 QIDNAILDNRTQSDSEDEQDVAAE---EFDSEDEQDPFESHFNQFPETEINTLDAAFKSK 176

Query: 182 KIRYKSVKV-PVN----EDEFFIYSRPTVEGEDGSS--VVAPSCKKSLHSYFIKQKLKIQ 234
           +++Y+SVK+ P      +DE+ IYS PTV G    S  ++  + K S+ SYF+K++LKIQ
Sbjct: 177 QLQYRSVKLQPAKVTKVKDEYLIYSEPTVPGGKQLSKKLIESNTKCSIGSYFLKKRLKIQ 236

Query: 235 NNLLDDKKEALAPLQKNLVDPMFQYQDLLXXXXXXXXXXXX-XDLYALHVLNHVYKTRDR 293
           N+LL++K + LA +QK LVDPMFQY+D+L               LYALH LNHVYKTRDR
Sbjct: 237 NDLLENKPDNLASIQKELVDPMFQYKDILYEYENYGKSEDEYRQLYALHALNHVYKTRDR 296

Query: 294 ILRNSQKLQDNSDQELLDQGFTRPKVLIVVPTRDVAYQIVTKIIEKSGLDQVDKRGKFQD 353
           IL+N+Q+LQ+NSD E LDQGFTRPKVLI+ PTRD AY IVT II KSG+DQVDKRGKF+D
Sbjct: 297 ILKNNQRLQENSDTECLDQGFTRPKVLIIAPTRDTAYSIVTTIINKSGIDQVDKRGKFKD 356

Query: 354 QFFDASLXXXXXXXXXXHIFKGNTNDFFVLGAKFTRKTLKLYSNFYQSDVIFCSPLGIQL 413
           QF++ SL           IFKGNTNDFFVLG KFTRK +KLYSNFYQSD+I CSPLG+Q+
Sbjct: 357 QFYEDSLPPSSKPKSFQSIFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIVCSPLGLQM 416

Query: 414 ILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNLSHITTIFQHINKIPQQQHDADFSRIR 473
           I+ENTDKKKRQDDFLSSIE+ +IDQLHSIEYQN+SH+ TIF+H+N IP +QHDADFSRIR
Sbjct: 417 IVENTDKKKRQDDFLSSIEITIIDQLHSIEYQNISHLYTIFEHLNNIPDEQHDADFSRIR 476

Query: 474 MWYINEQATLFRQTMVFTKYASPFANSLINGKCRNHAGRWKNHNIVLPEKSSINQLGLKV 533
           MWYIN+QA  FRQTMVFTKY SP ANS+INGKCRN +GRWKNH IV  E S I +L L+V
Sbjct: 477 MWYINDQARFFRQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGKLSLRV 536

Query: 534 RQIFQRFDLVGGSAMDEPDYRFKFFTSVIIASIIKSTGYEDGILLYIPDYTDYVRVRNHL 593
           RQIFQRF++ GGS +DEPDYRFKFFTSVII  I+KSTGYEDGIL+YIP+YTDYVRVRN+L
Sbjct: 537 RQIFQRFEVTGGSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVRVRNYL 596

Query: 594 REKTTLLFGDINEYSEQKQLTSNRALFQQGKVKVLLYTERLHHFRRYEIKGVKSVIFYKP 653
           +EKT +LFGDINEYS QKQLT+NR+LFQQG++KVLLYTERLHH+RRYEIKGVKSVIFYKP
Sbjct: 597 KEKTRILFGDINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKP 656

Query: 654 PTNPEFYREVVRYIGKSAFLGSADLNISTVRCVYCKLDGLSLERVVGTKRAAVLTHGQNE 713
           P++PEFY EVVR IG++AFLG+ DLNISTVRC+Y KLD L+LE VVGT+RA VL HGQNE
Sbjct: 657 PSDPEFYTEVVRNIGRNAFLGNTDLNISTVRCIYSKLDALALENVVGTQRAGVLCHGQNE 716

Query: 714 IYEFK 718
           IYEFK
Sbjct: 717 IYEFK 721

>TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa]
           {ON} Anc_2.292 YIL091C
          Length = 719

 Score =  850 bits (2196), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/648 (62%), Positives = 509/648 (78%), Gaps = 6/648 (0%)

Query: 77  KKQKVYNALLTLLESEHPHKKSKKN-REGGKEKQGNLQEGVETYSDEDEEEAIENALVET 135
           KK++VY+AL+T+L+SEH   K + N  E  KE+    ++  E    E EE+ IEN L+  
Sbjct: 72  KKKQVYDALVTILKSEHKEPKMRDNLNETSKEEHLTDEDLDEDEKFETEEQEIENNLLSI 131

Query: 136 NDDEDDV--GSDINGDEDDE--DKADSFELHFNNVSELQATKLASAFRDKKIRYKSVKVP 191
            DDE++     D  G+ DDE  +K+D F+ HFN  +E    K A AF++K+I+Y+S+K  
Sbjct: 132 KDDEEEGENNDDNAGESDDESDNKSDPFDSHFNQPTEQFTNKFADAFKNKQIKYRSIKYK 191

Query: 192 VNEDEFFIYSRPTVEGEDGSSVVAPSCKKSLHSYFIKQKLKIQNNLLDDKKEALAPLQKN 251
           +NE E  IYS P +  ++ + V +P  K S+HSY +K++LKI N+LLD     L  +QK 
Sbjct: 192 INEYESSIYSEPRILEDEQTKVKSPVLKSSIHSYALKKRLKINNDLLDPAVNNLTTIQKE 251

Query: 252 LVDPMFQYQDLLXXXXXX-XXXXXXXDLYALHVLNHVYKTRDRILRNSQKLQDNSDQELL 310
           LVDPMFQY+D+L               LY LHVLNH+YKTRDRIL+N+ K+QDN D E L
Sbjct: 252 LVDPMFQYKDILYEYGNYGKDEEEYRSLYCLHVLNHIYKTRDRILKNNSKVQDNPDAEFL 311

Query: 311 DQGFTRPKVLIVVPTRDVAYQIVTKIIEKSGLDQVDKRGKFQDQFFDASLXXXXXXXXXX 370
           DQGFTRPKVLIV PTRD  Y IV +II+KSG+DQ+DK+ KF+DQF++ SL          
Sbjct: 312 DQGFTRPKVLIVAPTRDAGYSIVNEIIKKSGIDQIDKKSKFRDQFYEESLLPASKPKSFQ 371

Query: 371 HIFKGNTNDFFVLGAKFTRKTLKLYSNFYQSDVIFCSPLGIQLILENTDKKKRQDDFLSS 430
            +FKGN+ND+FVLG KFTRK +KLYSNFYQSD+I CSPLG+ +ILENTDKKKRQDDFLSS
Sbjct: 372 AVFKGNSNDYFVLGIKFTRKAIKLYSNFYQSDIIVCSPLGLHMILENTDKKKRQDDFLSS 431

Query: 431 IELMVIDQLHSIEYQNLSHITTIFQHINKIPQQQHDADFSRIRMWYINEQATLFRQTMVF 490
           IELM+IDQLHS+E+QN+SH+T+IF+HINKIP++QHD DFSRI+MWYIN+QA LFRQTM+F
Sbjct: 432 IELMIIDQLHSMEFQNISHVTSIFEHINKIPKEQHDTDFSRIKMWYINDQAKLFRQTMIF 491

Query: 491 TKYASPFANSLINGKCRNHAGRWKNHNIVLPEKSSINQLGLKVRQIFQRFDLVGGSAMDE 550
           TKY SP AN  +NGKC+N +GRWKNH ++ P +SSI QLGL+V+Q+F RFD++GGS +DE
Sbjct: 492 TKYISPSANFFLNGKCQNWSGRWKNHKMITPNESSIGQLGLRVKQMFHRFDIIGGSIVDE 551

Query: 551 PDYRFKFFTSVIIASIIKSTGYEDGILLYIPDYTDYVRVRNHLREKTTLLFGDINEYSEQ 610
           PDYRFK+FTSVI+ SI KST YEDG+L+YI DYTDYVRVRN+L+EKTT+LFGDINEYS+Q
Sbjct: 552 PDYRFKYFTSVIVQSITKSTSYEDGMLIYITDYTDYVRVRNYLKEKTTILFGDINEYSDQ 611

Query: 611 KQLTSNRALFQQGKVKVLLYTERLHHFRRYEIKGVKSVIFYKPPTNPEFYREVVRYIGKS 670
           KQ+ SNRALFQQ +VKVLLYTERLHHFRRYEIKGVK+++FYK PTNPEFY EVVRYIGK+
Sbjct: 612 KQVNSNRALFQQRRVKVLLYTERLHHFRRYEIKGVKNIVFYKAPTNPEFYNEVVRYIGKN 671

Query: 671 AFLGSADLNISTVRCVYCKLDGLSLERVVGTKRAAVLTHGQNEIYEFK 718
           AF G+ D+NIS VR +Y KLDGL+LER++GTKRAAVLTHGQNE YEFK
Sbjct: 672 AFTGNTDINISNVRTIYSKLDGLALERIMGTKRAAVLTHGQNETYEFK 719

>TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {ON}
           Anc_2.292 YIL091C
          Length = 710

 Score =  846 bits (2186), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/716 (59%), Positives = 523/716 (73%), Gaps = 8/716 (1%)

Query: 4   VSKRSNRDESHGGYKKAKKTGRKELRTITRANARHANESKDDFENEPDMXXXXXXLADNK 63
           V  +SN DE+        K GRKELR+I R     A+E  +      +            
Sbjct: 2   VKDKSNGDEARRN--GTLKRGRKELRSIRRPQRNKAHEEPEHLNESSEGEVKNHHNGMQH 59

Query: 64  PRSXXXXXXXXXTKKQKVYNALLTLLESEHPHKKSKKNREGGKEKQGNLQEGVETYSDED 123
                        K++KVY ALLT+L SEHP  K K+       K+ +  +  E   DE 
Sbjct: 60  NEEIANVEEDEENKRRKVYGALLTILNSEHPKPKPKQEVTVQSRKEDSESDVEEDERDEV 119

Query: 124 EEEAIENALVETNDDEDDVGSDINGDEDDEDKADSFELHFNNVSELQATKLASAFRDKKI 183
           E+     A V+ N  EDD+    + DE+ +D+ D+F+ HFN V E    KL +AF+++++
Sbjct: 120 EQLEDNLARVDENPSEDDLSE--DADEESDDEQDTFDSHFNQVPENVVDKLDAAFKERQL 177

Query: 184 RYKSVKVPVNEDEFFIYSRPTVEGEDGSSVVAPSCKKSLHSYFIKQKLKIQNNLLDDKKE 243
           +YKS KVP+ E+E  +YS+P +  +    +  PS  +SL SY  KQ+LKIQN+L   + E
Sbjct: 178 KYKSAKVPIGENESMVYSKPLLLEDQSKKLEIPSRHESLKSYVFKQRLKIQNDL---EHE 234

Query: 244 ALAPLQKNLVDPMFQYQDLLXXXXXXXXXXXX-XDLYALHVLNHVYKTRDRILRNSQKLQ 302
            L   Q+ LVDPM QY DLL              DLYALHVLNHVYKTRD+IL+N+Q++ 
Sbjct: 235 NLTSTQRTLVDPMLQYNDLLYEYNSYEKDEDEYRDLYALHVLNHVYKTRDKILKNNQRIS 294

Query: 303 DNSDQELLDQGFTRPKVLIVVPTRDVAYQIVTKIIEKSGLDQVDKRGKFQDQFFDASLXX 362
           DN D + LDQGFTRPKVLIVVPTRD AYQ++ KII+KSG+DQ+DK+GKF+DQFF+ SL  
Sbjct: 295 DNPDADYLDQGFTRPKVLIVVPTRDTAYQVLEKIIDKSGIDQIDKKGKFRDQFFEESLPP 354

Query: 363 XXXXXXXXHIFKGNTNDFFVLGAKFTRKTLKLYSNFYQSDVIFCSPLGIQLILENTDKKK 422
                   H+FKGNTNDFFVLG KFTRK +KLYSNFYQSD+I CSPLGIQLILENTDKKK
Sbjct: 355 SSKPKSFQHVFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQLILENTDKKK 414

Query: 423 RQDDFLSSIELMVIDQLHSIEYQNLSHITTIFQHINKIPQQQHDADFSRIRMWYINEQAT 482
           RQDDFLSSIE+ + DQLHSIEYQN+SH+ TIF H+N IPQ+QHD DF R+R+WYINEQA 
Sbjct: 415 RQDDFLSSIEISIFDQLHSIEYQNVSHVMTIFDHLNLIPQEQHDTDFGRVRLWYINEQAK 474

Query: 483 LFRQTMVFTKYASPFANSLINGKCRNHAGRWKNHNIVLPEKSSINQLGLKVRQIFQRFDL 542
           LFRQTM+FTKY SP AN+LIN KC+N  GRWKNH+ + P +SSI +LGLKVRQIFQR DL
Sbjct: 475 LFRQTMIFTKYVSPTANALINNKCQNMTGRWKNHHFIEPNQSSIGKLGLKVRQIFQRIDL 534

Query: 543 VGGSAMDEPDYRFKFFTSVIIASIIKSTGYEDGILLYIPDYTDYVRVRNHLREKTTLLFG 602
              S ++E D+RFKFFTSVII SIIKSTGYEDGIL+YIPDY D++RVRN+++EKTT++FG
Sbjct: 535 GAASILEESDFRFKFFTSVIIPSIIKSTGYEDGILVYIPDYADFIRVRNYMKEKTTIIFG 594

Query: 603 DINEYSEQKQLTSNRALFQQGKVKVLLYTERLHHFRRYEIKGVKSVIFYKPPTNPEFYRE 662
           DINEYS QKQL SNRALFQQG+ KVLLYTERLHHFRRYEIKGVKSV+FY+PPTNPEFY E
Sbjct: 595 DINEYSNQKQLNSNRALFQQGRAKVLLYTERLHHFRRYEIKGVKSVVFYQPPTNPEFYSE 654

Query: 663 VVRYIGKSAFLGSADLNISTVRCVYCKLDGLSLERVVGTKRAAVLTHGQNEIYEFK 718
           VVR+I KSA LG+ DLNISTVR +Y KLDG+SLER+VGTKRAA+LTHGQNE+YEFK
Sbjct: 655 VVRFIAKSAALGTTDLNISTVRTIYSKLDGISLERIVGTKRAAILTHGQNEVYEFK 710

>Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa]
           {ON} complement(138925..141039) [2115 nt, 705 aa]
          Length = 704

 Score =  827 bits (2137), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/713 (58%), Positives = 536/713 (75%), Gaps = 23/713 (3%)

Query: 15  GGYKKAKKTGRKELRTITRAN----ARHANESKDDFENEPDMXXXXXXLADNKPRSXXXX 70
           G  +  KK GR ELR+I R N    ++H  +   + ENE          + +        
Sbjct: 6   GTSEGPKKRGRTELRSIRRPNRSQHSKHDQQVVHESENE-----DSLESSSDDDEDIAQA 60

Query: 71  XXXXXTKKQKVYNALLTLLESEHPHKKSKKNREGGKEKQGNLQE----GVETYSDEDEEE 126
                 +K+KVY ALLT+L SEHP +K  K+      K+ + QE    G+ + S+E++EE
Sbjct: 61  EAENSDRKEKVYGALLTILNSEHPERKKHKSHSTDFVKEIDEQEEIEQGMASESEEEDEE 120

Query: 127 AIENALVETNDDEDDVGSDINGDEDDEDKADSFELHFNNVSELQATKLASAFRDKKIRYK 186
             E    E +++E++  +D         + D+FE HFN+VS+     +++ F+DK+I+YK
Sbjct: 121 NDEEESNEGDEEEEEEPTD---------QLDTFESHFNDVSQDLVDDISAGFKDKQIKYK 171

Query: 187 SVKVPVNEDEFFIYSRPTVEGEDGSSVVAPSCKKSLHSYFIKQKLKIQNNLLDDKKEALA 246
           S+K  +++ E  I+ +P +  +   ++  P    S  SYFIKQ+LKIQN+LLD  KE L 
Sbjct: 172 SMKYSLDKKESAIFGKPLLLTQQDETIDNPVLTSSYDSYFIKQRLKIQNDLLDSSKENLT 231

Query: 247 PLQKNLVDPMFQYQDLLXXXXXXXX-XXXXXDLYALHVLNHVYKTRDRILRNSQKLQDNS 305
           PL+K L+DPMFQY+D+L              +LY+LHVLNH+YKTRD+IL+++Q+LQ+N 
Sbjct: 232 PLKKKLLDPMFQYKDVLCEYTNYENDEKEYRELYSLHVLNHIYKTRDKILKDNQRLQEND 291

Query: 306 DQELLDQGFTRPKVLIVVPTRDVAYQIVTKIIEKSGLDQVDKRGKFQDQFFDASLXXXXX 365
           D E LDQGFTRPKVLIVVPTRD AYQ+V  IIEKSGLDQ+DK+GKF+DQFFD SL     
Sbjct: 292 DLECLDQGFTRPKVLIVVPTRDTAYQVVETIIEKSGLDQIDKKGKFKDQFFDDSLPPTSK 351

Query: 366 XXXXXHIFKGNTNDFFVLGAKFTRKTLKLYSNFYQSDVIFCSPLGIQLILENTDKKKRQD 425
                H+FKGNTNDFFVLG KFTRK +KLYSNFYQSD+I CSPLGIQ+ILENTDKKKRQD
Sbjct: 352 PKSFRHVFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQD 411

Query: 426 DFLSSIELMVIDQLHSIEYQNLSHITTIFQHINKIPQQQHDADFSRIRMWYINEQATLFR 485
           DFLSSIE+M++DQLHSIEYQN+SH+ TI +HINKIPQQQ +ADFSRIRMWYIN+QA   R
Sbjct: 412 DFLSSIEVMIVDQLHSIEYQNISHVYTILEHINKIPQQQREADFSRIRMWYINDQAKFLR 471

Query: 486 QTMVFTKYASPFANSLINGKCRNHAGRWKNHNIVLPEKSSINQLGLKVRQIFQRFDLVGG 545
           QTM+FT+Y SP AN++INGKC N AGRWKN+ I+  E SSI QLG+K++QIFQRFDLVGG
Sbjct: 472 QTMLFTRYISPTANAIINGKCHNMAGRWKNNQIISSEDSSIGQLGIKIKQIFQRFDLVGG 531

Query: 546 SAMDEPDYRFKFFTSVIIASIIKSTGYEDGILLYIPDYTDYVRVRNHLREKTTLLFGDIN 605
           + +DE DYRFK+FTSV++ +I+KSTGYEDGIL+YIP+YTDY+R+RN+++EKTT+LF +IN
Sbjct: 532 TVVDESDYRFKYFTSVVMQNIVKSTGYEDGILVYIPEYTDYMRLRNYMKEKTTILFSEIN 591

Query: 606 EYSEQKQLTSNRALFQQGKVKVLLYTERLHHFRRYEIKGVKSVIFYKPPTNPEFYREVVR 665
           EYS QKQL SNR++FQQG+ KVLLYTERLHH+RRYE+KG+KSVIFYKPPTNPEFY EV+R
Sbjct: 592 EYSTQKQLDSNRSMFQQGRTKVLLYTERLHHYRRYELKGIKSVIFYKPPTNPEFYNEVIR 651

Query: 666 YIGKSAFLGSADLNISTVRCVYCKLDGLSLERVVGTKRAAVLTHGQNEIYEFK 718
           +  K+AFLG +D+NIST+R VY KLDGL+L+R+VG+KRAA+L HGQNE Y+FK
Sbjct: 652 FTAKNAFLGKSDINISTIRTVYSKLDGLALQRIVGSKRAAILCHGQNESYDFK 704

>ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 709

 Score =  827 bits (2135), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/705 (60%), Positives = 529/705 (75%), Gaps = 16/705 (2%)

Query: 20  AKKTGRKELRTITRANARHANESKDDFENEPDMXXXXXXLADNKPRSXXXXXXXXXTKKQ 79
           ++K GRK+LR+I RA  R+  E  ++ E  P        L+++               K+
Sbjct: 15  SRKRGRKDLRSIRRA--RNDKEPVEEPEI-PVASEEDGELSEDSEEDATNEVQEQEDSKE 71

Query: 80  KVYNALLTLLESEHPHKKSKKNREGGKEKQGNLQEGVETYSD--EDEEEAIENALVET-- 135
           K Y ALLT+L+SEHP  + ++ R+    K+ +LQ+   +  +  EDE+  +E  LV+T  
Sbjct: 72  KAYGALLTILKSEHPEDRQRERRK----KKQDLQDPSSSDDELSEDEKGEVEANLVDTPG 127

Query: 136 -NDDEDDVGSDINGDEDDEDKADSFELHFNNVSELQATKLASAFRDKKIRYKSVKVPVNE 194
             + + +       +++ ED+ D FE HFN  SE     L  A++ KKI  KS K+ V++
Sbjct: 128 EEEPQSEEELSEGDEDESEDERDPFESHFNMQSE-SIDSLDEAWKQKKIVNKSGKIRVDD 186

Query: 195 DEFFIYSRPTVEGEDGSSVVAPSCKKSLHSYFIKQKLKIQNNLLDDKKEALAPLQKNLVD 254
           DE  IY++ T+ G+ G     PS K  L SY +K+KLKIQNNLL+ + + L PLQ+ +VD
Sbjct: 187 DESLIYTK-TLAGK-GQEFELPSHKGHLSSYPLKRKLKIQNNLLESQDDVLTPLQRKIVD 244

Query: 255 PMFQYQDLLXXXXXXXXXXXX-XDLYALHVLNHVYKTRDRILRNSQKLQDNSDQELLDQG 313
           P+FQY+DLL              DLY LHVLNH+YKTRDRIL+++Q+L  N D E LDQG
Sbjct: 245 PIFQYRDLLYEYEDYEQDEDEYRDLYVLHVLNHIYKTRDRILKDNQRLATNPDGEFLDQG 304

Query: 314 FTRPKVLIVVPTRDVAYQIVTKIIEKSGLDQVDKRGKFQDQFFDASLXXXXXXXXXXHIF 373
           FTRPKVLIV PTRD AYQIV+K+IEKSGLDQVDK+ K +DQFF+  L          H F
Sbjct: 305 FTRPKVLIVAPTRDTAYQIVSKVIEKSGLDQVDKKSKLRDQFFEDVLPPSSKPKSFRHTF 364

Query: 374 KGNTNDFFVLGAKFTRKTLKLYSNFYQSDVIFCSPLGIQLILENTDKKKRQDDFLSSIEL 433
           KGNTNDFFVLG KFTRK ++LYSNFYQSD+I CSPLG+QLILENTD+KKRQDDFLSSIEL
Sbjct: 365 KGNTNDFFVLGVKFTRKAIRLYSNFYQSDLIVCSPLGLQLILENTDRKKRQDDFLSSIEL 424

Query: 434 MVIDQLHSIEYQNLSHITTIFQHINKIPQQQHDADFSRIRMWYINEQATLFRQTMVFTKY 493
           M+IDQL+SIE+QN+SH+ TIF H+NKIP++QHD DF R+RMWYINEQA L RQT++FT+Y
Sbjct: 425 MIIDQLNSIEFQNVSHLFTIFAHMNKIPKEQHDTDFGRVRMWYINEQAKLLRQTLIFTRY 484

Query: 494 ASPFANSLINGKCRNHAGRWKNHNIVLPEKSSINQLGLKVRQIFQRFDLVGGSAMDEPDY 553
            +P AN L+NGKCRN  GRWKNH+ +  E+SS+++LG +VRQIFQR DL G S +DEPDY
Sbjct: 485 VTPTANFLLNGKCRNIGGRWKNHHQITGEQSSVSKLGFRVRQIFQRVDLGGASVVDEPDY 544

Query: 554 RFKFFTSVIIASIIKSTGYEDGILLYIPDYTDYVRVRNHLREKTTLLFGDINEYSEQKQL 613
           RF+FFTSVI+ SI KSTGYEDGILLYIPDY D++RVRN+L++KTT+LFGDINEYS+ +QL
Sbjct: 545 RFRFFTSVIVPSITKSTGYEDGILLYIPDYADFIRVRNYLKDKTTILFGDINEYSDVRQL 604

Query: 614 TSNRALFQQGKVKVLLYTERLHHFRRYEIKGVKSVIFYKPPTNPEFYREVVRYIGKSAFL 673
           TS R+LFQQG++KVLLYTERLHHFRRYEIKGVKSVIFY+PP+NPEFY EVVRYIGKSAFL
Sbjct: 605 TSTRSLFQQGRIKVLLYTERLHHFRRYEIKGVKSVIFYQPPSNPEFYNEVVRYIGKSAFL 664

Query: 674 GSADLNISTVRCVYCKLDGLSLERVVGTKRAAVLTHGQNEIYEFK 718
           G  DLNISTVRCVY KLDGL+LER+V +KRAAVLTHGQNEIYEFK
Sbjct: 665 GDTDLNISTVRCVYSKLDGLALERIVSSKRAAVLTHGQNEIYEFK 709

>CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091c
          Length = 700

 Score =  826 bits (2133), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/706 (60%), Positives = 520/706 (73%), Gaps = 17/706 (2%)

Query: 22  KTGRKELRTITRANARHANESKDDFENEPDMXXXXXXL-ADNKPRSXXXXXXXXXTKKQK 80
           K GRKELR+I     R A  +K + E +  +      L A                 K++
Sbjct: 3   KRGRKELRSI-----RRAKRTKIEPEADAGVESSGSVLEAGPAVEEKVQDDGEKEDDKEQ 57

Query: 81  VYNALLTLLESEHPHKKSKKNREGGKEKQGNLQEGVETYSDEDEEEAIENALVETNDDED 140
           VYNALLT+L+SEH   K K +R+  +E+    +E        D   A   +  E +D+++
Sbjct: 58  VYNALLTILKSEHKEDKVKTHRDHDEEESEAEEEEQAEDQYNDAF-ADGESDDEDDDEDE 116

Query: 141 DVGSDINGDEDDEDKADSFELHFNNVSELQ-ATKLASAFRDKKIRYKSVKVPV---NED- 195
                   + DDE+K D F+ HFN     +    L +A +D K+RYKS+K+ V   +ED 
Sbjct: 117 QAQEQEEIESDDEEK-DPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQ 175

Query: 196 --EFFIYSRPTVEGEDGSSVVAPSCKKSLHSYFIKQKLKIQNNLLDDKKEALAPLQKNLV 253
             E  I+S P +EGE    +  P  K SL SYF+K++L+IQNNLLD +  AL  LQ+ +V
Sbjct: 176 VQEDAIFSVPYIEGE-TPKIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNALTDLQRKIV 234

Query: 254 DPMFQYQDLLXXXXXX-XXXXXXXDLYALHVLNHVYKTRDRILRNSQKLQDNSDQELLDQ 312
           DPM QY+D+L              DLY LHVLNHVYKTRD+I++N+QKLQDN D E LDQ
Sbjct: 235 DPMMQYKDILYEYDTYGKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQ 294

Query: 313 GFTRPKVLIVVPTRDVAYQIVTKIIEKSGLDQVDKRGKFQDQFFDASLXXXXXXXXXXHI 372
           GFTRPKVLI+ PTRD AYQIVTK+IEKSGLDQVDK+GKF+DQF+D S           HI
Sbjct: 295 GFTRPKVLIIAPTRDSAYQIVTKLIEKSGLDQVDKKGKFRDQFYDPSFPPSSKPKSFQHI 354

Query: 373 FKGNTNDFFVLGAKFTRKTLKLYSNFYQSDVIFCSPLGIQLILENTDKKKRQDDFLSSIE 432
           FKGNTND+FVLG KFTRK +KLYSNFYQSD+I CSPLG+Q+I+ENTDKKKRQDDFLSS+E
Sbjct: 355 FKGNTNDYFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVE 414

Query: 433 LMVIDQLHSIEYQNLSHITTIFQHINKIPQQQHDADFSRIRMWYINEQATLFRQTMVFTK 492
           + +IDQ HSIEYQN +H+ TIF H+NKIPQ+QHDADFSRIRMWYIN+QA  FRQTM+FTK
Sbjct: 415 VTIIDQFHSIEYQNYTHLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTK 474

Query: 493 YASPFANSLINGKCRNHAGRWKNHNIVLPEKSSINQLGLKVRQIFQRFDLVGGSAMDEPD 552
           Y SP ANSL+N KCRN  GRWKNH IV  E SS+  +GLKVRQIFQRF+++G S  DEPD
Sbjct: 475 YISPVANSLLNIKCRNLEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPD 534

Query: 553 YRFKFFTSVIIASIIKSTGYEDGILLYIPDYTDYVRVRNHLREKTTLLFGDINEYSEQKQ 612
           YRFKFFTSV+I++I KSTGY+DG L+YIP+Y+DYVRVRN+++EKT++LFGDINEYSEQ+ 
Sbjct: 535 YRFKFFTSVVISNITKSTGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRS 594

Query: 613 LTSNRALFQQGKVKVLLYTERLHHFRRYEIKGVKSVIFYKPPTNPEFYREVVRYIGKSAF 672
           LTSNR LF QG++KVLLYTERLHHFRRYE+KGVK+V+FYKPP++PEFY+EVVRYIGK+ F
Sbjct: 595 LTSNRTLFNQGRLKVLLYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVF 654

Query: 673 LGSADLNISTVRCVYCKLDGLSLERVVGTKRAAVLTHGQNEIYEFK 718
           LG ADLNISTVRC Y KLDGL+LE++VGTKR  VLTHGQNE YEFK
Sbjct: 655 LGDADLNISTVRCCYSKLDGLALEKIVGTKRTGVLTHGQNETYEFK 700

>ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL091C
          Length = 704

 Score =  820 bits (2117), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/702 (58%), Positives = 520/702 (74%), Gaps = 15/702 (2%)

Query: 22  KTGRKELRTITR-ANARHANESKDDFENEPDMXXXXX-XLADNKPRSXXXXXXXXXTKKQ 79
           K GRK+LR ITR   A H  E +     E  +          N+ R           ++ 
Sbjct: 13  KRGRKQLRNITRIGRAIHVQEDEAKSREEHTVEEAQAGEQTSNRKRGNHPAEDDGGARES 72

Query: 80  KVYNALLTLLESEHPHKKSKKNREGGKEKQGNLQEGVETYSDEDEEEAIENALVETNDDE 139
           + Y ALLTLL +EH  ++ K+ R+   E +           +E    A+EN+  +  D E
Sbjct: 73  QSYGALLTLLSAEHGKQRKKRLRK--AEAEAAEAAEAGEDPEEAITAALENSAQDAEDAE 130

Query: 140 DDVGSDINGDEDDEDKADSFELHFNNVSELQATKLASAFRDKKIRYKSVKVPVNEDEFFI 199
           D    D +G+ D+E   D F++HFN VS     +L +AF++ + +Y+  K    E+E  +
Sbjct: 131 D--AFDDSGESDEEQ--DHFDVHFNRVSAADVAQLDAAFKNGRAQYRVQKEARGEEEI-L 185

Query: 200 YSRPTV--EGEDGSSVVAPSCKKSLHSYFIKQKLKIQNNL-LDDKKEALAPLQKNLVDPM 256
           YS+P    EG +G  V  P+  +SL  Y IKQ+L++ N L  DD ++ L P QK L+DPM
Sbjct: 186 YSKPVASSEGTEGP-VRVPA--RSLRGYAIKQRLRMHNGLTADDPEKPLTPQQKVLLDPM 242

Query: 257 FQYQDLLXXXXXXXXXXXXXDLYALHVLNHVYKTRDRILRNSQKLQDNSDQELLDQGFTR 316
           FQYQD+L             +LY LH+LNHVYKTRDRIL+N+QKLQDN DQELLDQGFTR
Sbjct: 243 FQYQDILYEYEGYDREREYRELYTLHILNHVYKTRDRILKNNQKLQDNPDQELLDQGFTR 302

Query: 317 PKVLIVVPTRDVAYQIVTKIIEKSGLDQVDKRGKFQDQFFDASLXXXXXXXXXXHIFKGN 376
           PK L+VVPTR  AY +V  ++++SG++QVDK+ KF+DQF+D SL          H+FKGN
Sbjct: 303 PKALVVVPTRATAYDVVDLLLQQSGIEQVDKKSKFKDQFYDPSLPPASKPKSFQHVFKGN 362

Query: 377 TNDFFVLGAKFTRKTLKLYSNFYQSDVIFCSPLGIQLILENTDKKKRQDDFLSSIELMVI 436
           TNDFFVLG KFTRK ++LYSNFYQSDVI CSPLG+QLI+ENTDKKKRQDDFLSSIE+MV+
Sbjct: 363 TNDFFVLGMKFTRKAIRLYSNFYQSDVIVCSPLGLQLIIENTDKKKRQDDFLSSIEVMVL 422

Query: 437 DQLHSIEYQNLSHITTIFQHINKIPQQQHDADFSRIRMWYINEQATLFRQTMVFTKYASP 496
           DQLHSIE+QN++H++ IF HINKIPQQQ DADFSRIRMWYI +QA LFRQTMVFT+Y SP
Sbjct: 423 DQLHSIEFQNIAHVSNIFAHINKIPQQQRDADFSRIRMWYIEDQAKLFRQTMVFTRYISP 482

Query: 497 FANSLINGKCRNHAGRWKNHNIVLPEKSSINQLGLKVRQIFQRFDLVGGSAMDEPDYRFK 556
           FAN+L+N KC N AGR K+H +V  EKS I QLGLK+RQIFQRF+++GGS +DEPD+RFK
Sbjct: 483 FANALLNRKCANWAGRVKSHRVVSAEKSVIGQLGLKLRQIFQRFEVLGGSTVDEPDFRFK 542

Query: 557 FFTSVIIASIIKSTGYEDGILLYIPDYTDYVRVRNHLREKTTLLFGDINEYSEQKQLTSN 616
           FFTSV++  I K+TGY+ GILLYIP+YTD++RVRN+L++KT +LFGDINEYS+Q+QLTSN
Sbjct: 543 FFTSVVVPGIEKTTGYDSGILLYIPEYTDFIRVRNYLKDKTRILFGDINEYSDQRQLTSN 602

Query: 617 RALFQQGKVKVLLYTERLHHFRRYEIKGVKSVIFYKPPTNPEFYREVVRYIGKSAFLGSA 676
           RALFQ G++KVLLYTERLHHFRR+E+KGVKSVI YKPP+NPEFY+E++RYIGKSAFLG A
Sbjct: 603 RALFQLGRIKVLLYTERLHHFRRFELKGVKSVILYKPPSNPEFYQELLRYIGKSAFLGVA 662

Query: 677 DLNISTVRCVYCKLDGLSLERVVGTKRAAVLTHGQNEIYEFK 718
           DLNI+TVRC+Y K+D L+LER+VGTKRAAVLTHGQNE+YEFK
Sbjct: 663 DLNIATVRCLYSKMDSLALERIVGTKRAAVLTHGQNEVYEFK 704

>TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.292
           YIL091C
          Length = 716

 Score =  811 bits (2094), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/733 (57%), Positives = 542/733 (73%), Gaps = 47/733 (6%)

Query: 15  GGYKKAKKTGRKELRTITRA--------------NARHANESK--------DDFENEPDM 52
            G  + KK GR +LRTI R+              N +H +ESK        ++ E+E D 
Sbjct: 2   SGRGEFKKRGRSQLRTIQRSKYAKKRNSGRNYDTNTKHNDESKPADALVSGEEAESESDD 61

Query: 53  XXXXXXLADNKPRSXXXXXXXXXTKKQKVYNALLTLLESEHPHKKSKKNREGGKEKQGNL 112
                 +                 K+ +VY ALLT+L+SEHP KK +K +   +++    
Sbjct: 62  AKDEEDVG---------------KKRNQVYGALLTILKSEHPEKKKQKKKFNQEKEDA-Y 105

Query: 113 QEGVETYSDEDEEEAIENALVETNDDEDDVGSDINGDEDDEDKADS----FELHFNNVSE 168
               + Y+  D++E IEN L +  DD +D   +   + +++D++D     F++HFN V E
Sbjct: 106 NASDDEYNVSDKQE-IENGLEDQQDDNEDENENDMENMENDDESDDDTDLFDIHFNQVPE 164

Query: 169 LQATKLASAFRDKKIRY--KSVKVPVNEDEFFIYSRPTVEGEDGSSVVAPSCKKSLHSYF 226
               K+++ F +KKI+Y  K +++P +E +FFIYS+P V+  +   V +P  K SL SYF
Sbjct: 165 NVVDKISNGFDNKKIKYVSKKIQLPHHEKDFFIYSKPIVDDGNKHKVESPIKKSSLDSYF 224

Query: 227 IKQKLKIQNNLLDDKKEALAPLQKNLVDPMFQYQDLLXXXXXXXX-XXXXXDLYALHVLN 285
           IK++L+I NNLLD K + L  LQK+LVDPMFQY D+L              +LY LH+LN
Sbjct: 225 IKKRLEITNNLLDGK-DNLTKLQKSLVDPMFQYVDILHEYENYGSDEQEYRELYTLHILN 283

Query: 286 HVYKTRDRILRNSQKLQDNSDQELLDQGFTRPKVLIVVPTRDVAYQIVTKIIEKSGLDQV 345
           H+YKTRD++L+++Q+LQ+N++ E LDQGFTRPKVLIVVPTRD AY +V  II KSGLDQV
Sbjct: 284 HLYKTRDKVLKDNQRLQENNESEFLDQGFTRPKVLIVVPTRDTAYNVVETIIRKSGLDQV 343

Query: 346 DKRGKFQDQFFDASLXXXXXXXXXXHIFKGNTNDFFVLGAKFTRKTLKLYSNFYQSDVIF 405
           +K+GKF+ QFF+ SL           IFKGNTNDFFVLG KFTRK LKLYSNFYQSDVI 
Sbjct: 344 EKKGKFKSQFFEDSLPPSSKPKSFQSIFKGNTNDFFVLGLKFTRKALKLYSNFYQSDVII 403

Query: 406 CSPLGIQLILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNLSHITTIFQHINKIPQQQH 465
           CSPLG+ +I ENTDKKK+QDDFLSSIE+ ++DQLHS+EYQN+SHI  IF+H+NKIP++QH
Sbjct: 404 CSPLGLHMITENTDKKKKQDDFLSSIEITILDQLHSMEYQNISHIMNIFEHLNKIPREQH 463

Query: 466 DADFSRIRMWYINEQATLFRQTMVFTKYASPFANSLINGKCRNHAGRWKNHNIVLPEKSS 525
           DADFSRIRMWYIN+QA LFRQTM+FTKY SP AN++INGKCRN AGRW+N   +  E+SS
Sbjct: 464 DADFSRIRMWYINDQARLFRQTMIFTKYVSPTANAMINGKCRNIAGRWRNKIQLTSEESS 523

Query: 526 INQLGLKVRQIFQRFDLVGGSAMDEPDYRFKFFTSVIIASIIKSTGYEDGILLYIPDYTD 585
           + +LGLK+RQIFQRFDLVGG+  DEPD+RFKFF SV++ SI+KSTGYEDGIL+YIP+Y+D
Sbjct: 524 LGKLGLKIRQIFQRFDLVGGTLADEPDFRFKFFVSVVMNSILKSTGYEDGILVYIPNYSD 583

Query: 586 YVRVRNHLREKTTLLFGDINEYSEQKQLTSNRALFQQGKVKVLLYTERLHHFRRYEIKGV 645
           Y+RVRN+++EKTTLLFGDINEYS+Q++L SNR+LFQQG+VKVLLYTERLHH+RRYEIKGV
Sbjct: 584 YMRVRNYMKEKTTLLFGDINEYSDQRELNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGV 643

Query: 646 KSVIFYKPPTNPEFYREVVRYIGKSAFLGSADLNISTVRCVYCKLDGLSLERVVGTKRAA 705
           KSVIFY PPTNPEFY EVVR+IGK+AFLG+ D+NI+TVR VY KLD LSLER+VGT+RAA
Sbjct: 644 KSVIFYGPPTNPEFYNEVVRFIGKNAFLGNVDINIATVRMVYSKLDSLSLERIVGTQRAA 703

Query: 706 VLTHGQNEIYEFK 718
           VL+  +NE+YEFK
Sbjct: 704 VLSRAENEVYEFK 716

>Suva_2.409 Chr2 complement(727948..729717) [1770 bp, 589 aa] {ON}
           YDR243C (REAL)
          Length = 589

 Score = 35.8 bits (81), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 61/132 (46%), Gaps = 17/132 (12%)

Query: 549 DEPDYRFKFFTSVIIASIIKSTGYEDGILLYI--PDYTDYV--RVRNHLREKTTLLFGDI 604
           D  D +FK   SV+       T YE  I+++I      D++  + +N    K T+L G  
Sbjct: 420 DNDDQKFKKLRSVV-------TKYEPPIIVFINYKQTADWLAEKFQNETNMKVTILHGS- 471

Query: 605 NEYSEQKQLTSNRALFQQGKVKVLLYTERLHHFRRYEIKGVKSVIFYKPPTNPEFYREVV 664
                Q+Q   +  LF+ GKV++++ T      R  +I  V  V+ ++ P   + Y   +
Sbjct: 472 ---KSQEQREHSLKLFRSGKVQIMVATNVAA--RGLDIPNVSLVVNFQIPKKIDDYIHRI 526

Query: 665 RYIGKSAFLGSA 676
              G++A  G+A
Sbjct: 527 GRTGRAAKEGTA 538

>ZYRO0G15708g Chr7 complement(1277152..1281564) [4413 bp, 1470 aa]
           {ON} similar to uniprot|Q12697 Saccharomyces cerevisiae
           YOR291W Hypothetical ORF
          Length = 1470

 Score = 35.0 bits (79), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 37/76 (48%), Gaps = 9/76 (11%)

Query: 645 VKSVIFYKPPTNPEFYREVVRYIGKSAFLGSADLNISTVRCVYCKLDGLSL--------E 696
           ++S++F KP TN +FYR+  +YIG    +     +IS +R +   LD  ++         
Sbjct: 683 IRSMVFPKP-TNFKFYRDSFKYIGFMTMVALLGFSISCMRFIQIGLDKKTMILRALDIIT 741

Query: 697 RVVGTKRAAVLTHGQN 712
            VV     A LT G N
Sbjct: 742 VVVPPALPATLTIGTN 757

>TDEL0B03520 Chr2 complement(626658..631046) [4389 bp, 1462 aa] {ON}
           Anc_8.758 YOR291W
          Length = 1462

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 37/76 (48%), Gaps = 9/76 (11%)

Query: 645 VKSVIFYKPPTNPEFYREVVRYIGKSAFLGSADLNISTVRCVYCKLDGLSL--------E 696
           V+S++F KP T+ +FY +  +YIG  A +     +IS VR +   LD  ++         
Sbjct: 675 VRSMVFPKP-TSFKFYEDSFKYIGFMAIIAMLGFSISCVRFIQIGLDKKTMLLRALDIIT 733

Query: 697 RVVGTKRAAVLTHGQN 712
            VV     A LT G N
Sbjct: 734 IVVPPALPATLTIGTN 749

>CAGL0H01243g Chr8 (117461..120745) [3285 bp, 1094 aa] {ON} highly
           similar to uniprot|Q05549 Saccharomyces cerevisiae
           YDR291w
          Length = 1094

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 45/82 (54%), Gaps = 8/82 (9%)

Query: 403 VIFCSPLGIQL-ILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNLSHITTIFQHINKIP 461
           VIF +P  I   IL N    +R   FL ++ L+VID+LH  +    SH+  + + + ++ 
Sbjct: 396 VIFTNPDMIHASILPNHVNWRR---FLFNLHLVVIDELHIYKGLFGSHVALVMRRLLRLC 452

Query: 462 QQQHDADFSRIRMWYINEQATL 483
           ++ +D  F+R    +I+  ATL
Sbjct: 453 REHYDNFFTR----FISCSATL 470

>NCAS0C03430 Chr3 (672540..687344) [14805 bp, 4934 aa] {ON} Anc_8.295
            YLR106C
          Length = 4934

 Score = 33.1 bits (74), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 2/69 (2%)

Query: 90   ESEHPHKKSKKNREGGKEKQGNLQEGVETYSDEDEEEAIENALVETNDDEDDVGSDINGD 149
            E E   +  + N+E G E+     +G+E   +ED+ EA   A V+ N+     GSD   D
Sbjct: 4381 EDELADEDQRANKEQGGEETAEGLDGIEEEMNEDDIEA--EAAVQQNEGSKGAGSDAKDD 4438

Query: 150  EDDEDKADS 158
            ++ ED   S
Sbjct: 4439 KEQEDIGSS 4447

>KLLA0A06842g Chr1 complement(618848..620818) [1971 bp, 656 aa] {ON}
           conserved hypothetical protein
          Length = 656

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 36/71 (50%), Gaps = 7/71 (9%)

Query: 89  LESEHPHKKSKKNRE---GGKEKQGNLQEGVETYSDEDEEEAIENALVETNDDEDDVGS- 144
           L + H  + + + R    G KE    L++    YS  DE+   E + ++ N+D+DD+ S 
Sbjct: 154 LATGHLGRSNGRKRTSLLGSKEDI--LRDAENGYSSADEDATEEESTLDINEDDDDIHSF 211

Query: 145 -DINGDEDDED 154
            DI  D D ED
Sbjct: 212 ADIFSDPDVED 222

>TDEL0B05050 Chr2 (882443..885247) [2805 bp, 934 aa] {ON} Anc_2.143
           YNL127W
          Length = 934

 Score = 32.3 bits (72), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 42/83 (50%), Gaps = 14/83 (16%)

Query: 98  SKKNREG--GKEKQGNLQEGVETYSDEDEEEAIENALVETNDDEDDV-GSDINGDEDDED 154
           S K+R G  G+       +  E Y D DE  + +N   + ND+E+ V G +++GDEDDED
Sbjct: 94  SFKSRSGFEGRISTVAFDDDNEEYQDNDEL-SFDNR--QGNDEEEFVLGENVDGDEDDED 150

Query: 155 KADSFELHFNNVSELQATKLASA 177
                   F NV E+    LA A
Sbjct: 151 --------FTNVDEIDGPILAKA 165

>KNAG0J02350 Chr10 (440853..443870) [3018 bp, 1005 aa] {ON}
           Anc_3.309 YDR060W
          Length = 1005

 Score = 32.3 bits (72), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 32/48 (66%), Gaps = 2/48 (4%)

Query: 106 KEKQGNLQEGVETYSDEDEEEAIENALVETNDD-EDDVGSDINGDEDD 152
           K+KQ N   G ++  + +E++ I NALV++  D EDD G ++N DEDD
Sbjct: 861 KDKQRNASSGNDSEGEMNEDD-IWNALVKSRPDVEDDSGDEMNFDEDD 907

>CAGL0M11616g Chr13 complement(1143091..1157733) [14643 bp, 4880 aa]
            {ON} similar to uniprot|Q12019 Saccharomyces cerevisiae
            YLR106c
          Length = 4880

 Score = 31.6 bits (70), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 28/59 (47%), Gaps = 2/59 (3%)

Query: 100  KNREGGKEKQGNLQEGVETYSDEDEEEAIENALVETNDDEDDVGSDINGDEDDEDKADS 158
            +N E G        EG+E Y D ++E +  NA  E N      G+D   DED E+  DS
Sbjct: 4333 ENGETGTNIDDEGAEGIENYLDNNDETSEANA--EQNAGAKGAGADTKDDEDQENIGDS 4389

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 77,540,930
Number of extensions: 3606567
Number of successful extensions: 37328
Number of sequences better than 10.0: 958
Number of HSP's gapped: 33624
Number of HSP's successfully gapped: 1207
Length of query: 718
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 601
Effective length of database: 40,065,477
Effective search space: 24079351677
Effective search space used: 24079351677
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)