Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E07524g2.293ON47947923860.0
KLTH0G10516g2.293ON47448215710.0
Kwal_27.115002.293ON47548215460.0
TDEL0G022302.293ON48848714660.0
Smik_9.892.293ON49149114560.0
ADL208W2.293ON50250814420.0
NCAS0B062202.293ON48648614340.0
Ecym_33322.293ON51351614360.0
KNAG0A053902.293ON49748914270.0
Skud_9.832.293ON49149114240.0
YIL090W (ICE2)2.293ON49149114100.0
Suva_9.1092.293ON49149114090.0
ZYRO0A02024g2.293ON48648513920.0
CAGL0D04202g2.293ON49949113780.0
KAFR0J013302.293ON49149213690.0
NDAI0B035202.293ON50149913670.0
KLLA0E08207g2.293ON48647912601e-170
Kpol_1003.422.293ON49048712391e-167
TPHA0C034402.293ON57953411391e-150
TBLA0B059802.293ON49349710431e-137
TBLA0B069902.293ON53653010421e-136
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E07524g
         (479 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E07524g Chr5 complement(609285..610724) [1440 bp, 479 aa] {...   923   0.0  
KLTH0G10516g Chr7 (889468..890892) [1425 bp, 474 aa] {ON} simila...   609   0.0  
Kwal_27.11500 s27 complement(825779..827206) [1428 bp, 475 aa] {...   600   0.0  
TDEL0G02230 Chr7 (437121..438587) [1467 bp, 488 aa] {ON} Anc_2.2...   569   0.0  
Smik_9.89 Chr9 (172734..174209) [1476 bp, 491 aa] {ON} YIL090W (...   565   0.0  
ADL208W Chr4 (337118..338626) [1509 bp, 502 aa] {ON} Syntenic ho...   560   0.0  
NCAS0B06220 Chr2 complement(1173970..1175430) [1461 bp, 486 aa] ...   556   0.0  
Ecym_3332 Chr3 (634314..635855) [1542 bp, 513 aa] {ON} similar t...   557   0.0  
KNAG0A05390 Chr1 complement(793701..795194) [1494 bp, 497 aa] {O...   554   0.0  
Skud_9.83 Chr9 (170322..171797) [1476 bp, 491 aa] {ON} YIL090W (...   553   0.0  
YIL090W Chr9 (193595..195070) [1476 bp, 491 aa] {ON}  ICE2Integr...   547   0.0  
Suva_9.109 Chr9 (187818..189293) [1476 bp, 491 aa] {ON} YIL090W ...   547   0.0  
ZYRO0A02024g Chr1 (167059..168519) [1461 bp, 486 aa] {ON} simila...   540   0.0  
CAGL0D04202g Chr4 (414049..415548) [1500 bp, 499 aa] {ON} simila...   535   0.0  
KAFR0J01330 Chr10 complement(243571..245046) [1476 bp, 491 aa] {...   531   0.0  
NDAI0B03520 Chr2 complement(885459..886964) [1506 bp, 501 aa] {O...   531   0.0  
KLLA0E08207g Chr5 complement(740213..741673) [1461 bp, 486 aa] {...   489   e-170
Kpol_1003.42 s1003 (100704..102176) [1473 bp, 490 aa] {ON} (1007...   481   e-167
TPHA0C03440 Chr3 (752685..754424) [1740 bp, 579 aa] {ON} Anc_2.2...   443   e-150
TBLA0B05980 Chr2 (1412745..1414226) [1482 bp, 493 aa] {ON} Anc_2...   406   e-137
TBLA0B06990 Chr2 (1649581..1651191) [1611 bp, 536 aa] {ON}            405   e-136

>SAKL0E07524g Chr5 complement(609285..610724) [1440 bp, 479 aa] {ON}
           similar to uniprot|P40499 Saccharomyces cerevisiae
           YIL090W ICE2 Integral ER membrane protein with type-III
           transmembrane domains mutations cause defects in
           cortical ER morphology in both the mother and daughter
           cells
          Length = 479

 Score =  923 bits (2386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/479 (95%), Positives = 456/479 (95%)

Query: 1   MLPRSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXKIVSK 60
           MLPRSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLS               KIVSK
Sbjct: 1   MLPRSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSFTVTLFNLYFLTTTLKIVSK 60

Query: 61  KYNRLYYSITSFVYYLQHFIIPXXXXXXXXGFNNDELKRQIDGDVNLPRESLVNFLRNKS 120
           KYNRLYYSITSFVYYLQHFIIP        GFNNDELKRQIDGDVNLPRESLVNFLRNKS
Sbjct: 61  KYNRLYYSITSFVYYLQHFIIPSLLFLFLSGFNNDELKRQIDGDVNLPRESLVNFLRNKS 120

Query: 121 GKHSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHKNSNT 180
           GKHSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHKNSNT
Sbjct: 121 GKHSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHKNSNT 180

Query: 181 WIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVSGKGS 240
           WIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVSGKGS
Sbjct: 181 WIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVSGKGS 240

Query: 241 VIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGNLPTDNLLSYYRNVVLK 300
           VIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGNLPTDNLLSYYRNVVLK
Sbjct: 241 VIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGNLPTDNLLSYYRNVVLK 300

Query: 301 NGEMIWDAIVQKTGTTSPSTTQMVWLRLQPLWKFTKNFTISVPSSIREIFRVTLKMATES 360
           NGEMIWDAIVQKTGTTSPSTTQMVWLRLQPLWKFTKNFTISVPSSIREIFRVTLKMATES
Sbjct: 301 NGEMIWDAIVQKTGTTSPSTTQMVWLRLQPLWKFTKNFTISVPSSIREIFRVTLKMATES 360

Query: 361 VTPTVVINLVFRILVFYSATRIIPALQKDDSNGRKSSRRLMRLIYWYSPCIVIAMYTHLI 420
           VTPTVVINLVFRILVFYSATRIIPALQKDDSNGRKSSRRLMRLIYWYSPCIVIAMYTHLI
Sbjct: 361 VTPTVVINLVFRILVFYSATRIIPALQKDDSNGRKSSRRLMRLIYWYSPCIVIAMYTHLI 420

Query: 421 LQYSGELNNDLCLWGCFPWSHTNDPSSKVVVDAWGFWNWCNVFCTLAIYGLELIGGKSS 479
           LQYSGELNNDLCLWGCFPWSHTNDPSSKVVVDAWGFWNWCNVFCTLAIYGLELIGGKSS
Sbjct: 421 LQYSGELNNDLCLWGCFPWSHTNDPSSKVVVDAWGFWNWCNVFCTLAIYGLELIGGKSS 479

>KLTH0G10516g Chr7 (889468..890892) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090W ICE2
           Integral ER membrane protein with type-III transmembrane
           domains mutations cause defects in cortical ER
           morphology in both the mother and daughter cells
          Length = 474

 Score =  609 bits (1571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/482 (64%), Positives = 375/482 (77%), Gaps = 12/482 (2%)

Query: 1   MLPRSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXKIVSK 60
           M PRS+IQS R CLT+FYLLL+LITIPISFQVGGLYCGLS               KI ++
Sbjct: 1   MFPRSVIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60

Query: 61  KYNRLYYSITSFVYYLQHFIIPXXXXXXXXGFNNDELKRQIDGDVNLPRESLVNFLRNKS 120
              R    + S  YY QHF IP        GF+NDELKRQID +   P ESL++ LR+ +
Sbjct: 61  A--RGLAKLASAAYYAQHFFIPSLLFLFLSGFSNDELKRQIDTNTR-PDESLIDLLRSTT 117

Query: 121 GKHSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHKNSNT 180
              +W+FYYYYY++ V+PWQF+LL STPYFTLLEGFFTVLGIQA+GETN+WL     SN 
Sbjct: 118 QSQTWVFYYYYYQYVVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGNGSNM 177

Query: 181 WIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVSGKGS 240
           W+I  L+ SGGVIT +LYYLYRIYVTP+WELS+QTASLLGFT SIV GLG+YGIVSG+GS
Sbjct: 178 WVISGLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIYGIVSGRGS 237

Query: 241 VIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQ-KHQGNLPTDNLLSYYRNVVL 299
            IESSLFFAYIVRC+YEISPQLATSAMDEIF +VK+TW  +H+    +D LL+YYR+++L
Sbjct: 238 TIESSLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRSSDTLLTYYRDIIL 297

Query: 300 KNGEMIWDAIVQKTGTTSPSTTQMVWL---RLQPLWKFTKNFTISVPSSIREIFRVTLKM 356
           KNGEM+WDAI+ +T     ++   VW    R+QPLWKF K+FT SVPSSI+EIF +TL+M
Sbjct: 298 KNGEMVWDAILARTNVNVGASGTPVWASWNRVQPLWKFVKHFTSSVPSSIQEIFYLTLEM 357

Query: 357 ATESVTPTVVINLVFRILVFYSATRIIPALQKDDSNGRKSSRRLMRLIYWYSPCIVIAMY 416
           A E++ P VVINL FRIL+FYSATRIIPALQK     ++ SRR MR++YWYSPCIVIAMY
Sbjct: 358 AREAIAPAVVINLCFRILIFYSATRIIPALQKKH---KRRSRRFMRMLYWYSPCIVIAMY 414

Query: 417 THLILQYSGELNNDLCLWGCFPWSHTNDPSSKVVVDAWGFWNWCNVFCTLAIYGLELIGG 476
           THLILQYSG+++NDLCLWGCFPWS  + P  KVVVD+WGFWNWCN+FCT+AIY  EL+G 
Sbjct: 415 THLILQYSGQISNDLCLWGCFPWSVPDTP--KVVVDSWGFWNWCNIFCTMAIYASELLGS 472

Query: 477 KS 478
           KS
Sbjct: 473 KS 474

>Kwal_27.11500 s27 complement(825779..827206) [1428 bp, 475 aa] {ON}
           YIL090W - Hypothetical ORF [contig 27] FULL
          Length = 475

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/482 (63%), Positives = 369/482 (76%), Gaps = 12/482 (2%)

Query: 1   MLPRSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXKIVSK 60
           M+PRS++QSIR CLT+FYLLL+LITIPI+FQVGGLYCGLS               KI ++
Sbjct: 1   MIPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60

Query: 61  KYNRLYYSITSFVYYLQHFIIPXXXXXXXXGFNNDELKRQIDGDVNLPRESLVNFLRNKS 120
              R +  + S  YY QHF IP        GF+NDELK QID +   P ESL++ LR+ +
Sbjct: 61  A--RGFAKLASAAYYAQHFFIPSLLFLFLSGFSNDELKHQIDTNTR-PDESLIDLLRSST 117

Query: 121 GKHSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHKNSNT 180
               WIFYYYYY + V+PWQF+LL STPYFTLLEGFFTVLGIQA+GETN+WL     SN 
Sbjct: 118 HSQPWIFYYYYYHYVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGHGSNV 177

Query: 181 WIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVSGKGS 240
           W+I  L+ SGGVIT +LYYLYRIYVTP+WELS+QTASLLGFT SIV GLG++GIVSG+GS
Sbjct: 178 WVISGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGIVSGRGS 237

Query: 241 VIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQ-KHQGNLPTDNLLSYYRNVVL 299
            IESSLFFAYIVRC+YEISPQLATSAMDEI  +VKDTW  +H+    +D  L+YYR+++L
Sbjct: 238 TIESSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAYYRDIIL 297

Query: 300 KNGEMIWDAIVQKTGTTSPSTTQMVWL---RLQPLWKFTKNFTISVPSSIREIFRVTLKM 356
           KNGEMIWDA++ +T         + W+   R+QPLWKF K+FT SVPSSI+EIF +TL M
Sbjct: 298 KNGEMIWDAVLARTNVNVSGAGPVAWISWHRVQPLWKFVKHFTSSVPSSIQEIFLLTLSM 357

Query: 357 ATESVTPTVVINLVFRILVFYSATRIIPALQKDDSNGRKSSRRLMRLIYWYSPCIVIAMY 416
           A E++ P VVINL FRIL+FYSATRIIPALQ+     ++ SRR MR++YWYSPCIVIAMY
Sbjct: 358 AREAIAPAVVINLCFRILIFYSATRIIPALQRKH---KRRSRRFMRMLYWYSPCIVIAMY 414

Query: 417 THLILQYSGELNNDLCLWGCFPWSHTNDPSSKVVVDAWGFWNWCNVFCTLAIYGLELIGG 476
           THLI+QYSG+++NDLCLWGCFPWS      SKVVVD+WGFWNWCN+FCT+AIY  EL G 
Sbjct: 415 THLIMQYSGQISNDLCLWGCFPWSPPE--GSKVVVDSWGFWNWCNIFCTMAIYASELFGS 472

Query: 477 KS 478
           KS
Sbjct: 473 KS 474

>TDEL0G02230 Chr7 (437121..438587) [1467 bp, 488 aa] {ON} Anc_2.293
           YIL090W
          Length = 488

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/487 (60%), Positives = 362/487 (74%), Gaps = 14/487 (2%)

Query: 2   LPRSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXKIVSKK 61
           + +S +Q  R  L  FYLL  L+TIPISF+VGGLYCGLS                +V++ 
Sbjct: 4   ISKSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMVAQS 63

Query: 62  Y-NRLYYSITSFVYYLQHFIIPXXXXXXXXGFNNDELKRQIDGDVNLPRESLVNFLRNK- 119
           Y N+ Y   T+F+YYLQHF+I         GF+N+EL + ++ D + P +SLVN LRN  
Sbjct: 64  YGNKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLE-DGSQPEQSLVNVLRNNV 122

Query: 120 -SGKHSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHKNS 178
            S   SW+ YYYYY++ V+PWQ VL HST +F L EGFFTVLGIQAIGETN+WL    NS
Sbjct: 123 FSNHSSWMLYYYYYRYVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIGETNRWLLDEMNS 182

Query: 179 NTWIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVSGK 238
           NTWII SLL SGGVIT SLYYLYRIYVTP+W LS+QTASLLGFTLSIVCG+GL+GIVS  
Sbjct: 183 NTWIIASLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIVCGIGLFGIVSKN 242

Query: 239 GSVIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGNLP-TDNLLSYYRNV 297
           GSVIESSLFFAYIVRCIYEISP+LAT+A DEI +++K  WQKHQ NL  T+NLLSYY++V
Sbjct: 243 GSVIESSLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLSTTNNLLSYYQDV 302

Query: 298 VLKNGEMIWDAIVQKTGTTSPSTTQMV------WLRLQPLWKFTKNFTISVPSSIREIFR 351
           VLKN EM+W++IV +T  +  +T   +      W    P+WKF K F +SVPSSI  +F+
Sbjct: 303 VLKNAEMVWESIVLRTKNSDATTFTAIQPLNKLWHAFTPIWKFFKGFVLSVPSSIGGVFQ 362

Query: 352 VTLKMATESVTPTVVINLVFRILVFYSATRIIPALQKDDSNGRKSSRRLMRLIYWYSPCI 411
           VTLK+A+ESV+P +V+NL FR+LVFYSATRIIPALQ+ ++   + SRR+M ++YWYSPCI
Sbjct: 363 VTLKLASESVSPAIVLNLCFRVLVFYSATRIIPALQRKNTRELRKSRRIMNVLYWYSPCI 422

Query: 412 VIAMYTHLILQYSGELNNDLCLWGCFP-WSHTNDPSSKVVVDAWGFWNWCNVFCTLAIYG 470
           +IAMYTHLILQYSGELN+DLCLWGC   W  +  P  K+ ++ W FWNWCN+F T+ IYG
Sbjct: 423 LIAMYTHLILQYSGELNSDLCLWGCSEKWFGSGQP--KIEINTWVFWNWCNIFWTVLIYG 480

Query: 471 LELIGGK 477
            ELIGGK
Sbjct: 481 SELIGGK 487

>Smik_9.89 Chr9 (172734..174209) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/491 (58%), Positives = 355/491 (72%), Gaps = 17/491 (3%)

Query: 2   LPRSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXKIVSKK 61
           L +S +QS R C   FYLL  L++IPISF+VGGL CGLS                +++++
Sbjct: 4   LSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLARR 63

Query: 62  YN-RLYYSITSFVYYLQHFIIPXXXXXXXXGFNNDELKRQIDGDVNLPRESLVNFLRN-- 118
           Y  +LY  +TS +YY QHFII         GF+NDEL   +    N   ES +  L+N  
Sbjct: 64  YGGKLYIFLTSCLYYSQHFIIASLLYLFLSGFSNDELGNVLKKRPN-ESESFLEALKNSL 122

Query: 119 KSGKHSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHKNS 178
            S + +++ YYYY++F V+PWQF+L  STP+FTL EGFFT+L IQA+GETN+WL    NS
Sbjct: 123 NSNQINYVLYYYYFRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNS 182

Query: 179 NTWIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVSGK 238
           NTWII SLL SGGVIT SLYYLYRIYVTP+W LSIQTASLLGF LS+VCGLGLYGIVS K
Sbjct: 183 NTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQK 242

Query: 239 GSVIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGNLPT-DNLLSYYRNV 297
           GSVIESSLFFAYIVRCIYEISP+LAT+A DEI  + KD WQKHQ NLPT DNLL Y+ NV
Sbjct: 243 GSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNV 302

Query: 298 VLKNGEMIWDAIV----QKTGT-----TSPSTTQMVWLRLQPLWKFTKNFTISVPSSIRE 348
           +LKN EM+W + +    +KTG       S  + + V L  +P WKF KNFT SVP SI E
Sbjct: 303 ILKNAEMLWGSFIPRGRKKTGDFHDKLISVLSFEKVSLISKPFWKFFKNFTFSVPLSINE 362

Query: 349 IFRVTLKMATESVTPTVVINLVFRILVFYSATRIIPALQKDDSNGRKSSRRLMRLIYWYS 408
             +VT+KMA+ESV+P +V+NL FR+L+FYSATRIIPALQ+ +    + SRR+M+ +YWYS
Sbjct: 363 FCQVTIKMASESVSPAIVVNLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYWYS 422

Query: 409 PCIVIAMYTHLILQYSGELNNDLCLWGCFP-WSHTNDPSSKVVVDAWGFWNWCNVFCTLA 467
           PCI+IAMYTHLILQYSGEL  DLC+WGC   W  ++ P  +++VD+WGFWNWCN+FCT+ 
Sbjct: 423 PCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGSDQP--EIIVDSWGFWNWCNIFCTIL 480

Query: 468 IYGLELIGGKS 478
           +Y  ELIG  S
Sbjct: 481 VYATELIGSGS 491

>ADL208W Chr4 (337118..338626) [1509 bp, 502 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL090W
          Length = 502

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/508 (54%), Positives = 355/508 (69%), Gaps = 37/508 (7%)

Query: 1   MLPRSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXKIVSK 60
           M+P+ L++S+R  L +FYL LVLIT+PISFQ+GGLYCGLS               KI + 
Sbjct: 1   MVPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAA 60

Query: 61  KYNRLYYSITSFVYYLQHFIIPXXXXXXXXGFNNDELKRQI--------------DGDVN 106
                +  I S +YYLQHF++P        GFNND+L++++              DG++N
Sbjct: 61  TRGDEWKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNMN 120

Query: 107 LPRESLVNFLRNKSGKHSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIG 166
              ESL+  L       + + Y +YY++ V+PWQ++LLH+TP FTL EGFFTVL IQ IG
Sbjct: 121 ---ESLLQLLGRSRDDRATMAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIG 177

Query: 167 ETNKWLRYHKNSNTWIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIV 226
           ET +WLRY +NS  W+I SL++SG VITTS+YYLYRIYVTP+W LS+ TA+LLGFTLS+V
Sbjct: 178 ETGRWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLV 237

Query: 227 CGLGLYGIVSGKGSVIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGNLP 286
            GLGLYGI+SGKGS IESSLFFAY+V CIYEISPQLA +AM EIF++V +TWQ  QG LP
Sbjct: 238 FGLGLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTLP 297

Query: 287 TDNLLSYYRNVVLKNGEMIWDAIVQKTG-------TTSPSTT----------QMVWLRLQ 329
            ++LL+YY+N +L N E +WD +++K           +PS+           Q  W + Q
Sbjct: 298 KNSLLAYYKNFIL-NAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKSQ 356

Query: 330 PLWKFTKNFTISVPSSIREIFRVTLKMATESVTPTVVINLVFRILVFYSATRIIPALQKD 389
            LW FTKNF+  +P SI EIF VTL +A ES+   VV NLVFR++VFYSATRIIPALQ+ 
Sbjct: 357 QLWSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQR- 415

Query: 390 DSNGRKSSRRLMRLIYWYSPCIVIAMYTHLILQYSGELNNDLCLWGCFPWSHTNDPSSKV 449
            + G   SR+LMR+IYWYSPCIVIAMYTH+IL+YSGELNN+LC+WGCFPW  +     + 
Sbjct: 416 -ATGGTQSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCFPWLQSEANRDRW 474

Query: 450 VVDAWGFWNWCNVFCTLAIYGLELIGGK 477
           VVDAWGFWNWCN+F TL IY +ELIG +
Sbjct: 475 VVDAWGFWNWCNLFFTLLIYAVELIGSR 502

>NCAS0B06220 Chr2 complement(1173970..1175430) [1461 bp, 486 aa]
           {ON} Anc_2.293 YIL090W
          Length = 486

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/486 (57%), Positives = 361/486 (74%), Gaps = 18/486 (3%)

Query: 1   MLPRSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXKIVSK 60
           M+  S I+ IR C  TFYLL  LI+IPISF++GGL+CGL+                I ++
Sbjct: 1   MISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWAR 60

Query: 61  KY-NRLYYSITSFVYYLQHFIIPXXXXXXXXGFNNDELKRQIDGDVNLPRESLVNFLRNK 119
           KY +R++  +T+ +YY QHFII         GF+N++L   +  D N P +S+ +  +  
Sbjct: 61  KYGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLR-DGNKPIDSIADIFKKN 119

Query: 120 ---SGKHSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHK 176
              S + +W+ YYYYY+F V+PWQF+L +STP+FTL EGFFT+L IQAIGETNKWL Y  
Sbjct: 120 VASSTQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEI 179

Query: 177 NSNTWIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVS 236
           NSNTW+I SLL SGGVIT SLYYLYRIYVTP+W+LS+QTASLLGFTLS+V GLG+YGIV+
Sbjct: 180 NSNTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVT 239

Query: 237 GKGSVIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGNLPT-DNLLSYYR 295
            KGSVIESS+FFAYIVRCIYEISP+LAT+A +EI ++ K+ WQ+HQ NL + +NLLSYY 
Sbjct: 240 DKGSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYH 299

Query: 296 NVVLKNGEMIWDA--IVQKTGTTSPSTTQMVWLRLQPLWKFTKNFTISVPSSIREIFRVT 353
           NVVLKN E IW++  I   +  TS ST +++ +   P+WK  K FTI+VPSSI E+  VT
Sbjct: 300 NVVLKNIETIWESFKINDNSFITSFSTERVITI-FMPIWKLLKTFTITVPSSINELCFVT 358

Query: 354 LKMATESVTPTVVINLVFRILVFYSATRIIPALQKDDSNGRKSSRRLMRLIYWYSPCIVI 413
            KMA ES++P V++NL FR+L+FYSATRIIPALQ+ D N  + SRR+M+++YWYSPCI+I
Sbjct: 359 YKMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYWYSPCILI 418

Query: 414 AMYTHLILQYSGELNNDLCLWGC----FPWSHTNDPSSKVVVDAWGFWNWCNVFCTLAIY 469
           AMY HLILQYSGEL ++LCLWGC    FP   ++ P  K++VD+WGFWNWCN+F T+ +Y
Sbjct: 419 AMYAHLILQYSGELKDELCLWGCNSKIFP---SDQP--KIIVDSWGFWNWCNIFFTILVY 473

Query: 470 GLELIG 475
             ELIG
Sbjct: 474 ASELIG 479

>Ecym_3332 Chr3 (634314..635855) [1542 bp, 513 aa] {ON} similar to
           Ashbya gossypii ADL208W
          Length = 513

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/516 (57%), Positives = 358/516 (69%), Gaps = 42/516 (8%)

Query: 1   MLPRSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXKIVSK 60
           ML R L++SIR  L  FYL LVLITIPISFQVGGLYCGLS               KI + 
Sbjct: 1   MLSRGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSFTVTLFILYFTTTTLKITTT 60

Query: 61  KYNRLYYSITSFVYYLQHFIIPXXXXXXXXGFNNDELKRQIDGDV------------NLP 108
             +  +  + S +YYLQHF+IP         FN+D+L+R +D D             N+ 
Sbjct: 61  NGSGKFKLLASLIYYLQHFLIPSILFLFLSAFNSDQLQRLVDSDAVGASSKGFIFEGNVN 120

Query: 109 RESLVNFLRNKSGKHSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGET 168
              L         + S   YYYYYK+ VKPWQ++LLH+TPYFTL EGFFTVL IQAIGET
Sbjct: 121 ESLLQLLSLPPGNEGSVASYYYYYKYIVKPWQYMLLHATPYFTLTEGFFTVLAIQAIGET 180

Query: 169 NKWLRYHKNSNTWIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCG 228
            +WLRY KNSNTW+I+SLL+SG VITTS++YLYRIYVTP+W LS+QTA+LLGFTLS+V G
Sbjct: 181 GRWLRYKKNSNTWVILSLLVSGVVITTSMFYLYRIYVTPIWPLSVQTATLLGFTLSLVFG 240

Query: 229 LGLYGIVSGKGSVIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGNLPTD 288
           LGLYGI+SGKGS IESSLFFAY+VRCIYEISPQLA +AM EIF++V DTWQ  QG L  +
Sbjct: 241 LGLYGIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQLQQGTLSKN 300

Query: 289 NLLSYYRNVVLKNGEMIWDAIVQKT---------------GTTSPSTTQMV--------- 324
           NLL+YY N  + N E  WD++++KT               G + P T+ +          
Sbjct: 301 NLLTYY-NTFVSNAESFWDSLLKKTAIGTAAAAEETYTIFGYSMPFTSTIAKDTLIILQT 359

Query: 325 --WLRLQPLWKFTKNFTISVPSSIREIFRVTLKMATESVTPTVVINLVFRILVFYSATRI 382
             WL+ Q +W FTKNF++ +P SI EI  VTLKMA ES+ P V+ NLVFR+LVFYSATRI
Sbjct: 360 QWWLKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRVLVFYSATRI 419

Query: 383 IPALQKDDSNGRKSSRRLMRLIYWYSPCIVIAMYTHLILQYSGELNNDLCLWGCFPW-SH 441
           IPALQK  + G   SR+LMR+IYWYSPCIVIAMYTHLIL+YSGELNNDLC+WGCFPW + 
Sbjct: 420 IPALQK--ATGATQSRKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLCIWGCFPWLNF 477

Query: 442 TNDPSSKVVVDAWGFWNWCNVFCTLAIYGLELIGGK 477
           +    SK VVDAW FWNWCN+F TL IY +ELIG +
Sbjct: 478 SAKTRSKWVVDAWSFWNWCNLFFTLLIYAVELIGSR 513

>KNAG0A05390 Chr1 complement(793701..795194) [1494 bp, 497 aa] {ON}
           Anc_2.293 YIL090W
          Length = 497

 Score =  554 bits (1427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/489 (58%), Positives = 352/489 (71%), Gaps = 13/489 (2%)

Query: 2   LPRSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXKIVSKK 61
           L    I+  R C    YLLL LI+IPISF+VGGLYCGL+                I+++K
Sbjct: 5   LTSGFIRGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSIIARK 64

Query: 62  Y-NRLYYSITSFVYYLQHFIIPXXXXXXXXGFNNDELKRQIDGDVNLPRESLVNFLR--N 118
             NR+Y  ++S +YY QHFII         GF+N EL + I+ D  +P ESL + L    
Sbjct: 65  NGNRIYIVLSSILYYCQHFIIASLLHLFLSGFSNAELHKIIENDA-IPIESLTSILNVSM 123

Query: 119 KSGKHSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHKNS 178
            S + +WIFYYYYYK+ V PW+FVL HSTP+FTL EGFFT+L IQAIGETNKWL Y KNS
Sbjct: 124 SSSEANWIFYYYYYKYVVTPWKFVLSHSTPFFTLSEGFFTILAIQAIGETNKWLCYEKNS 183

Query: 179 NTWIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVSGK 238
           N WII SLL S  VI+ +LYYLYRIYVTP+WEL++QTASLLGF LS+V GLG+YGIVS  
Sbjct: 184 NAWIISSLLTSSAVISAALYYLYRIYVTPIWELTVQTASLLGFVLSLVSGLGIYGIVSDS 243

Query: 239 GSVIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGNLPT-DNLLSYYRNV 297
           GSVIESSLFFAYIVRCIYEISP+LAT+A DE+ ++ KD WQK QGNLP  +NL+ YY NV
Sbjct: 244 GSVIESSLFFAYIVRCIYEISPKLATTATDELLELFKDVWQKRQGNLPIRNNLIFYYNNV 303

Query: 298 VLKNGEMIWDAIVQKTGTT-----SPS-TTQMVWLRLQPLWKFTKNFTISVPSSIREIFR 351
           +LKN EM WD  + +TGT+     +PS      W   +P+WKF KNFT+SVP SIREI  
Sbjct: 304 ILKNIEMAWDNFILRTGTSGTFNYNPSLLLNNTWKFCKPIWKFFKNFTLSVPFSIREILL 363

Query: 352 VTLKMATESVTPTVVINLVFRILVFYSATRIIPALQKDDSNGRKSSRRLMRLIYWYSPCI 411
           +T KM+ ESV+P VVINL FRIL+FYSATRI+P+LQ+ D+  ++ SR++M L+YWYSPCI
Sbjct: 364 MTWKMSLESVSPAVVINLCFRILIFYSATRIVPSLQRKDAREQRRSRKVMELVYWYSPCI 423

Query: 412 VIAMYTHLILQYSGELNNDLCLWGC--FPWSHTNDPSSKVVVDAWGFWNWCNVFCTLAIY 469
           +IAMY HLILQYS EL N+LCLWGC      +  D +  VVVDAW FWNWCNVFCT+ +Y
Sbjct: 424 LIAMYAHLILQYSSELKNELCLWGCNNILLGYNTDQNETVVVDAWRFWNWCNVFCTILVY 483

Query: 470 GLELIGGKS 478
             ELIG  +
Sbjct: 484 ANELIGDTT 492

>Skud_9.83 Chr9 (170322..171797) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  553 bits (1424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/491 (58%), Positives = 354/491 (72%), Gaps = 17/491 (3%)

Query: 2   LPRSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXKIVSKK 61
           L +S +QS R C   FYLL  L++IPISF+VGGL CGLS                +++K+
Sbjct: 4   LSKSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLAKR 63

Query: 62  YN-RLYYSITSFVYYLQHFIIPXXXXXXXXGFNNDELKRQIDGDVNLPRESLVNFLRN-- 118
           +  +LY  +T+ +YY QHF+I         GF+NDEL   +    N   ES ++ L++  
Sbjct: 64  HGGKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVLKNRSN-ESESFLDALKDSL 122

Query: 119 KSGKHSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHKNS 178
            S + +++ YYYYY+F V+PWQFVL  STP+FTL EGFFT+L IQA+GETN+WL    NS
Sbjct: 123 NSNQINYVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNS 182

Query: 179 NTWIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVSGK 238
           NTWII SLL SGGVIT SLYYLYRIYVTP+W LSIQTASLLGF LS+VCGLGLYGIVS K
Sbjct: 183 NTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQK 242

Query: 239 GSVIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGNLPT-DNLLSYYRNV 297
           GSVIESSLFFAYIVRCIYEISP+LAT+A DEI  + KD WQKHQ NLPT DNLL Y+ NV
Sbjct: 243 GSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNV 302

Query: 298 VLKNGEMIWDAIV----QKTGT-----TSPSTTQMVWLRLQPLWKFTKNFTISVPSSIRE 348
           VLKN EM+W + +    +KTG       S  + + V L  +P WKF KNFT SVP SI E
Sbjct: 303 VLKNAEMLWGSFIPRGRKKTGDFHDKIISILSFEKVSLISRPFWKFFKNFTFSVPLSINE 362

Query: 349 IFRVTLKMATESVTPTVVINLVFRILVFYSATRIIPALQKDDSNGRKSSRRLMRLIYWYS 408
             +VT+KMA+ESV+P +VINL FR+L+FYSATRIIPALQ+ +    + SRR+MR +YWYS
Sbjct: 363 FCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMRGLYWYS 422

Query: 409 PCIVIAMYTHLILQYSGELNNDLCLWGCFP-WSHTNDPSSKVVVDAWGFWNWCNVFCTLA 467
           PCI+IAMYTHLILQYSGEL  DLC+WGC   W     P  +++VD+WGFWNWCN+FCT+ 
Sbjct: 423 PCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGAEQP--EIIVDSWGFWNWCNIFCTIL 480

Query: 468 IYGLELIGGKS 478
           +Y  ELIG  S
Sbjct: 481 VYATELIGSGS 491

>YIL090W Chr9 (193595..195070) [1476 bp, 491 aa] {ON}  ICE2Integral
           ER membrane protein with type-III transmembrane domains;
           required for ER zinc homeostasis; mutations cause
           defects in cortical ER morphology in both the mother and
           daughter cells
          Length = 491

 Score =  547 bits (1410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/491 (58%), Positives = 352/491 (71%), Gaps = 17/491 (3%)

Query: 2   LPRSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXKIVSKK 61
           L +S +QS R C   FYLL  L++IPISF+VGGL CGLS                +++++
Sbjct: 4   LSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLARR 63

Query: 62  YN-RLYYSITSFVYYLQHFIIPXXXXXXXXGFNNDELKRQIDGDVNLPRESLVNFLRN-- 118
           +  RLY   T+ +YY QHFII         GF+NDEL   +    N   ES +  L+N  
Sbjct: 64  HGGRLYIFFTNCLYYSQHFIIASLLYLFLSGFSNDELGNVLKNKYN-ESESFLEALKNSL 122

Query: 119 KSGKHSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHKNS 178
            S + +++ YYYYY+F V+PWQFVL  STP+FTL EGFFT+L IQA+GETN+WL    NS
Sbjct: 123 NSNQINYVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNS 182

Query: 179 NTWIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVSGK 238
           NTWII SLL SGGVIT SLYYLYRIYVTP+W LSIQTASLLG  LS+VCGLGLYGIVS K
Sbjct: 183 NTWIISSLLTSGGVITASLYYLYRIYVTPIWPLSIQTASLLGLVLSMVCGLGLYGIVSQK 242

Query: 239 GSVIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGNLPT-DNLLSYYRNV 297
           GSVIESSLFFAYIVRCIYEISP+LAT+A DEI  + KD WQKHQ NLPT DNLL Y+ NV
Sbjct: 243 GSVIESSLFFAYIVRCIYEISPKLATTATDEILNLFKDVWQKHQRNLPTADNLLCYFHNV 302

Query: 298 VLKNGEMIWDAIV----QKTGT-----TSPSTTQMVWLRLQPLWKFTKNFTISVPSSIRE 348
           +LKN E++W + +    +KTG       S  + + V L  +P WKF KNFT SVP SI E
Sbjct: 303 ILKNAEVLWGSFIPRGRKKTGDFHDKLISILSFEKVSLISKPFWKFFKNFTFSVPLSINE 362

Query: 349 IFRVTLKMATESVTPTVVINLVFRILVFYSATRIIPALQKDDSNGRKSSRRLMRLIYWYS 408
             +VT+KMA+ESV+P +VINL FR+L+FYSATRIIPALQ+ +    + SRR+M+ +YWYS
Sbjct: 363 FCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYWYS 422

Query: 409 PCIVIAMYTHLILQYSGELNNDLCLWGCFP-WSHTNDPSSKVVVDAWGFWNWCNVFCTLA 467
           PCI+IAMYTHLILQYSGEL  DLC+WGC   W   + P  +++VD+WGFWNWCN+FCT+ 
Sbjct: 423 PCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGVDQP--EIIVDSWGFWNWCNIFCTIL 480

Query: 468 IYGLELIGGKS 478
           +Y  ELIG  S
Sbjct: 481 VYATELIGSGS 491

>Suva_9.109 Chr9 (187818..189293) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  547 bits (1409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/491 (57%), Positives = 351/491 (71%), Gaps = 17/491 (3%)

Query: 2   LPRSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXKIVSKK 61
           L +S +QS R C   FYLL  L++IPISF+VGGL CGLS                +++++
Sbjct: 4   LSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLARR 63

Query: 62  YN-RLYYSITSFVYYLQHFIIPXXXXXXXXGFNNDELKRQIDGDVNLPRESLVNFLRN-- 118
              RLY  +TS +YY QHF+I         GF+NDEL   +    N   ES +  L+N  
Sbjct: 64  NGGRLYIFLTSCLYYSQHFVIASLLFLFLSGFSNDELGNVLKNRSN-ESESFLEALKNSL 122

Query: 119 KSGKHSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHKNS 178
            S + +++ YYYYY+F V+PWQF+L  STP+FTL EGFFT+L IQA+GETN+WL    NS
Sbjct: 123 NSNQINYVLYYYYYRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNS 182

Query: 179 NTWIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVSGK 238
           NTWII SLL SGGVIT SLYYLYRIYVTP+W LSIQTASLLGF LS+VCGLGLYGIVS +
Sbjct: 183 NTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQR 242

Query: 239 GSVIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGNLPT-DNLLSYYRNV 297
           GSVIESSLFFAYIVRCIYEISP+LAT+A DEI  + KD WQKHQ NLPT DNLL Y+ NV
Sbjct: 243 GSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNV 302

Query: 298 VLKNGEMIWDAIVQKTGTTSPS---------TTQMVWLRLQPLWKFTKNFTISVPSSIRE 348
           +LKN E++W + + +   T+           + + V L  +P W+F KNFT SVP SI E
Sbjct: 303 ILKNAEVLWGSFIPRRRKTTSDLHEKIISILSFEKVSLISKPFWRFCKNFTFSVPLSINE 362

Query: 349 IFRVTLKMATESVTPTVVINLVFRILVFYSATRIIPALQKDDSNGRKSSRRLMRLIYWYS 408
             +VT+KMA+ESV+P +VINL FR+L+FYSATRIIPALQ+ +    + SRR+M+ +YWYS
Sbjct: 363 FCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYWYS 422

Query: 409 PCIVIAMYTHLILQYSGELNNDLCLWGCFP-WSHTNDPSSKVVVDAWGFWNWCNVFCTLA 467
           PCI+IAMYTHLILQYSGEL  DLC+WGC   W   + P  +++VD+WGFWNWCN+FCT+ 
Sbjct: 423 PCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGPDQP--EIIVDSWGFWNWCNIFCTIL 480

Query: 468 IYGLELIGGKS 478
           +Y  EL+G  S
Sbjct: 481 VYATELVGSGS 491

>ZYRO0A02024g Chr1 (167059..168519) [1461 bp, 486 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090W ICE2
           Integral ER membrane protein with type-III transmembrane
           domains mutations cause defects in cortical ER
           morphology in both the mother and daughter cells
          Length = 486

 Score =  540 bits (1392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/485 (59%), Positives = 354/485 (72%), Gaps = 16/485 (3%)

Query: 6   LIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXKIVSKKY-NR 64
           ++QS+R  L  FYLL +LITIPISF+VGGLYCGLS                +  + Y +R
Sbjct: 4   VVQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGYASR 63

Query: 65  LYYSITSFVYYLQHFIIPXXXXXXXXGFNNDELKRQIDGDVNLPRESLVNFLRNK--SGK 122
            Y   T+ +YY QH II         GF+N+EL + ++     P +SL+  L++   S  
Sbjct: 64  FYVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGSQ-PEQSLLEVLKSNPFSAH 122

Query: 123 HSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHKNSNTWI 182
            +WI YYYYY + V+PWQ++L HST +F+L EGFFT+L IQA+GE+++WL Y  NSN W 
Sbjct: 123 SNWILYYYYYCYIVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESHRWLLYEINSNIWN 182

Query: 183 IVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVSGKGSVI 242
           I SLLISGGVIT +LYYLYRIYVTPVWELSIQTASLLGFTLS+VCGLGLYGIVS  GSVI
Sbjct: 183 ITSLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGLGLYGIVSKNGSVI 242

Query: 243 ESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGNL-PTDNLLSYYRNVVLKN 301
           ESSLFFAYIVRCIYEISP+LAT+A DEI +I K+ WQKHQ N   T+NLLSYY +VVL +
Sbjct: 243 ESSLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTNNLLSYYHDVVLDS 302

Query: 302 GEMIWDAIVQKTGTTSP---STTQMVWLR-----LQPLWKFTKNFTISVPSSIREIFRVT 353
            EM+W++IV KT TTS     T+    LR      +P+  F KNFTISVPSSI  +F+VT
Sbjct: 303 AEMMWESIVSKTVTTSDPFYHTSMFPPLRKFTDIFKPVGIFFKNFTISVPSSIEGLFQVT 362

Query: 354 LKMATESVTPTVVINLVFRILVFYSATRIIPALQKDDSNGRKSSRRLMRLIYWYSPCIVI 413
           LKMA++SV+P +V+NL FR+L+FYSAT+IIPALQ         SRR+M ++YWYSPCI+I
Sbjct: 363 LKMASDSVSPAIVVNLFFRVLIFYSATKIIPALQGKGDRQLNKSRRIMNVLYWYSPCILI 422

Query: 414 AMYTHLILQYSGELNNDLCLWGCFP-WSHTNDPSSKVVVDAWGFWNWCNVFCTLAIYGLE 472
           AMYTHLILQYSGELN DLCLWGC   W   N   +K+VVD+WGFWNWCN+F T+ +YG E
Sbjct: 423 AMYTHLILQYSGELNRDLCLWGCNSMWFSLNQ--TKIVVDSWGFWNWCNIFWTILVYGSE 480

Query: 473 LIGGK 477
           LIGGK
Sbjct: 481 LIGGK 485

>CAGL0D04202g Chr4 (414049..415548) [1500 bp, 499 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090w
          Length = 499

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/491 (55%), Positives = 348/491 (70%), Gaps = 26/491 (5%)

Query: 8   QSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXKIVSKKY-NRLY 66
           +SIR      YL+L L++IPISF++GGL CGLS                +++++  NR Y
Sbjct: 10  RSIRISSAALYLVLTLVSIPISFKIGGLQCGLSFTVTLFNLYLISTTLSVLARRSCNRGY 69

Query: 67  YSITSFVYYLQHFIIPXXXXXXXXGFNNDELKR---------QIDGDVNLPRESLVNFLR 117
              TS +YY QH +I         GF+N+E  R         ++D     P  S ++ L+
Sbjct: 70  VFATSILYYSQHLVIAPLLFLFLSGFSNEEFNRFLSPVGSYQELD-----PDGSFLDLLK 124

Query: 118 NK-------SGKHSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNK 170
           ++           +W  YYYY+KF V+PWQ++L +STP+FTLLEGFFT+L IQAIGETNK
Sbjct: 125 HRILMATTAENSKNWTLYYYYFKFIVQPWQWLLSYSTPFFTLLEGFFTILAIQAIGETNK 184

Query: 171 WLRYHKNSNTWIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLG 230
           WL Y  NSNTWII SLL+SGGVIT SLYYLYRIYVTP+W+L+IQ+ASLLGF LSIV  LG
Sbjct: 185 WLSYEMNSNTWIITSLLVSGGVITGSLYYLYRIYVTPIWKLTIQSASLLGFVLSIVFCLG 244

Query: 231 LYGIVSGKGSVIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGN-LPTDN 289
           LYGI+S KGSVIESSLFFAYIVRCIYEISP+LAT A +EI  +VKD WQ HQ N L  DN
Sbjct: 245 LYGIISRKGSVIESSLFFAYIVRCIYEISPKLATRATEEILDLVKDVWQTHQRNLLNRDN 304

Query: 290 LLSYYRNVVLKNGEMIWDA-IVQKTGTTSPSTTQMVWLRLQPLWKFTKNFTISVPSSIRE 348
           LL+YY NVVLKN EM+W++ I+ ++ + +       WL + P+WKF KNFT+SVPSSI E
Sbjct: 305 LLAYYHNVVLKNAEMVWESFILPRSRSLNAMEKIRFWLDVTPVWKFFKNFTVSVPSSIVE 364

Query: 349 IFRVTLKMATESVTPTVVINLVFRILVFYSATRIIPALQKDDSNGRKSSRRLMRLIYWYS 408
           +  VT KMA+ES++P V++NL FRIL+FYSATRIIPALQ+     ++ SRR+++L+YWYS
Sbjct: 365 LVSVTYKMASESLSPAVIVNLCFRILIFYSATRIIPALQRSSYKEQRQSRRILKLLYWYS 424

Query: 409 PCIVIAMYTHLILQYSGELNNDLCLWGCFP-WSHTNDPSSKVVVDAWGFWNWCNVFCTLA 467
           PC++IAMYTHLILQYSGEL  +LCLWGC   W  + D   ++V D+W FWNWCN+F T+ 
Sbjct: 425 PCVLIAMYTHLILQYSGELKRELCLWGCTSNWFGSKD-QPRIVTDSWSFWNWCNIFWTVL 483

Query: 468 IYGLELIGGKS 478
           +Y  ELIG ++
Sbjct: 484 VYANELIGTQA 494

>KAFR0J01330 Chr10 complement(243571..245046) [1476 bp, 491 aa] {ON}
           Anc_2.293 YIL090W
          Length = 491

 Score =  531 bits (1369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/492 (54%), Positives = 349/492 (70%), Gaps = 17/492 (3%)

Query: 1   MLPRSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXKIVSK 60
           +L +S+I+ +R    TFYLL  LI+IP+SF++GG++CGLS                I+++
Sbjct: 3   LLSKSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSILAR 62

Query: 61  KY-NRLYYSITSFVYYLQHFIIPXXXXXXXXGFNNDELKRQI-DGDVNLPRESLVNFLRN 118
           +  +R Y  +TS +YY QH II         GF+NDEL R + DG   +  E LV     
Sbjct: 63  QSGSRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLKDGTEKI--EVLVANQDL 120

Query: 119 KSGKHSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHKNS 178
              + +W+ Y YYY + VKPW+FVL +STP+F L EGFFT+L IQAIGETN+WL   KNS
Sbjct: 121 MVSESNWLLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQAIGETNRWLSDEKNS 180

Query: 179 NTWIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVSGK 238
           N+WII SLL S GV+T SLYYLYRIYVTP+WELS QTA+LLG  LS+  GLG++GI+S +
Sbjct: 181 NSWIISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLSLTFGLGIHGIISER 240

Query: 239 GSVIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGNLP-TDNLLSYYRNV 297
           GSV+ESSLFFAYIVRCIYEISP+LAT+A DEI ++ K+ WQ+HQG LP TDN+L+YYR+V
Sbjct: 241 GSVVESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGKLPITDNILNYYRSV 300

Query: 298 VLKNGEMIWDAIVQKTGTTSPS------TTQMVWLRLQPLWKFTKNFTISVPSSIREIFR 351
           +LKN EMIW+A + KT   S        T +  W+   PLWKF KNFTISVP SI E+  
Sbjct: 301 ILKNTEMIWEAFLSKTKQHSNHTLNSFFTAENFWIHFNPLWKFFKNFTISVPFSISELSG 360

Query: 352 VTLKMATESVTPTVVINLVFRILVFYSATRIIPALQKDDSNGRKSSRRLMRLIYWYSPCI 411
           + L+MA+ES++P VV+NL FR+L+FYSATRIIP+LQ+ +    + SRR+M+++YWYSPCI
Sbjct: 361 MMLQMASESISPAVVVNLCFRVLIFYSATRIIPSLQRKEVRDSRKSRRIMKVLYWYSPCI 420

Query: 412 VIAMYTHLILQYSGELNNDLCLWGCFPWSH----TNDPSSKVVVDAWGFWNWCNVFCTLA 467
           +IAMYTHLILQYSGEL  +L LWG  P S      +   + +VVD+W FWNWCN+F T+ 
Sbjct: 421 LIAMYTHLILQYSGELKRELYLWG--PDSKLSFLVDKEENNIVVDSWSFWNWCNIFWTIL 478

Query: 468 IYGLELIGGKSS 479
           IYG EL G  ++
Sbjct: 479 IYGGELFGTPTA 490

>NDAI0B03520 Chr2 complement(885459..886964) [1506 bp, 501 aa] {ON}
           Anc_2.293 YIL090W
          Length = 501

 Score =  531 bits (1367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/499 (54%), Positives = 348/499 (69%), Gaps = 22/499 (4%)

Query: 1   MLPRSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXKIVSK 60
           M+  S ++ +R     FYLL  LI+IPISF++GGL CGL+                ++++
Sbjct: 1   MISSSFMRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLAR 60

Query: 61  KY-NRLYYSITSFVYYLQHFIIPXXXXXXXXGFNNDELKRQIDGDVNLPRESLVNFLRNK 119
           KY +     +T F+YY QH II         GF++++L   +  D            RN 
Sbjct: 61  KYGSNFSIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSDDTQKVDIISDVVRRNL 120

Query: 120 SGKHS-WIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHKNS 178
           S  +S W  Y+ YY F V+PW+++L +STP+FTL EGFFT+L IQA+GETNKWL    NS
Sbjct: 121 SSTNSNWNLYHNYYTFFVQPWKYLLSYSTPFFTLSEGFFTILAIQAVGETNKWLVNEINS 180

Query: 179 NTWIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVSGK 238
           NTWII SLL SGGVIT SLYYLYRIYVTP+W+LSIQTASLLGFTLS+V GLGLYGIV+ K
Sbjct: 181 NTWIISSLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVGGLGLYGIVTEK 240

Query: 239 GSVIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGNLP-TDNLLSYYRNV 297
           GSVIESSLFFAYIVRCIYEISP+LAT+A DEI +I K+ WQ+HQGNLP TDNLL YY N 
Sbjct: 241 GSVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPTTDNLLFYYNNF 300

Query: 298 VLKNGEMIWDAIVQKTGTTSPSTT---------------QMVWLRL-QPLWKFTKNFTIS 341
           VL++ +M+W+ +V K     P+ T               + + LR+ +P+WK  KNFT+S
Sbjct: 301 VLRHIDMLWELLVSKINQNDPNNTLPSSFNINFLTTFLSKDLLLRICKPIWKLFKNFTVS 360

Query: 342 VPSSIREIFRVTLKMATESVTPTVVINLVFRILVFYSATRIIPALQKDDSNGRKSSRRLM 401
           VPSSI E+  VT +MA ESV+P VVINL FR+L+FYSATRIIPALQ+ + +  K SRR+M
Sbjct: 361 VPSSISELVLVTYQMARESVSPAVVINLCFRVLIFYSATRIIPALQRRNDSELKKSRRIM 420

Query: 402 RLIYWYSPCIVIAMYTHLILQYSGELNNDLCLWGC-FPWSHTNDPSSKVVVDAWGFWNWC 460
           +++YWYSPC++IAMYTHLILQYSGEL  DLCLWGC   W   N P  +++VD+WGFWNWC
Sbjct: 421 KILYWYSPCVLIAMYTHLILQYSGELKKDLCLWGCNLKWLIPNQP--ELIVDSWGFWNWC 478

Query: 461 NVFCTLAIYGLELIGGKSS 479
           N+F T+ IY  EL G  ++
Sbjct: 479 NIFFTIIIYASELFGTTAT 497

>KLLA0E08207g Chr5 complement(740213..741673) [1461 bp, 486 aa] {ON}
           similar to uniprot|P40499 Saccharomyces cerevisiae
           YIL090W ICE2 Integral ER membrane protein with type-III
           transmembrane domains mutations cause defects in
           cortical ER morphology in both the mother and daughter
           cells
          Length = 486

 Score =  489 bits (1260), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 258/479 (53%), Positives = 324/479 (67%), Gaps = 39/479 (8%)

Query: 1   MLPRSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXKIVSK 60
           ++ +S++Q++R  LTT YL LVLITIPISFQVGGL CGLS               K+V  
Sbjct: 42  LIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLL 101

Query: 61  KYNRLYYSITSFVYYLQHFIIPXXXXXXXXGFNNDELKRQIDGDVNLPRESLVNFLRNKS 120
                  ++++ +YYLQH +IP         F N      ID D  +  E          
Sbjct: 102 DRGS---ALSTLIYYLQHLLIPSILFMFLSYFEN------IDSD-TVDSE---------- 141

Query: 121 GKHSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHKNSNT 180
                 ++  ++   VKPWQ  L+HSTP FTLLEG FT+L IQAIGET +WL+  + SN 
Sbjct: 142 ------YFKVFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWLKMSRRSNQ 195

Query: 181 WIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVSGKGS 240
           W+I+SLLISGG+IT SL+Y YRIYVTP+WELS  +ASLLGFT SIVCG+GLYGI +G GS
Sbjct: 196 WVILSLLISGGIITLSLFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLYGI-NGSGS 254

Query: 241 VIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGNLP-TDNLLSYYRNVVL 299
           V+ESSLFFAY+VR +YEISP++A +AMDEIF IVK+TW+ HQ NLP  DNLL     ++ 
Sbjct: 255 VMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLL----ELMT 310

Query: 300 KNGEMIWDAIVQKTGTTSPSTTQMVWLR--LQPLWKFTKNFTISVPSSIREIFRVTLKMA 357
           KN   IW  IV+ T         M   +  L PLW   KNFT SVP SI+EIF VT KMA
Sbjct: 311 KNYRAIWSQIVEHTPRNHKYIKMMDQCKWILNPLWNSVKNFTKSVPISIQEIFVVTFKMA 370

Query: 358 TESVTPTVVINLVFRILVFYSATRIIPALQKDDSNGRKSSRRLMRLIYWYSPCIVIAMYT 417
            ES+ P VVINLVFR+L+FYSATRIIP LQ+ ++  R+S RR+M  +YWYSPCI+IAMYT
Sbjct: 371 KESLIPAVVINLVFRLLIFYSATRIIPTLQR-NTKERRSFRRIMNFVYWYSPCIIIAMYT 429

Query: 418 HLILQYSGELNNDLCLWGCFPWSHTNDPSSKVVVDAWGFWNWCNVFCTLAIYGLELIGG 476
           HLIL+YSG+L NDLC+WGCFP+    +   K+VVD+W FWNWCN++ T+ IY LEL+G 
Sbjct: 430 HLILRYSGQLKNDLCIWGCFPY----ETEPKIVVDSWSFWNWCNIYSTMLIYALELMGS 484

>Kpol_1003.42 s1003 (100704..102176) [1473 bp, 490 aa] {ON}
           (100704..102176) [1473 nt, 491 aa]
          Length = 490

 Score =  481 bits (1239), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 244/487 (50%), Positives = 326/487 (66%), Gaps = 16/487 (3%)

Query: 4   RSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXKIVSKKY- 62
           ++LI+S++  L  FYLL ++ TIPISF++GGLYCGL+                I+++++ 
Sbjct: 6   KNLIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGLTFTVTLFYLYFTSTTLNIIARRWG 65

Query: 63  NRLYYSITSFVYYLQHFIIPXXXXXXXXGFNNDELKRQIDGDVNLPRESLVNFLRNK--S 120
           ++    ITS  +Y Q+FIIP        GF N++L + I   +  P+E+ ++ LR     
Sbjct: 66  SKPAIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIRSGIQ-PKETFLDLLRGDIPV 124

Query: 121 GKHSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHKNSNT 180
              +W+ +YYYY +TVKPWQ +L +STP FTLLEGFFT+LGIQ IGE N WL++ +NSN 
Sbjct: 125 SVKNWLLFYYYYSYTVKPWQVILSYSTPVFTLLEGFFTILGIQTIGEMNTWLKHERNSNI 184

Query: 181 WIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVSGKGS 240
           WII SLL SGG+IT SLYYLYRIY TP+W LS+  A+LLGFTLS+V  LG+YGIVS  GS
Sbjct: 185 WIISSLLTSGGLITGSLYYLYRIYATPIWNLSVGAATLLGFTLSLVGSLGIYGIVSHNGS 244

Query: 241 VIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGNLP-TDNLLSYYRNVVL 299
           VIESSLFFAYIVRCIYEI+P+LAT+A +E  + +K+ WQ H  NL   D  +SY+ +   
Sbjct: 245 VIESSLFFAYIVRCIYEIAPELATTATEEFLEGIKEVWQSHHANLNVADGFISYFYDSFH 304

Query: 300 KNGEMIWDAIVQKTG---------TTSPSTTQMVWLRLQPLWKFTKNFTISVPSSIREIF 350
                 W     +T             PS   M+     P+W+  K  T SVP+SI E+F
Sbjct: 305 MQAHKFWTLFTSRTPYYGYLHNYCMDYPSLV-MIRSNFYPIWETLKTLTFSVPTSISELF 363

Query: 351 RVTLKMATESVTPTVVINLVFRILVFYSATRIIPALQKDDSNGRKSSRRLMRLIYWYSPC 410
            +T++MA +SV+P ++INL FR+++FYSATRIIPA+QK   +  +  R +M+ +YWYSPC
Sbjct: 364 HLTVRMAIDSVSPAIIINLCFRLMIFYSATRIIPAIQKRTRSETRKIRGIMKALYWYSPC 423

Query: 411 IVIAMYTHLILQYSGELNNDLCLWGCFPWSHTNDPSSKVVVDAWGFWNWCNVFCTLAIYG 470
           I+IAMYTHLILQYSGEL  DLCLWGC   +   +   ++ VDAW FWNWCN+F T+ IYG
Sbjct: 424 ILIAMYTHLILQYSGELKKDLCLWGCDS-TWFGEDQERINVDAWSFWNWCNIFWTIIIYG 482

Query: 471 LELIGGK 477
            ELIGGK
Sbjct: 483 SELIGGK 489

>TPHA0C03440 Chr3 (752685..754424) [1740 bp, 579 aa] {ON} Anc_2.293
           YIL090W
          Length = 579

 Score =  443 bits (1139), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 238/534 (44%), Positives = 328/534 (61%), Gaps = 60/534 (11%)

Query: 1   MLPRSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXKIVSK 60
           ++PR +I S    L  FYLL +++TIPISF++GG+YCGLS                I++K
Sbjct: 50  LIPRGVINSGHAVLVAFYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIITK 109

Query: 61  K--YNRLYYSITSFVYYLQHFIIPXXXXXXXXGFNNDEL--------------------K 98
           +  +N     + S ++Y+Q+FII         GFNN +L                    K
Sbjct: 110 RLTHNTTLRLLASSLFYIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNTK 169

Query: 99  RQI-------------------DGDVN----LPRESLVNFLRNKSGKHSWIFYYYYYKFT 135
            QI                   D  +N    L  +S  N + +    +SWI ++YYY   
Sbjct: 170 YQILFIIKDYFVNIMNLILFREDNGLNKMLQLALKSEGNSVPDPQKLNSWILFFYYYYIF 229

Query: 136 VKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHKNSNTWIIVSLLISGGVITT 195
           +KPW+F+L++STP+FTLLEGFFT+LGIQ IGETN WL+  K+S+ W+I+SLL SGGVIT 
Sbjct: 230 IKPWKFLLINSTPFFTLLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVITA 289

Query: 196 SLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVSGKGSVIESSLFFAYIVRCI 255
           +LYYL RIYVTP W+L++ TAS+LGFTLSIV GLG++GIVS  GS IESSLFFAYIVRCI
Sbjct: 290 TLYYLNRIYVTPFWDLTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRCI 349

Query: 256 YEISPQLATSAMDEIFKIVKDTWQKHQGNLP-TDNLLSYYRNVVLK---NGEMIWDAIVQ 311
           YE+SP+LA SA DE  +   + WQ +Q  +   DN+L+Y +  ++    +   I   +  
Sbjct: 350 YEMSPELAISATDEFLEGFNEVWQMNQNRITVADNVLTYCKKYIMDAFSSFSSIEHHLFP 409

Query: 312 KTGTTSPSTTQMVWLRLQPLWKFTKNFTISVPSSIREIFRVTLKMATESVTPTVVINLVF 371
           KT     S   +V    +  W F KNFTI+VPSSI ++ ++T +MA +S++P ++INL F
Sbjct: 410 KTIELGISKNLIV----KQFWVFLKNFTINVPSSINDLIQITAQMAVDSISPAIIINLSF 465

Query: 372 RILVFYSATRIIPALQKDDSNGRKSSRRLMRLIYWYSPCIVIAMYTHLILQYSGELNNDL 431
           R+++FYSATRIIPA+Q+            M  +YW+SPC++IAMYTHLILQ+SGEL  ++
Sbjct: 466 RLMIFYSATRIIPAIQRRTKPDAHDLTGFMSAVYWFSPCMLIAMYTHLILQFSGELKKNI 525

Query: 432 CLWGCFPW-------SHTNDPSSKVVVDAWGFWNWCNVFCTLAIYGLELIGGKS 478
           CLW C  W         TN   + ++VD+W FWNWCN+F T+ IY  ELIGG+S
Sbjct: 526 CLWNCENWLSSSSDVKSTNLGDNSIIVDSWSFWNWCNIFWTIIIYASELIGGRS 579

>TBLA0B05980 Chr2 (1412745..1414226) [1482 bp, 493 aa] {ON}
           Anc_2.293 YIL090W
          Length = 493

 Score =  406 bits (1043), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 228/497 (45%), Positives = 325/497 (65%), Gaps = 33/497 (6%)

Query: 4   RSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXKIVSKKYN 63
           ++L +S R      YLL VL+T+PI+FQ+GGL CGL+                 +++K  
Sbjct: 6   KNLGESTRFFFAGIYLLSVLMTVPIAFQLGGLQCGLAFTLTLFSSYFITTTLNAIARKLR 65

Query: 64  -RLYYSITSFVYYLQHFIIPXXXXXXXXGFNNDELKRQIDGDVNLPRESLVNFLRNK--- 119
            + + + T+F+YY Q+F I          F++ EL   +  D N   E++ + L+N    
Sbjct: 66  WQRFIAWTNFLYYFQNFNIIGILHIFLSLFSHTELSISM-SDENPSMETITSILKNNDTY 124

Query: 120 -SGKHSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHKNS 178
            S   S+I+ Y++Y + +  W+F L +STP F L+EGFFT+L IQ IGETN WL   KNS
Sbjct: 125 PSKTISFIYKYFFY-YAMPRWKFCLSYSTPLFALVEGFFTILAIQVIGETNIWLTTVKNS 183

Query: 179 NTWIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVSGK 238
           + WII+SL++S  ++TTS+YY+Y+IYVTP+W LS Q ASLL FT S+V G+ +YGIVS +
Sbjct: 184 SIWIILSLIMSSSMVTTSIYYIYKIYVTPLWHLSNQVASLLSFTFSLVGGVAIYGIVSHR 243

Query: 239 GSVIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGN-LPTDNLLSYYRNV 297
           GSV+ESSLFFAYIV CIYEISP +AT+AMD+IF  +K++WQ HQ N   +DNLL YY N 
Sbjct: 244 GSVVESSLFFAYIVCCIYEISPIMATTAMDDIFDTLKESWQIHQRNFFISDNLLIYYYNS 303

Query: 298 VLKNGEMIWDAIVQKTGTTSPSTTQMVWLRLQP----------LWKFTKNFTISVPSSIR 347
           ++KN +      + K  T    + +   L  Q           + K +K FT+ +PSSI 
Sbjct: 304 LIKNVDEFIKLKIIKLTTKDNFSNKFNSLLFQCVKISKKSFKFILKLSKRFTLGIPSSIY 363

Query: 348 EIFRVTLKMATESVTPTVVINLVFRILVFYSATRIIPALQKDDSNG-------RKSSRRL 400
           E++ +TLKMA+ES++P +++NL +R+L+FY+ATRIIPAL+   SNG        KS+ + 
Sbjct: 364 ELYSITLKMASESISPVILVNLCYRVLIFYAATRIIPALE-SRSNGFSNNNIKTKSNSKF 422

Query: 401 MRLIYWYSPCIVIAMYTHLILQYSGELNNDLCLWGCFPWSHTNDPSSKVVVDAWGFWNWC 460
           M+++YWYSPCI+IAMYT+LILQYSGEL ++  LW        N  +++VVVD+W FWNWC
Sbjct: 423 MKVLYWYSPCILIAMYTNLILQYSGELKSEFKLW-------NNSNNNEVVVDSWRFWNWC 475

Query: 461 NVFCTLAIYGLELIGGK 477
           N+F T+ +YG ELIGG+
Sbjct: 476 NIFWTITLYGSELIGGR 492

>TBLA0B06990 Chr2 (1649581..1651191) [1611 bp, 536 aa] {ON} 
          Length = 536

 Score =  405 bits (1042), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 226/530 (42%), Positives = 325/530 (61%), Gaps = 58/530 (10%)

Query: 4   RSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXKIVSKK-Y 62
           +S+ QSIR     FYL+ VLITIP +F++GGLYCGLS                +++K+  
Sbjct: 6   KSVKQSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLIAKRTL 65

Query: 63  NRLYYSITSFVYYLQHFIIPXXXXXXXXGFNNDELKRQIDGDVNLPRESLVNFLRNKSGK 122
           N  Y  +++ VYYLQH +I          F++  L   +  +      SL+ +++N + K
Sbjct: 66  NNFYILLSTLVYYLQHIVIASLLYIFITIFSDGNLNEILSNNKTDQLPSLLYYIKNDTSK 125

Query: 123 H-SWIFYYYYYKF----TVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHKN 177
             S  F+Y  + +     V+PW ++L HSTP+FTLLEGFFT+LGIQAIGET  WL   K 
Sbjct: 126 SVSQNFHYLLFYYYYYYAVQPWNYLLSHSTPFFTLLEGFFTILGIQAIGETYCWLLLKKQ 185

Query: 178 SNTWIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVSG 237
              + +++ LIS GVI T++++LY+IY   VWELSIQTASLLG T+S+V  +G++GI S 
Sbjct: 186 KKIFKLLTWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGVTMSLVLTVGIFGIFST 245

Query: 238 KGSVIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGNLP-TDNLLSYYRN 296
            GS+IESSLF  YI+RC YEISP+L+TSA  EI   +K+ WQ HQG++  T+++L YY N
Sbjct: 246 NGSLIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNHQGSITVTEHILFYYNN 305

Query: 297 VVLK--NGEMIWDAIVQKTGTTSPSTTQMV------------------------------ 324
           V+LK  N   ++++   K+  TS     +                               
Sbjct: 306 VLLKNINSSYLFNSNFSKSNDTSAKNRTLAEIQRSTNNYTLTDITKPSDLIHLIGFKSIY 365

Query: 325 --WL-RLQPLWKFTKNFTISVPSSIREIFRVTLKMATESVTPTVVINLVFRILVFYSATR 381
             WL    P+++  K+F +++P+S+  + +VT K+A +SV+P++VINL FR+L+FYSATR
Sbjct: 366 QNWLIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSIVINLCFRVLIFYSATR 425

Query: 382 IIPALQKDDSNGRKSSRRLMRLIYWYSPCIVIAMYTHLILQYSGELNNDLCLWGCFPWSH 441
           IIPA+Q+ +    K SR  ++  Y +SPCIVIAMYT+LILQYSGEL NDLC+WGC   S 
Sbjct: 426 IIPAVQRKNHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSGELKNDLCIWGCDIISK 485

Query: 442 --------------TND--PSSKVVVDAWGFWNWCNVFCTLAIYGLELIG 475
                         ++D  P+ + +V++WGFWNWCN+FCT+ IYG EL+G
Sbjct: 486 SISQRMSTINMDVGSDDTYPNREFIVNSWGFWNWCNIFCTIFIYGCELMG 535

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.140    0.447 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,558,484
Number of extensions: 2101713
Number of successful extensions: 6870
Number of sequences better than 10.0: 37
Number of HSP's gapped: 6942
Number of HSP's successfully gapped: 39
Length of query: 479
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 366
Effective length of database: 40,524,141
Effective search space: 14831835606
Effective search space used: 14831835606
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)