Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E01980g6.46ON46546523130.0
KLTH0C10582g6.46ON48148510101e-133
Kwal_56.225276.46ON4814869771e-128
ACL020W6.46ON5394929391e-121
ZYRO0C07172g6.46ON4504189241e-120
Ecym_30496.46ON5014399141e-118
NCAS0H009006.46ON4954819111e-117
KLLA0C05852g6.46ON4824868701e-111
TDEL0G042406.46ON4444468621e-111
NDAI0D008906.46ON5394558481e-107
Smik_13.1066.46ON5064708191e-104
YML043C (RRN11)6.46ON5074718101e-102
CAGL0J11792g6.46ON5104857772e-97
Suva_13.1176.46ON5134777694e-96
KAFR0L004206.46ON4604787374e-92
Skud_13.1056.46ON5123417372e-91
KNAG0E009106.46ON4864996351e-76
TBLA0B005706.46ON5174905804e-68
TPHA0J005106.46ON4374465388e-63
Kpol_1037.116.46ON4014185019e-58
TBLA0A065903.353ON36177751.2
KLLA0B04565g4.347ON192106677.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E01980g
         (465 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E01980g Chr5 complement(150830..152227) [1398 bp, 465 aa] {...   895   0.0  
KLTH0C10582g Chr3 (877398..878843) [1446 bp, 481 aa] {ON} simila...   393   e-133
Kwal_56.22527 s56 complement(168165..169610) [1446 bp, 481 aa] {...   380   e-128
ACL020W Chr3 (326268..327887) [1620 bp, 539 aa] {ON} Non-synteni...   366   e-121
ZYRO0C07172g Chr3 (541070..542422) [1353 bp, 450 aa] {ON} weakly...   360   e-120
Ecym_3049 Chr3 complement(93199..94704) [1506 bp, 501 aa] {ON} s...   356   e-118
NCAS0H00900 Chr8 (167875..169362) [1488 bp, 495 aa] {ON} Anc_6.4...   355   e-117
KLLA0C05852g Chr3 (518508..519956) [1449 bp, 482 aa] {ON} weakly...   339   e-111
TDEL0G04240 Chr7 (770798..772132) [1335 bp, 444 aa] {ON} Anc_6.4...   336   e-111
NDAI0D00890 Chr4 (203085..204704) [1620 bp, 539 aa] {ON} Anc_6.4...   331   e-107
Smik_13.106 Chr13 complement(183859..185379) [1521 bp, 506 aa] {...   320   e-104
YML043C Chr13 complement(190244..191767) [1524 bp, 507 aa] {ON} ...   316   e-102
CAGL0J11792g Chr10 complement(1150752..1152284) [1533 bp, 510 aa...   303   2e-97
Suva_13.117 Chr13 complement(186472..188013) [1542 bp, 513 aa] {...   300   4e-96
KAFR0L00420 Chr12 (77468..78850) [1383 bp, 460 aa] {ON} Anc_6.46...   288   4e-92
Skud_13.105 Chr13 complement(181845..183383) [1539 bp, 512 aa] {...   288   2e-91
KNAG0E00910 Chr5 complement(171075..172535) [1461 bp, 486 aa] {O...   249   1e-76
TBLA0B00570 Chr2 complement(113646..115199) [1554 bp, 517 aa] {O...   228   4e-68
TPHA0J00510 Chr10 complement(114098..115411) [1314 bp, 437 aa] {...   211   8e-63
Kpol_1037.11 s1037 (23974..25179) [1206 bp, 401 aa] {ON} (23974....   197   9e-58
TBLA0A06590 Chr1 (1614194..1615279) [1086 bp, 361 aa] {ON} Anc_3...    33   1.2  
KLLA0B04565g Chr2 (409720..410298) [579 bp, 192 aa] {ON} highly ...    30   7.7  

>SAKL0E01980g Chr5 complement(150830..152227) [1398 bp, 465 aa] {ON}
           similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043C RRN11 rDNA transcription factor CF component
           which also contains Rrn6p and Rrn7p which is required
           for rDNA transcription by RNA polymerase I component of
           rDNA transcription factor
          Length = 465

 Score =  895 bits (2313), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/465 (93%), Positives = 433/465 (93%)

Query: 1   MFELPVVRTNKKIRSKRKLRYQYINTLNKKHEQLNPKKQTVGLPTPESSAAETSDTDELE 60
           MFELPVVRTNKKIRSKRKLRYQYINTLNKKHEQLNPKKQTVGLPTPESSAAETSDTDELE
Sbjct: 1   MFELPVVRTNKKIRSKRKLRYQYINTLNKKHEQLNPKKQTVGLPTPESSAAETSDTDELE 60

Query: 61  DSQSXXXXXXXXXLQSILGHAVXXXXXXXXXXXXXXXXXXXXXXXKHVKNKYYKPQETYE 120
           DSQS         LQSILGHAV                       KHVKNKYYKPQETYE
Sbjct: 61  DSQSKRTKRRKRRLQSILGHAVSSSDEDDISEEENDNDYEECDYEKHVKNKYYKPQETYE 120

Query: 121 LWTTGPENRVPLNTTSMTYKQYKKIHKAAHRRVTRTLSYSSKNSAAFFSAIYNGYEPYET 180
           LWTTGPENRVPLNTTSMTYKQYKKIHKAAHRRVTRTLSYSSKNSAAFFSAIYNGYEPYET
Sbjct: 121 LWTTGPENRVPLNTTSMTYKQYKKIHKAAHRRVTRTLSYSSKNSAAFFSAIYNGYEPYET 180

Query: 181 SQLENYQTTHIRNLTNLLHVNVMEQNWEIAYRCFSILIRLPGVDIRSIWGIGVRILKEID 240
           SQLENYQTTHIRNLTNLLHVNVMEQNWEIAYRCFSILIRLPGVDIRSIWGIGVRILKEID
Sbjct: 181 SQLENYQTTHIRNLTNLLHVNVMEQNWEIAYRCFSILIRLPGVDIRSIWGIGVRILKEID 240

Query: 241 RKRSEEFLEWMSSVFSTKNNFNQGTNHAMDPVFRSGSKTHTPKFVTSWLWETLMGCTSKD 300
           RKRSEEFLEWMSSVFSTKNNFNQGTNHAMDPVFRSGSKTHTPKFVTSWLWETLMGCTSKD
Sbjct: 241 RKRSEEFLEWMSSVFSTKNNFNQGTNHAMDPVFRSGSKTHTPKFVTSWLWETLMGCTSKD 300

Query: 301 ENNGNRDVNKLQFLTEKISELVLTPPYMDDPKIWFIYALCHIVEADHLSQQFIENEHIKN 360
           ENNGNRDVNKLQFLTEKISELVLTPPYMDDPKIWFIYALCHIVEADHLSQQFIENEHIKN
Sbjct: 301 ENNGNRDVNKLQFLTEKISELVLTPPYMDDPKIWFIYALCHIVEADHLSQQFIENEHIKN 360

Query: 361 GSRRDIARNQVIQHITNAKNFLQTCQEKGGFQFPKQHIEKQLSNFENRLYQRTEDLLNNF 420
           GSRRDIARNQVIQHITNAKNFLQTCQEKGGFQFPKQHIEKQLSNFENRLYQRTEDLLNNF
Sbjct: 361 GSRRDIARNQVIQHITNAKNFLQTCQEKGGFQFPKQHIEKQLSNFENRLYQRTEDLLNNF 420

Query: 421 DSDSSASNEFNRQDFQDVNPIVYEEENVFGELGDAQFDIDTYSSE 465
           DSDSSASNEFNRQDFQDVNPIVYEEENVFGELGDAQFDIDTYSSE
Sbjct: 421 DSDSSASNEFNRQDFQDVNPIVYEEENVFGELGDAQFDIDTYSSE 465

>KLTH0C10582g Chr3 (877398..878843) [1446 bp, 481 aa] {ON} similar
           to uniprot|Q04712 Saccharomyces cerevisiae YML043C RRN11
           rDNA transcription factor CF component which also
           contains Rrn6p and Rrn7p which is required for rDNA
           transcription by RNA polymerase I component of rDNA
           transcription factor
          Length = 481

 Score =  393 bits (1010), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 212/485 (43%), Positives = 291/485 (60%), Gaps = 26/485 (5%)

Query: 1   MFELPVVRTNKKIRSKRKLRYQYINTLNKKHEQLNP-KKQTVGLPTPESSAAE-TSDTDE 58
           MFELP+VR  K++R+ RKLRYQYINTL +++ ++         LPTPE+SAAE  SD D 
Sbjct: 1   MFELPLVRNTKRVRTVRKLRYQYINTLYQEYRKVQSFANANSTLPTPENSAAEEASDGDH 60

Query: 59  LEDSQSXXXXXXXXXLQSILGHAVXXXXXXXXXXXXXXXXXXXXXXXKHVKNKYYKPQET 118
                +         L S+LGHA                        K    ++ KPQET
Sbjct: 61  NSADATSRRRRRKRRLLSVLGHAETDTELSDMEAEEGSHEADQADSEKEFFTRHEKPQET 120

Query: 119 YELWTTGPENRVPLNTTSMTYKQYKKIHKAAHRRVTRTLSYSSKNSAAFFSAIYNGYEPY 178
           +E+W T  +  VP+NT +++Y   K+I K A +RV+  +++ SKN+   F A+ +GYE  
Sbjct: 121 FEVWNTDRQKAVPMNTATLSYDTCKQIEKHAQKRVSAGMAHISKNANFHFQAMKDGYETV 180

Query: 179 ETSQLENYQTTHIRNLTNLLHVNVMEQNWEIAYRCFSILIRLPGVDIRSIWGIGVRILKE 238
             +  E++   HI  L  LLH N+M+  W+ AYRCFS+LIRLPG+DIRS+WG G RIL+E
Sbjct: 181 AETP-ESHHLVHIAQLNELLHTNIMKGKWDTAYRCFSLLIRLPGIDIRSVWGPGARILRE 239

Query: 239 IDRK-----RSEEFLEWMSSVFSTKNNFNQGTNHAMDPVFRSGSKTHTPKFVTSWLWETL 293
           +         SEEFL W+S +FS+++NFNQ  N  MDPVFR GSKTH  KFV +WLWE L
Sbjct: 240 LASNDKGLGTSEEFLGWLSGIFSSRSNFNQTMNFLMDPVFRCGSKTHAAKFVVAWLWELL 299

Query: 294 MG-CTSKDENNGNRDVN--KLQFLTEKISELVLTPPYMDDPKIWFIYALCHIVEADHLSQ 350
              C    E+    D +  KL  L E++SE+VL PPYM+DP++WFI+A+CH+V AD LSQ
Sbjct: 300 FASCPDGTEHPSAEDASNRKLSHLLERLSEMVLIPPYMEDPEVWFIFAVCHLVSADQLSQ 359

Query: 351 QFIENEHIKNGSRRDIARNQVIQHITNAKNFLQTCQ-EKGGFQFPKQHIEKQLSNFENRL 409
           +FI  +   +   RDI+RNQV QHITNA   ++TC+ +K  F FP++ IE+QL+ FE RL
Sbjct: 360 RFISTKLRTSELERDISRNQVTQHITNAHMCIRTCEAKKEEFSFPRRIIEEQLACFEKRL 419

Query: 410 YQRT-----EDLLNNFDSDSSASNEFNRQDFQDV-----NPIVYEEENVFGELGDAQFDI 459
           YQ +      DL + F+ D+S  N     D Q+V     +P++ EEEN FG      F  
Sbjct: 420 YQNSGESTASDLGSGFELDNSPEN----LDTQNVLGPGMSPMIDEEENFFGSAEQVHFGF 475

Query: 460 DTYSS 464
           D+ SS
Sbjct: 476 DSDSS 480

>Kwal_56.22527 s56 complement(168165..169610) [1446 bp, 481 aa] {ON}
           YML043C (RRN11) - component of rDNA transcription factor
           [contig 185] FULL
          Length = 481

 Score =  380 bits (977), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 215/486 (44%), Positives = 290/486 (59%), Gaps = 28/486 (5%)

Query: 1   MFELPVVRTNKKIRSKRKLRYQYINTLNKKHEQL-NPKKQTVGLPTPESSAAE-TSDTDE 58
           MFELP+ R + ++R+ RKLRYQYIN+L+++H ++ +       LPTPE+SAAE  SD D+
Sbjct: 1   MFELPLARNSNRVRTVRKLRYQYINSLSQEHRRIQDSAAAHATLPTPENSAAEDASDGDQ 60

Query: 59  LEDSQSXXXXXXXXXLQSILGHAVXXXXXXXXXXXXXXXXXXXXXXXKHVKNKYYKPQET 118
             +            + S+LGH                         K   + + KPQ+T
Sbjct: 61  DSEDAGSRRRRRKRRILSVLGHIDSESELSDVDMSTESHHSELQESEKEFFSHHEKPQDT 120

Query: 119 YELWTTGPENRVPLNTTSMTYKQYKKIHKAAHRRVTRTLSYSSKNSAAFFSAIYNGYEPY 178
           YE W T     V + T +++Y + K I   A RRV   + + S+ + + F++I  GYE Y
Sbjct: 121 YETWNTDRRKAVSMTTATLSYAENKLIEARAQRRVIERIGHFSRIARSHFNSIKRGYEIY 180

Query: 179 -ETSQLENYQTTHIRNLTNLLHVNVMEQNWEIAYRCFSILIRLPGVDIRSIWGIGVRILK 237
              SQ+  +QTTHI +L  LLH+NVME  WE A+RCFSILIRLPGVDIRS+WG+GVRIL+
Sbjct: 181 SRPSQV--HQTTHITHLNELLHINVMEGQWETAFRCFSILIRLPGVDIRSMWGLGVRILR 238

Query: 238 EIDR-----KRSEEFLEWMSSVFSTKNNFNQGTNHAMDPVFRSGSKTHTPKFVTSWLWET 292
           E+         S+EFL W+S ++++++NFN   N  MDPVFR+GSK HT KFV++WLWE 
Sbjct: 239 ELSSTDKNVASSDEFLGWLSGIYTSRSNFNHTMNFLMDPVFRTGSKKHTAKFVSAWLWEM 298

Query: 293 LMG-CTSK------DENNGNRDVNKLQFLTEKISELVLTPPYMDDPKIWFIYALCHIVEA 345
           L   C  K      D  +GNR   KL  L EK+SE+VL PPYM+DP+IWFIYALCH+V A
Sbjct: 299 LFAACPDKLEERQADNGSGNR---KLIQLLEKLSEMVLIPPYMEDPEIWFIYALCHLVSA 355

Query: 346 DHLSQQFIENEHIKNGSRRDIARNQVIQHITNAKNFLQTCQEKG-GFQFPKQHIEKQLSN 404
           D LSQ+F           RDI+RNQV QHITNA N ++TC+ KG  F FP++ IE+QL+ 
Sbjct: 356 DELSQRFTFTYSESTELERDISRNQVTQHITNAHNCIRTCEAKGDDFFFPRRIIEEQLAF 415

Query: 405 FENRLYQRTEDLLNNFDSDSSASNEFNRQDF--QDV-NPIV---YEEENVFGELGDAQFD 458
           FE RLY+   D   + + DS     F   +F  QD+ +P +    EEEN FG      F 
Sbjct: 416 FERRLYEHVGDSTTS-EQDSPHEMTFEPHNFDTQDLPSPGMSSFVEEENYFGTAERVHFG 474

Query: 459 IDTYSS 464
            D+ SS
Sbjct: 475 FDSDSS 480

>ACL020W Chr3 (326268..327887) [1620 bp, 539 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YML043C (RRN11)
          Length = 539

 Score =  366 bits (939), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 193/492 (39%), Positives = 297/492 (60%), Gaps = 35/492 (7%)

Query: 1   MFELPVVRTNKKIRSKRKLRYQYINTLNKKHEQLN----PKKQ----TVGLPTPESSAAE 52
           MFE P+V  +K+ + +R L+Y+Y++ + +K+EQLN      KQ    +   PTP++SAAE
Sbjct: 46  MFESPIVSYSKRSKQQRALKYKYVSCVRRKYEQLNGLSDSDKQAHIDSACFPTPDNSAAE 105

Query: 53  TSDTDELE---DSQSXXXXXXXXXLQSILGHAVXXXXXXXXXXXXXXXXXXXXXXXKHVK 109
            SD D LE   D+ +         LQSILGHA                         + K
Sbjct: 106 ASDGDALEGDVDTAARRLKRKRLRLQSILGHATLDAEEGDLGSEEEDDLNGGSTAKDYEK 165

Query: 110 N---KYYKPQETYELWTTGPENRVPLNTTSMTYKQYKKIHKAAHRRVTRTLSYSSKNSAA 166
               +YYKP+ TYELW T P+NRVP+    ++Y+ +K+I   +++R+  TLS S+K +AA
Sbjct: 166 QFFARYYKPEYTYELWATSPKNRVPIRRKMLSYQAFKQIENYSNQRMKATLSLSTKKAAA 225

Query: 167 FFSAIYNGYEPYETSQLENYQTTHIRNLTNLLHVNVMEQNWEIAYRCFSILIRLPGVDIR 226
           +   +  GYE     ++ NYQ  H+ +L  LL+ N++ +NW  AYRCF++LIR+  VD+R
Sbjct: 226 YHEVMRLGYETCPKEEVTNYQKLHLNHLVGLLYSNIISENWGTAYRCFALLIRMKSVDLR 285

Query: 227 SIWGIGVRILKEIDRKRSEEFLEWMSSVFSTKNNFNQGTNHAMDPVFRSGSKTHTPKFVT 286
           SIW +G  IL  ++    E+FLEWM +VF++ + F+Q   + +DPVFRSGS+ HTP F+ 
Sbjct: 286 SIWNLGSHILSHLNFDMHEKFLEWMGTVFTSHSVFSQNKVNLIDPVFRSGSRAHTPNFML 345

Query: 287 SWLWETLMGCTSKDENNGNRDVNKLQFLTEKISELVLTPPYMDDPKIWFIYALCHIVEAD 346
           +WLW  L G T+ +  +  R    + +L EK+SELVL PPYMDD +IWF+YA+C+ ++AD
Sbjct: 346 AWLWLVLRGATADEVLDSTR---SMAWLLEKVSELVLRPPYMDDAEIWFLYAMCYFIQAD 402

Query: 347 HLSQQFIENEHIK-NGSRRDIARNQVIQHITNAKNFLQTCQEKGGFQFPKQHIEKQLSNF 405
            LS Q   +E IK +GS+ DIA+ QV Q+I + KN L++C+EKG F +P++ I++QL  F
Sbjct: 403 KLSAQLASHEGIKLHGSKLDIAKTQVTQYICSVKNCLESCREKGNFTYPERIIQEQLLEF 462

Query: 406 ENRLYQRTE------DLLNNFDSDSSASN---------EFNRQDFQDVNPIVYEEEN-VF 449
           E RLY  T       +  + ++SD+   N         +F+  +F++  P V E+++  F
Sbjct: 463 ERRLYAGTHKEQTDGNSFDTYESDTGEQNDNPTMVSETDFHDPNFRNFKPDVAEDDDTAF 522

Query: 450 GELGDAQFDIDT 461
           GEL   +F++D+
Sbjct: 523 GELP-TRFEVDS 533

>ZYRO0C07172g Chr3 (541070..542422) [1353 bp, 450 aa] {ON} weakly
           similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043C RRN11 rDNA transcription factor CF component
           which also contains Rrn6p and Rrn7p which is required
           for rDNA transcription by RNA polymerase I component of
           rDNA transcription factor
          Length = 450

 Score =  360 bits (924), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 185/418 (44%), Positives = 258/418 (61%), Gaps = 17/418 (4%)

Query: 1   MFELPVVRTNKKIRSKRKLRYQYINTLNKKHEQLNP-KKQTVGLPTPESSAAETSDTDEL 59
           MFELP+V T+K+ R+ RKL+YQYIN L+KK++ +N        LPTPE+SA ETS+ +E+
Sbjct: 1   MFELPLVITSKRTRTSRKLKYQYINNLSKKYDGINGISNGQTELPTPENSATETSENEEV 60

Query: 60  EDSQSXXXXXXXXXLQSILGHAVXXXXXXXXXXXXXXXXXXXXXXXKHVKNKYYKPQETY 119
              +           +SI+G +                        +    KY KPQ T+
Sbjct: 61  GQQKRRRIRKRL---KSIIGESYSDLESDEEQPVEEVDNEE-----RKFYRKYEKPQLTF 112

Query: 120 ELWTTGPENRVPLNTTSMTYKQYKKIHKAAHRRVTRTLSYSSKNSAAFFSAIYNGYEPYE 179
           E W   P  R P+    + Y +  +I +   RR+  +L+ +S+ +  FF A   GY+ ++
Sbjct: 113 EKWQCDPRKRTPIQRNRINYNRMNRIQRHGLRRMETSLAVASRTNKTFFHATTQGYQLFD 172

Query: 180 TS--QLENYQTTHIRNLTNLLHVNVMEQNWEIAYRCFSILIRLPGVDIRSIWGIGVRILK 237
            +  +   +Q  HI  LT+LLH+NV+++ WE+AY+CF++LIR+PGVD+R++WG+G RIL 
Sbjct: 173 PTYGRANTFQLKHIGTLTSLLHINVLKRKWELAYKCFALLIRIPGVDVRTLWGLGERILA 232

Query: 238 EIDRKRSEEFLEWMSSVFSTKNNFNQGTNHAMDPVFRSGSKTHTPKFVTSWLWETLMGCT 297
           E    RS EFL+WMSSV+STK  F    N+ M PVF  GSKTHTPK+ T+WLWE L+   
Sbjct: 233 ERQPTRSLEFLQWMSSVYSTKLPFADDVNYRMAPVFTKGSKTHTPKYTTTWLWECLIRYA 292

Query: 298 SKDEN---NGNRDVNKLQFLTEKISELVLTPPYMDDPKIWFIYALCHIVEADHLSQQFIE 354
           +  E+   +        Q L ++ISE+VL PPYMDDP++WFIYALCH+V+AD LSQQF  
Sbjct: 293 NGLEDLEMDSKSAAENFQSLMDRISEMVLGPPYMDDPEVWFIYALCHMVKADTLSQQF-- 350

Query: 355 NEHIKNGSRRDIARNQVIQHITNAKNFLQTCQEKGGFQFPKQHIEKQLSNFENRLYQR 412
            +    GS RDIA NQVIQHI N K+ LQ C  KGGF FPK++I +QL+ FE RLY +
Sbjct: 351 -DPRLTGSARDIASNQVIQHIQNTKSHLQQCSSKGGFTFPKRYIARQLAAFEARLYGK 407

>Ecym_3049 Chr3 complement(93199..94704) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ACL020W
          Length = 501

 Score =  356 bits (914), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 186/439 (42%), Positives = 263/439 (59%), Gaps = 24/439 (5%)

Query: 1   MFELPVVRTNKKIRSKRKLRYQYINTLNKKHEQL--------NPKKQTVGLPTPESSAAE 52
           MFE P++  N K R +RKL+Y+YIN+L +K+E L           K T GLPTP +SAAE
Sbjct: 1   MFESPIISYNSKDRKRRKLKYKYINSLKRKYEHLVGTQGGSKGSTKDTSGLPTPGNSAAE 60

Query: 53  TSDTDELEDSQ--SXXXXXXXXXLQSILGHAVXXXXXXXXXXXXXXXXXXXXXXXKHVK- 109
            SD D  E+ +            LQSILGHA                         ++  
Sbjct: 61  ASDGDGREEDELSRLRRRKRRIRLQSILGHAADEDEDEAEAEGAVGSEDDDGYEDGYLDE 120

Query: 110 --------NKYYKPQETYELWTTGPENRVPLNTTSMTYKQYKKIHKAAHRRVTRTLSYSS 161
                   +KYY P+ETYE+WTT   NR+P+   SM+Y  ++ I K AH++V  +L+ SS
Sbjct: 121 KDPEKIFYSKYYVPEETYEVWTTSINNRIPIQRRSMSYHVFRTIEKYAHKKVAASLALSS 180

Query: 162 KNSAAFFSAIYNGYEPYETSQLENYQTTHIRNLTNLLHVNVMEQNWEIAYRCFSILIRLP 221
           K    FF  I +GYE     ++ NYQ  H+ +L +LL++N++  +++ AYRCFS+LIR+ 
Sbjct: 181 KKLTGFFEVIRSGYETCPRERITNYQKVHLHHLVDLLYINILRGDFDTAYRCFSLLIRMN 240

Query: 222 GVDIRSIWGIGVRILKEIDRKRSEEFLEWMSSVFSTKNNFNQGTNHAMDPVFRSGSKTHT 281
            VD+RS+W +G +IL+  +    E FLEWMS+V ++ + F Q + + +DPVFRSGS+TH 
Sbjct: 241 FVDLRSMWNLGSKILEHYNLDDQERFLEWMSTVLTSNSAFPQNSKNQLDPVFRSGSRTHI 300

Query: 282 PKFVTSWLWETLMGCTSKDENNGNRDVNKLQFLTEKISELVLTPPYMDDPKIWFIYALCH 341
           P FV SWLW  L     +   +   D+N   +L +KISELVL PPYMDD ++WFIYA+C+
Sbjct: 301 PNFVLSWLWLVLENAVKERVFSSGHDIN---WLLDKISELVLRPPYMDDAEVWFIYAMCY 357

Query: 342 IVEADHLSQQFIENEHIKN--GSRRDIARNQVIQHITNAKNFLQTCQEKGGFQFPKQHIE 399
            ++AD LS Q  +   +    GS+ DIARNQVI++I + KN L+ C+EKGGFQ+PK+ IE
Sbjct: 358 FIKADKLSLQLKQEGSLNGLKGSQLDIARNQVIENIHHVKNHLRICEEKGGFQYPKRVIE 417

Query: 400 KQLSNFENRLYQRTEDLLN 418
            QL  FE RLY  +   +N
Sbjct: 418 AQLVEFEKRLYPESSTHIN 436

>NCAS0H00900 Chr8 (167875..169362) [1488 bp, 495 aa] {ON} Anc_6.46
           YML043C
          Length = 495

 Score =  355 bits (911), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 198/481 (41%), Positives = 292/481 (60%), Gaps = 25/481 (5%)

Query: 1   MFELPVVRTNKKIRSKRKLRYQYINTLNKKHEQLNPKKQTVGLPTPESSAAETSDTDELE 60
           MF+LP   +NK+I ++RK+RY YIN L++K+ + +   ++  LPTPE+SA+E+ ++    
Sbjct: 1   MFDLPTQISNKRIANERKIRYTYINQLSRKYNRQDA--ESSSLPTPENSASESHES--TG 56

Query: 61  DSQSXXXXXXXXXLQSILGHAVXXXXXXXXXXXXXXXXXXXXXXXKHVKNKYYKPQETYE 120
           + +           ++++G AV                       +  K  + KPQE+YE
Sbjct: 57  EDEEVRRRRLKRRWKNVIGEAVSDTDEDEDGEEEREDEGPENQERRFFKT-HEKPQESYE 115

Query: 121 LWTTGPENRVPLNTTSMTYKQYKKIHKAAHRRVTRTLSYSSKNSAAFFSAIYNGYE---P 177
           +W+T    R+PL    +++ +  KI K+  RR+  +L +SSK +   F +I  G E   P
Sbjct: 116 IWSTDNNKRMPLQKKFISFSKLNKIEKSTKRRMQGSLLHSSKFNNICFESISQGQELVTP 175

Query: 178 YETSQLENYQTTHIRNLTNLLHVNVMEQNWEIAYRCFSILIRLPGVDIRSIWGIGVRILK 237
             T   E++   HI NLTNLLH+NVM+  WE+AY+ F++++R+P VDIRSIWGIGV+IL 
Sbjct: 176 LHTP--ESFTLKHIENLTNLLHINVMKGKWEVAYKIFALMVRIPKVDIRSIWGIGVKILS 233

Query: 238 EIDRKRSEEFLEWMSSVFSTKNNFNQGTNHAMDPVFRSGSKTHTPKFVTSWLWETLMGCT 297
           +     + +FL WM+SV+S++ N+ QG  H +DPVFRSGSKTH+ KF  +WLW++L+ CT
Sbjct: 234 QRAATTTLDFLVWMNSVYSSRINYIQGMTHRVDPVFRSGSKTHSSKFTITWLWKSLIYCT 293

Query: 298 SKDENN------GNRDVNKLQFLTEKISELVLTPPYMDDPKIWFIYALCHIVEADHLSQQ 351
             D +       G    +KLQ L EK+SELVL PP+M+D ++WFIYALCH+V+AD LS  
Sbjct: 294 DTDNDEDIDSDYGGFGRDKLQILIEKVSELVLIPPFMEDAEVWFIYALCHMVKADQLSLN 353

Query: 352 FIENEHIKNGSRRDIARNQVIQHITNAKNFLQTCQEKGGFQFPKQHIEKQLSNFENRLYQ 411
           F  N+   NGS RDIARN+VIQ+I   K FLQT   KG F++P++ I +QL+ FE RLY 
Sbjct: 354 FNLNQ--SNGSARDIARNEVIQNIQLVKTFLQTAMSKGHFEYPERFITRQLNTFEERLYS 411

Query: 412 RTE----DLLNNFDSDSSASNEFNRQDFQDVNPI-VYEEENVFGELG--DAQFDIDTYSS 464
           + E    D  NN   + S+ +  N Q   + NPI   E+E VF +    +A  D+DT + 
Sbjct: 412 KDETNSKDKDNNESDNGSSMDNGNIQLVPETNPIPPAEDEYVFSDFSFTNAAHDLDTQAL 471

Query: 465 E 465
           E
Sbjct: 472 E 472

>KLLA0C05852g Chr3 (518508..519956) [1449 bp, 482 aa] {ON} weakly
           similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043C RRN11 rDNA transcription factor CF component
           which also contains Rrn6p and Rrn7p which is required
           for rDNA transcription by RNA polymerase I component of
           rDNA transcription factor
          Length = 482

 Score =  339 bits (870), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 196/486 (40%), Positives = 282/486 (58%), Gaps = 42/486 (8%)

Query: 1   MFELPVVRTNKKIRSKRKLRYQYINTLNKKHEQLNPKKQ-----------TVGLPTPESS 49
           MF+LPV+  + + R +RK+RYQYIN+L +K++QLN  +            T G+ TPE+S
Sbjct: 1   MFQLPVIDRSSRNRKRRKIRYQYINSLKRKYDQLNYNQSEASVSSEADNVTNGILTPENS 60

Query: 50  AAETSDTDELEDSQSXXXXXXXXXLQSILGHAVXXXXXXXXXXXXXXXXXXXXXXXKHVK 109
            +  ++  +LE             LQS+LG+A+                           
Sbjct: 61  ESSEAEAADLEKKH-----RRKRRLQSVLGNALDSSDEELDGDEDGTDENDPET---QFY 112

Query: 110 NKYYKPQETYELWTTGPENRVPLNTTSMTYKQYKKIHKAAHRRVTRTLSYSSKNSAAFFS 169
             + KPQ T+E+W      R P+    +TY   KK+ KAA + VT+ L+Y +K    +F 
Sbjct: 113 ESHIKPQHTFEVWNVNTALRTPIQRKKITYNAVKKLEKAATKSVTKKLNYQTKKLNMYFQ 172

Query: 170 AIYNGYEPYETSQLENYQTTHIRNLTNLLHVNVMEQNWEIAYRCFSILIRLPGVDIRSIW 229
           A+  G++ Y   QL   +T H+ +L  LL+ NV+ QNWEIAYRCFSILIRL  VD+RS+W
Sbjct: 173 ALKFGFDVYPKPQLSKQKTMHLAHLNQLLYTNVLNQNWEIAYRCFSILIRLEDVDVRSLW 232

Query: 230 GIGVRILKEI-DRKRSEEFLEWMSSVFSTKNNFNQGTNHAMDPVFRSGSKTHTPKFVTSW 288
            IG  IL  + D + +E +LEW++ VF ++  FNQGTN+++DPVFR GS+THTP FV +W
Sbjct: 233 SIGSEILNSLGDTQSNEAYLEWLAHVFPSRVQFNQGTNYSLDPVFRCGSRTHTPTFVLTW 292

Query: 289 LWETLMGCTSKDENNGNRDVNK---LQFLTEKISELVLTPPYMDDPKIWFIYALCHIVEA 345
           LW  L   TS     G+  V+K   LQ L +++ E+VL+PPYMDD +IW+I+ L H+V A
Sbjct: 293 LWTRLFIATS-----GSSAVDKEKFLQSLIDRLDEMVLSPPYMDDSEIWYIFGLTHLVMA 347

Query: 346 DHLSQQFIENEHIKNGSRRDIARNQVIQHITNAKNFLQTCQEKGGFQFPKQHIEKQLSNF 405
             LS +F +++ I  GSR DIARNQVIQHI NAKN LQ C+    ++FP+  IE QL   
Sbjct: 348 SELSSKFRQSKDILLGSRADIARNQVIQHINNAKNCLQMCKANSNYEFPENVIEHQLVQL 407

Query: 406 ENRLYQRTEDL-LNNFDSDSSASNE------FNRQD--FQDVNPI---VYEEENVFGELG 453
           E  LY  T++L +N  D  + +S+E      +  +D    DV P+    YE EN+  E+ 
Sbjct: 408 ERSLY--TDELSVNCTDESAKSSDEDGIEHSYPNEDSNLPDVGPLDTQQYEIENLIPEVE 465

Query: 454 DAQFDI 459
            A+F +
Sbjct: 466 SAEFTV 471

>TDEL0G04240 Chr7 (770798..772132) [1335 bp, 444 aa] {ON} Anc_6.46
           YML043C
          Length = 444

 Score =  336 bits (862), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 182/446 (40%), Positives = 262/446 (58%), Gaps = 17/446 (3%)

Query: 1   MFELPVVRTNKKIRSKRKLRYQYINTLNKKHEQLNPKKQTVGLPTPESSAAETSDTDELE 60
           MFE PV  T +++R+ +KLRYQY+N L+ K  +L     T GLPTPE+SAAE+S   E E
Sbjct: 1   MFEQPVALTTRRLRNAKKLRYQYVNNLSAKFNRLERITNTNGLPTPENSAAESS---ENE 57

Query: 61  DSQSXXXXXXXXXLQSILGHAVXXXXXXXXXXXXXXXXXXXXXXXKHVK--NKYYKPQET 118
           ++           L+S  G +                        +  K  N Y  PQE+
Sbjct: 58  EALQRKKKRIRRRLKSAAGESYSDSESDEVDNNHDNEVVEDEEEDQERKFLNNYELPQES 117

Query: 119 YELWTTGPENRVPLNTTSMTYKQYKKIHKAAHRRVTRTLSYSSKNSAAFFSAIYNGYEPY 178
           +E W   P  RVP+  + +++ +Y+++ + A R++  ++  +SK +  +   I  G+E  
Sbjct: 118 FEKWQDDPSKRVPIQRSKISFTKYQRLRRHAKRKMNTSIDLASKRNKIYMDTISEGFEMV 177

Query: 179 ET--SQLENYQTTHIRNLTNLLHVNVMEQNWEIAYRCFSILIRLPGVDIRSIWGIGVRIL 236
           +    + + +Q  HI  LT LLH++V  + W+ AY CF++LIR+P VDIR+IWGIG  IL
Sbjct: 178 DPVDGKPDTFQMKHISILTTLLHLHVSRREWDAAYTCFALLIRVPKVDIRNIWGIGDLIL 237

Query: 237 KEIDRKRSEEFLEWMSSVFSTKNNFNQGTNHAMDPVFRSGSKTHTPKFVTSWLWETLMGC 296
           +E +  +S EFL WMSSV+S+++ F +  NH   PVF  GSKTH PKF T+W+WE+L+ C
Sbjct: 238 REREPIKSLEFLSWMSSVYSSRSAFAEDVNHRTPPVFTKGSKTHVPKFATTWMWESLIQC 297

Query: 297 TSKDENNGNRDV----NKLQFLTEKISELVLTPPYMDDPKIWFIYALCHIVEADHLSQQF 352
           T      G  +     + LQ L E+ISE+VL PPYMD  ++WFIY LCH+++AD LS QF
Sbjct: 298 TKNSLETGELEQIESNDGLQDLIERISEMVLAPPYMDASEVWFIYGLCHLIKADILSNQF 357

Query: 353 IENEHIKNGSRRDIARNQVIQHITNAKNFLQTCQEKGGFQFPKQHIEKQLSNFENRLYQR 412
              +    GS RDIA NQVIQHI   K+ LQTC  KG F++PK++IE+QL  FE RL  R
Sbjct: 358 ---DGRLAGSARDIASNQVIQHIQRTKSCLQTCLSKGDFKYPKRYIERQLEEFEKRL-DR 413

Query: 413 TEDLLNNFDSDSSASNEFNRQDFQDV 438
            ED  +  DSD    +  ++ D Q +
Sbjct: 414 QEDTPD--DSDHEVESLHDKLDTQSI 437

>NDAI0D00890 Chr4 (203085..204704) [1620 bp, 539 aa] {ON} Anc_6.46
           YML043C
          Length = 539

 Score =  331 bits (848), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 191/455 (41%), Positives = 267/455 (58%), Gaps = 49/455 (10%)

Query: 1   MFELPVVRTNKKIRSKRKLRYQYINTLNKKHEQLNPKKQTVG-----LPTPESSAAETSD 55
           MFELP++  NK+  ++RK+RY YIN L+KK+ +   +          LPTPESSA E+ D
Sbjct: 1   MFELPIIYNNKRTATERKIRYTYINQLSKKYNRTQNRHNNNNNNNGILPTPESSATESHD 60

Query: 56  TDELEDSQSX-XXXXXXXXLQSILGHAVXXX--------XXXXXXXXXXXXXXXXXXXXK 106
            D+   S             +S++G A                                 
Sbjct: 61  DDDATTSDDLIKRKRLRRRWKSVIGEAYSDTDLDDDDDDEEEEEDVDVEDEMSDHHESAH 120

Query: 107 HV----KNKYYK----PQETYELWTTGPENRVPLNTTSMTYKQYKKIHKAAHRRVTRTLS 158
           H+    + K++K    PQET+E+W T    RVP+N + +TY + KKI K A R++T  L 
Sbjct: 121 HIHENEERKFFKKYEKPQETFEIWQTNNLKRVPINKSMITYTKLKKIEKQAKRKITVPLL 180

Query: 159 YSSKNSAAFFSAIYNGYE---PYETSQLENYQTTHIRNLTNLLHVNVMEQNWEIAYRCFS 215
           ++SK +   F A+  G E   P  T  +EN+   HI  LT LL++NV  +NW+IAYR F+
Sbjct: 181 HASKINKLCFEAMSEGLELVTPLVT--IENFSLQHIEKLTTLLYLNVSRENWDIAYRIFT 238

Query: 216 ILIRLPGVDIRSIWGIGVRILKEIDRKRSEEFLEWMSSVFSTKNNFNQGTNHAMDPVFRS 275
           +LIR+  +DIRSIWGIGVRIL E    ++ +FL WM+SV+S++ NF QG N+ MDPVF+S
Sbjct: 239 LLIRIKKLDIRSIWGIGVRILSEKSPTKTLDFLNWMNSVYSSRLNFIQGINYRMDPVFKS 298

Query: 276 GSKTHTPKFVTSWLWETLM--------------------GCTSKDENNGNRDVNKLQFLT 315
           GS+THTPK+  +WLW++L+                    G +S+ + + N D N L  L 
Sbjct: 299 GSRTHTPKYTLTWLWKSLIQYSTKKIISGNNNSNESLEDGSSSELDIDINIDRNNLLDLI 358

Query: 316 EKISELVLTPPYMDDPKIWFIYALCHIVEADHLSQQFIENEHIKNGSRRDIARNQVIQHI 375
           EKISE+VL PP+M+D ++WFIY+LCH+V AD LS +F  N  I NGSR DI RNQVIQHI
Sbjct: 359 EKISEMVLIPPFMEDSEVWFIYSLCHMVLADDLSSKF--NPLISNGSRGDIERNQVIQHI 416

Query: 376 TNAKNFLQTCQEKGGFQFPKQHIEKQLSNFENRLY 410
              K++LQT   KG F++P+++I KQLS +E RLY
Sbjct: 417 QKTKSYLQTSMNKGDFEYPEKYILKQLSIYEQRLY 451

>Smik_13.106 Chr13 complement(183859..185379) [1521 bp, 506 aa] {ON}
           YML043C (REAL)
          Length = 506

 Score =  320 bits (819), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 188/470 (40%), Positives = 269/470 (57%), Gaps = 41/470 (8%)

Query: 1   MFELPVVRTNKKIRSKRKLRYQYINTLNKKHEQLNPKKQT-VGLPTPESSAAETSDTDEL 59
           MFE+P+  TNKK   +RKL+YQYIN  +++ E++  K  T + LPTPE+SAAE ++ D+ 
Sbjct: 1   MFEVPITLTNKKFAQRRKLKYQYINHTSRRFEKIVKKSTTALSLPTPENSAAENNEEDDG 60

Query: 60  EDSQSXXXXXXXXXLQ----------SILGHAVXXXXXXXXXXXXXXXXXXXXXXXKHVK 109
           E +            Q          S++G                          K   
Sbjct: 61  ERNGEGGAYRRLILQQRKRRRERHWKSVVGEIYSSTETESDSQEDAEEDEECNTEGKEED 120

Query: 110 --------NKYYKPQETYELW-TTGPENRVPLNTTSMTYKQYKKIHKAAHRRVTRTLSYS 160
                    KY KP+E++E+W T   +N+ P+N   MTY  +KKI K + R++   L + 
Sbjct: 121 IDEERKFWKKYEKPEESFEVWRTVSSQNKSPINKQKMTYHTFKKIEKNSLRKMEVPLLHC 180

Query: 161 SKNSAAFFSAIYNGYEPYE--TSQLENYQTTHIRNLTNLLHVNVMEQNWEIAYRCFSILI 218
           +K S   F ++  G EP +  TS++ NY+T HI  LTNLLH+NV   NW +AY+ F+ LI
Sbjct: 181 TKESKLHFQSLSKGLEPLQPSTSEVRNYRTKHIITLTNLLHLNVSRHNWSLAYKIFATLI 240

Query: 219 RLPGVDIRSIWGIGVRIL-KEIDRKRSEEFLEWMSSVFSTKNNFNQGTNH-AMDPVFRSG 276
           R+PGV I+SIWGIGV IL    +   S +FL+WM  ++S+K  F Q TN+ ++ P F++G
Sbjct: 241 RIPGVQIKSIWGIGVEILNNSPNLSTSLDFLQWMCQIYSSKLRFVQSTNYRSIVPPFQTG 300

Query: 277 SKTHTPKFVTSWLWETLMGCTSK----DENNGNRDV--NKLQFLTEKISELVLTPPYMDD 330
           S+THT KF T++LW +L+ C       D N+   D+  + LQ L ++ISE VLTPP+M+D
Sbjct: 301 SRTHTSKFATTYLWSSLITCQKSMELPDINDKRYDMENDLLQDLIDRISEWVLTPPFMED 360

Query: 331 PKIWFIYALCHIVEADHLSQQFIENEHIKN--GSRRDIARNQVIQHITNAKNFLQTCQEK 388
            ++WFIYA CH+++AD LS+QF  +    +  G  RDI  NQVI+HI   K FLQTC +K
Sbjct: 361 AEVWFIYASCHLLKADILSRQFANDNKTSDLIGLDRDIKINQVIKHIHYVKVFLQTCSDK 420

Query: 389 GGFQFPKQHIEKQLSNFENRLYQRTEDL--------LNNFDSDSSASNEF 430
           GGF  P + IE QL  FE+RLY   +DL         N+ D D+S +N F
Sbjct: 421 GGFTVPNRLIESQLKGFESRLYGEAQDLREREMDDDYNSID-DNSVNNSF 469

>YML043C Chr13 complement(190244..191767) [1524 bp, 507 aa] {ON}
           RRN11Component of the core factor (CF) rDNA
           transcription factor complex; CF is required for
           transcription of 35S rRNA genes by RNA polymerase I and
           is composed of Rrn6p, Rrn7p, and Rrn11p
          Length = 507

 Score =  316 bits (810), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 179/471 (38%), Positives = 274/471 (58%), Gaps = 42/471 (8%)

Query: 1   MFELPVVRTNKKIRSKRKLRYQYINTLNKKHEQLNPKKQTV-GLPTPESSAAETSDTDEL 59
           MFE+P+  TN+K   +RKL+YQYIN ++++ ++++ K  T   LPTPE+SAAE +D +E 
Sbjct: 1   MFEVPITLTNRKFAQRRKLKYQYINYISRRFDRISKKSTTTDSLPTPENSAAENNDEEEG 60

Query: 60  EDSQS---------XXXXXXXXXLQSILGHAVXXXXXXXXXXXXXXXX---------XXX 101
           ++S++                   +S++G                               
Sbjct: 61  QNSEAGTYRRSVLQQKKRRRERHWRSVVGEIYSTTESETDSQEEETEEGGEHDTGIDKED 120

Query: 102 XXXXKHVKNKYYKPQETYELW-TTGPENRVPLNTTSMTYKQYKKIHKAAHRRVTRTLSYS 160
               +    KY KP++++E+W T   +N+ P+N   MTY  +KKI K   R++   L + 
Sbjct: 121 SDEERKFWKKYEKPEKSFEIWRTVSSQNKQPINKQKMTYHNFKKIEKIPLRKMEIPLLHC 180

Query: 161 SKNSAAFFSAIYNGYEPYETS--QLENYQTTHIRNLTNLLHVNVMEQNWEIAYRCFSILI 218
           +K +  +F +I  G EP +TS  ++ NY+T HI  LT+LLH+NV   NW +AY+ F+ LI
Sbjct: 181 TKENKLYFQSISRGLEPLKTSTSEVRNYRTRHIVTLTDLLHLNVSRHNWSLAYKIFATLI 240

Query: 219 RLPGVDIRSIWGIGVRILKEIDRKRSE-EFLEWMSSVFSTKNNFNQGTNH-AMDPVFRSG 276
           R+PGV I+S+WGIGV IL  +    S  +FL+WM  ++S+K+ F Q  N+ ++ P F++G
Sbjct: 241 RIPGVQIKSLWGIGVEILDNLSNSSSGLDFLQWMCQIYSSKSRFVQNINYRSIVPPFQTG 300

Query: 277 SKTHTPKFVTSWLWETLMGCTSKDENNGN-------RDVNKLQFLTEKISELVLTPPYMD 329
           S+THT KF  ++LW +L+ C    E + N        + + LQ L +KISE VLTPP+M+
Sbjct: 301 SRTHTAKFAITYLWSSLINCQKSMEPSSNIIDKPFDTENDLLQELIDKISEWVLTPPFME 360

Query: 330 DPKIWFIYALCHIVEADHLSQQFIENEHIKN---GSRRDIARNQVIQHITNAKNFLQTCQ 386
           D ++WFIYA CH+++AD LS+QF+ N++  N   G  RDI  NQVI+HI   + FL+ C 
Sbjct: 361 DAEVWFIYASCHLLKADTLSRQFV-NDNKNNDLIGLDRDIKINQVIKHIHYVRTFLKICL 419

Query: 387 EKGGFQFPKQHIEKQLSNFENRLYQRTEDL-----LNNFDS--DSSASNEF 430
           +KGGF  P + IE QL +FE+RLY   +D+      N +DS  +SS  N F
Sbjct: 420 DKGGFAVPSRLIENQLKSFESRLYGEAQDIQERDVANVYDSIDNSSVENSF 470

>CAGL0J11792g Chr10 complement(1150752..1152284) [1533 bp, 510 aa]
           {ON} similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043c RRN11 RNA polymerase I specific transcription
           initiation factor
          Length = 510

 Score =  303 bits (777), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 179/485 (36%), Positives = 266/485 (54%), Gaps = 30/485 (6%)

Query: 1   MFELPVVRTNKKIRSKRKLRYQYINTLNKKH---EQLNPKKQTVGLPTPESSAAETSDTD 57
           MFE+P+    +++  +R++RYQYIN L++K+    +   ++Q   LPTPE+SA E   ++
Sbjct: 1   MFEVPITYNCRRLNVERRVRYQYINILSRKYHAKRRSKRRRQANSLPTPENSAVENDQSE 60

Query: 58  -ELEDSQSXXXXXXXXXLQSILGHAVXXXXXXXXXXXXXXXXXXXXXXXKHVKNKYYKPQ 116
            +L   +                 A                        K    KY KP+
Sbjct: 61  SQLPSREQIKEKKMKLGEDYSDSEAETSSEGEDTTKDDNEFANDMNKFEKLFYRKYEKPE 120

Query: 117 ETYELWTTG----PENRVPLNTTSMTYKQYKKIHKAAHRRVTRTLSYSSKNSAAFFSAIY 172
            ++E+W  G     + +  L  T + Y +  ++ + A +RV + + +    +  +F    
Sbjct: 121 HSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIAKKRVEKNVVHMPLVNKRYFDIKS 180

Query: 173 NGYEPYE-TSQLENYQTTHIRNLTNLLHVNVMEQNWEIAYRCFSILIRLPGVDIRSIWGI 231
            GYE  E    +++Y   HI  LT +L  +V + NW+IAYR FS+LIR+P VDIR+IWG+
Sbjct: 181 EGYEVLEPLVDIDSYLLKHIEILTQILFSSVSQGNWDIAYRTFSLLIRIPEVDIRNIWGL 240

Query: 232 GVRILKEIDRK-RSEEFLEWMSSVFSTKNNFNQGTNHAMDPVFRSGSKTHTPKFVTSWLW 290
           G RIL E  +  RS EFL+WMS+V+S+K NF Q   H   PVFRSGS+THTPK+  +WLW
Sbjct: 241 GTRILMERGQTTRSLEFLKWMSTVYSSKQNFVQSHCHRKAPVFRSGSRTHTPKYALTWLW 300

Query: 291 ETLM------------GCTSKDENNGNRD----VNKLQFLTEKISELVLTPPYMDDPKIW 334
             L+            G  + +E N N      ++KL  L +KISE+VL PPY+DDP+IW
Sbjct: 301 NCLIKVTELISIEEEKGVNTNEEENDNGSKQSAMDKLTELIDKISEMVLVPPYLDDPEIW 360

Query: 335 FIYALCHIVEADHLSQQFIENEHIKNGSRRDIARNQVIQHITNAKNFLQTCQEKGGFQFP 394
           FIY++CH+V AD+LS +F  N    +GSRRDIARNQV QHI   K +LQ C +KG F++P
Sbjct: 361 FIYSMCHMVHADYLSGKF--NCQRLSGSRRDIARNQVTQHIHYVKTYLQNCSQKGNFEYP 418

Query: 395 KQHIEKQLSNFENRLYQRTEDLLNNFDSDSSASNEFNRQDFQDVNPIVYEEENVF-GELG 453
           KQ I+ +L  FE R+Y+      N    +S  +  ++ +D ++ NP   +E N F G L 
Sbjct: 419 KQFIQSRLEEFEKRMYEDESKPENMKLQESYDNTSYSNEDDEE-NPFQIDESNSFLGNLV 477

Query: 454 DAQFD 458
           +   D
Sbjct: 478 EEGID 482

>Suva_13.117 Chr13 complement(186472..188013) [1542 bp, 513 aa] {ON}
           YML043C (REAL)
          Length = 513

 Score =  300 bits (769), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 178/477 (37%), Positives = 274/477 (57%), Gaps = 48/477 (10%)

Query: 1   MFELPVVRTNKKIRSKRKLRYQYINTLNKKHEQLNPKKQTV-GLPTPESSAAETS----- 54
           MFE+P+  TNKK   +RKL+YQYIN ++++ +++  K  T   LPTPE+SAAE +     
Sbjct: 1   MFEVPITLTNKKFAQRRKLKYQYINHISRRFDRITKKSNTTDSLPTPENSAAENNDEDYD 60

Query: 55  --------DTDELEDS-QSXXXXXXXXXLQSILGHAVXXXXXXXXXXXXXXXXXXXXXXX 105
                   ++D  E S +           +S++G                          
Sbjct: 61  DDEEERNYESDAGESSIRQQTKRRRERHWKSVIGELYSSTETESDSQEEDDQEGDQVEHE 120

Query: 106 KHVK-----------NKYYKPQETYELW-TTGPENRVPLNTTSMTYKQYKKIHKAAHRRV 153
             +K            KY KP++++E+W T    N+ P+N   +TY  YKKI K + R++
Sbjct: 121 TRLKEEDTDEERKFWKKYEKPEKSFEVWQTVSSHNKSPINKQKITYHNYKKIEKNSLRKM 180

Query: 154 TRTLSYSSKNSAAFFSAIYNGYEPYE--TSQLENYQTTHIRNLTNLLHVNVMEQNWEIAY 211
              L + +K +  +F  +  G EP +  TS   NYQT HI  LTNLLH+NV   NW +AY
Sbjct: 181 EIPLLHCTKENKLYFQLLAKGLEPLQSPTSAARNYQTRHIITLTNLLHLNVSRHNWPLAY 240

Query: 212 RCFSILIRLPGVDIRSIWGIGVRIL-KEIDRKRSEEFLEWMSSVFSTKNNFNQGTNH-AM 269
           + F+ LIR+P V I+SIWGIGV+IL    +   S +FL+WM  V+S+K+ F Q  N+ ++
Sbjct: 241 KIFATLIRIPNVQIKSIWGIGVKILDNSPNLSSSLDFLQWMCQVYSSKSRFVQNVNYRSV 300

Query: 270 DPVFRSGSKTHTPKFVTSWLWETLMGC------TSKDENNGNRDVNKLQFLTEKISELVL 323
            P F++GS+THT KF  ++LW  L+ C      ++  +N  + + ++L+ L ++ISE VL
Sbjct: 301 VPPFQTGSRTHTSKFAITYLWSCLISCQKSIESSNATDNQYDMENSRLEELIDQISEWVL 360

Query: 324 TPPYMDDPKIWFIYALCHIVEADHLSQQFIENEHIKN---GSRRDIARNQVIQHITNAKN 380
            PP+M+D +++FIYA CH+++AD LS+QF+ N++  N   G  +DI  NQVI++I   K 
Sbjct: 361 IPPFMEDAEVYFIYASCHLLKADLLSRQFV-NDNRNNDLVGLNKDIKINQVIKNIHYVKV 419

Query: 381 FLQTCQEKGGFQFPKQHIEKQLSNFENRLYQRTED-----LLNNFDS--DSSASNEF 430
           FLQTC +KGGF  P + IE QL +FE+RLY   +D     +++++D+  +SSA N F
Sbjct: 420 FLQTCLDKGGFTIPNRLIENQLKSFESRLYGEAQDIHERRMVDDYDNTDNSSADNSF 476

>KAFR0L00420 Chr12 (77468..78850) [1383 bp, 460 aa] {ON} Anc_6.46
           YML043C
          Length = 460

 Score =  288 bits (737), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 184/478 (38%), Positives = 261/478 (54%), Gaps = 48/478 (10%)

Query: 1   MFELPVVRTNKKIRSKRKLRYQYINTLNKKHEQLNPKKQTVGLPTPESSAAETSDTDELE 60
           MFE+PV   +K + ++RKLRY+YIN   ++ E+   K    G+ TPE+S       DEL+
Sbjct: 1   MFEIPVNVNSKTLSNERKLRYRYINQFTRRFER---KDDRNGMITPETSE------DELQ 51

Query: 61  DSQSXXXXXXXXXLQSILGHAVXXXXXXXXXXXXXXXXXXXXXXXKHVKN-------KYY 113
             +          L  I  +                          ++ N       K  
Sbjct: 52  QRKKRDW------LHVIGEYGSDDDERSGGQQDDEEEEEEVIDEDYNLNNEERKFFKKID 105

Query: 114 KPQETYELWTTGPENRVPLNTTSMTYKQYKKIHKAAHRRVTRTLSYSSKNSAAFFSAIYN 173
           KPQETYE W +    +  +    +TY +Y K+ +   R++  +L + S  +   F    +
Sbjct: 106 KPQETYEHWPSH-RKKTRIQRDILTYHRYNKVSRYVERKMANSLVHVSSKNRYHFKCKID 164

Query: 174 GYEPYET--SQLENYQTTHIRNLTNLLHVNVMEQNWEIAYRCFSILIRLPGVDIRSIWGI 231
           G E  E       N+Q   I  LTNLL++NV   NWEIAY+ F++LIR+P VDIRS+W +
Sbjct: 165 GMEIVEPLHKGATNFQLKQIETLTNLLYLNVNRGNWEIAYKIFAMLIRIPKVDIRSVWNV 224

Query: 232 GVRILKEIDRKRSEEFLEWMSSVFSTKNNFNQGTNHAMDPVFRSGSKTHTPKFVTSWLWE 291
           G RIL E D+ RS EFLEWMSSV+ST+  F QG N+  DPVFRSGSK HTPK+   WLW 
Sbjct: 225 GNRILYEKDKLRSLEFLEWMSSVYSTRVTFIQGINYRFDPVFRSGSKNHTPKYTLQWLWN 284

Query: 292 TLMGCTSKDENNGNRDVNKLQFLTEKISELVLTPPYMDDPKIWFIYALCHIVEADHLSQQ 351
           +L+  T +   N + +++K   L +KI+E+VL PP+MDDP+IWFIY++CH+V+AD LS +
Sbjct: 285 SLLEYTEQLFENDDENIDK---LIDKIAEMVLIPPFMDDPEIWFIYSMCHMVKADFLSSK 341

Query: 352 FIENEHIKNGSRRDIARNQVIQHITNAKNFLQTCQEK--GGFQFPKQHIEKQLSNFENRL 409
           F  + H   GS RDI+ NQVIQHI + K +L  C+EK  G ++  +  I KQL  FE RL
Sbjct: 342 F--DTH-SVGSMRDISMNQVIQHINDVKRYLNVCKEKSQGQYESNEMIITKQLKAFEVRL 398

Query: 410 YQRTEDLL---NNFDSDSSASNEFNRQDFQDVNPIVYEEENVFGELGDAQF---DIDT 461
           Y+     L   N+ D D       N ++  + N  V+E+   + E  D Q    D+DT
Sbjct: 399 YKEPVFPLEPENDLDGD-------NEEEVDESN--VFEDSANYFEFDDTQEQLNDLDT 447

>Skud_13.105 Chr13 complement(181845..183383) [1539 bp, 512 aa] {ON}
           YML043C (REAL)
          Length = 512

 Score =  288 bits (737), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 154/341 (45%), Positives = 221/341 (64%), Gaps = 22/341 (6%)

Query: 111 KYYKPQETYELWTTGP-ENRVPLNTTSMTYKQYKKIHKAAHRRVTRTLSYSSKNSAAFFS 169
           K+ KP+ ++E+W T   +N+ P+N   MTY +++KI K + R+V   L + +K +  +F 
Sbjct: 136 KHEKPERSFEIWQTASLQNKGPINRRKMTYHKFQKIQKNSLRKVQIPLLHCTKENRLYFR 195

Query: 170 AIYNGYEPYET--SQLENYQTTHIRNLTNLLHVNVMEQNWEIAYRCFSILIRLPGVDIRS 227
           ++  G EP +T  S + NYQT HI  LTNLLH+NV   NW +AYR F+ LIR+P V ++S
Sbjct: 196 SLSKGLEPLQTPTSTIRNYQTRHIITLTNLLHINVSRHNWSLAYRIFATLIRIPEVQMKS 255

Query: 228 IWGIGVRILKEI-DRKRSEEFLEWMSSVFSTKNNFNQGTNH-AMDPVFRSGSKTHTPKFV 285
           IWG GV+IL  + D   S +FL+WM  ++S+K  F Q  NH ++ P F++GS+THT KF 
Sbjct: 256 IWGFGVKILDNLPDSSSSLDFLQWMCQIYSSKARFVQNINHRSIVPPFQTGSRTHTAKFA 315

Query: 286 TSWLWETLMGCTSKDE----NNGNRDV--NKLQFLTEKISELVLTPPYMDDPKIWFIYAL 339
           T++LW +L+ C    E    N+ + D+  ++LQ L +KISE VLTPP+M+D ++WFIYA 
Sbjct: 316 TTYLWASLINCQKSIEPSTINDKHYDMENDRLQELIDKISEWVLTPPFMEDAEVWFIYAS 375

Query: 340 CHIVEADHLSQQFIENEHIKN---GSRRDIARNQVIQHITNAKNFLQTCQEKGGFQFPKQ 396
           CH+++AD LS+QF+ N+  K    G  RDI  NQVI+HI   K FLQTC +KGGF  P +
Sbjct: 376 CHLLKADILSRQFV-NDGTKGDLIGLDRDIKINQVIKHIHYVKVFLQTCLDKGGFTIPNR 434

Query: 397 HIEKQLSNFENRLYQRTED-----LLNNFDSD--SSASNEF 430
            IE QL NFE RLY  T+D     +++ +D    SS  N F
Sbjct: 435 LIEIQLKNFELRLYGETQDVQEREIVDGYDETDISSVENSF 475

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 36/52 (69%), Gaps = 1/52 (1%)

Query: 1  MFELPVVRTNKKIRSKRKLRYQYINTLNKKHEQLNPKKQTV-GLPTPESSAA 51
          MFE+P+  TNKK   +RKL+YQYIN L+++ +++     T   LPTPE+SA 
Sbjct: 1  MFEVPITLTNKKFAQRRKLKYQYINHLSRRFDKVAKTTNTTDSLPTPENSAV 52

>KNAG0E00910 Chr5 complement(171075..172535) [1461 bp, 486 aa] {ON}
           Anc_6.46 YML043C
          Length = 486

 Score =  249 bits (635), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 162/499 (32%), Positives = 252/499 (50%), Gaps = 63/499 (12%)

Query: 1   MFELPVVR---TNKKIRSKRKLRYQYINTLNKKHEQLNPKKQTVGLPTPESSAAETSDTD 57
           MFELPV+    +  +   ++KLRY+Y N +  +++++    +  G  TPESS  E  D +
Sbjct: 1   MFELPVLLGSFSESQSLVRKKLRYRYRNEIKNQYKRIKIHDEN-GQLTPESSHTELDDHE 59

Query: 58  --------------ELEDSQSXXXXXXXXXLQSILGHAVXXXXXXXXXXXXXXXXXXXXX 103
                         +L D +           Q  +G                        
Sbjct: 60  SRSRVCRGRKRRLYDLRDREEHGFESDSSEAQDEVG-----------DLPEKEEEEIGHE 108

Query: 104 XXKHVKNKYYKPQETYELWTTGPENR-VPLNTTSMTYKQYKKIHKAAHRRVTRTLSYSSK 162
             K+ KN + KP++ YE+W    E R VP+    ++Y + + I + A R++   L + S+
Sbjct: 109 ERKYFKN-HEKPEDLYEVWHVATERRKVPIQRQFVSYNRLQTIERRAKRKMEVPLLHVSR 167

Query: 163 NSAAFFSAIYNGYEPY----ETSQLENYQTTHIRNLTNLLHVNVMEQNWEIAYRCFSILI 218
             ++ FSA  +GY+      ET+  EN    HI+ L  LLH ++  +NW +AY+ F++LI
Sbjct: 168 VRSSEFSAEIDGYDVVSRGDETTHFEN---KHIQLLVTLLHRHISTENWNLAYKVFALLI 224

Query: 219 RLPGVDIRSIWGIGVRILKEIDRKRSEEFLEWMSSVFSTKNNFNQGTNHAMDPVFRSGSK 278
           R+P VDIR++W +GV IL   D   + +FLEWM SV+S K+ F Q  NH + P FRSGS+
Sbjct: 225 RMPRVDIRAVWNLGVAILARRDSTTAIDFLEWMHSVYSNKHRFIQNVNHRLPPAFRSGSR 284

Query: 279 THTPKFVTSWLWETLMGCTSKDENNGNRDVNKLQFLTEKISELVLTPPYMDDPKIWFIYA 338
           THT ++ T+WLW +L   T + +      +  L+ LT+K SEL+LTPPYMDD ++WFIY 
Sbjct: 285 THTAQYTTTWLWLSLRAATEQAQEGAPTTLEPLELLTDKTSELLLTPPYMDDSEVWFIYC 344

Query: 339 LCHIVEADHLSQ----QFIENEHIKNGSRRDIARNQVIQHITNAKNFLQTCQEKGG---- 390
            C+ V+AD LS+        N H  + S  D+ RN+V+Q IT  +  L T +EK      
Sbjct: 345 SCYFVKADILSRNIHSDLTHNVHAFSSSTMDLRRNEVVQSITRCQKTLHTAEEKSDQARH 404

Query: 391 -----FQFPKQHIEKQLSNFENRLYQRTEDLLNNFDSDSSASNEFN--------RQDFQD 437
                ++ P  +I++QL   E RL  ++       D  SS ++  N         +D  D
Sbjct: 405 RAHAYWELPTGYIKRQLQQIEKRLTAQS----TPRDQPSSPAHYENYGLGDTELAEDQAD 460

Query: 438 VNPIVYEEENVFGELGDAQ 456
           ++    EE+N F +  D Q
Sbjct: 461 IDAFPIEEDNSFLQALDTQ 479

>TBLA0B00570 Chr2 complement(113646..115199) [1554 bp, 517 aa] {ON}
           Anc_6.46 YML043C
          Length = 517

 Score =  228 bits (580), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 147/490 (30%), Positives = 245/490 (50%), Gaps = 70/490 (14%)

Query: 1   MFELPVVRTNKKIRSKRKLRYQYINTLNKKHEQL------------NPKKQTVGLPTPES 48
           MFE P+   +K + ++RK+RYQYINT  K++ QL            N  +  + LPTPE+
Sbjct: 1   MFEAPLNIHSKVLANERKIRYQYINTFTKRYSQLYGDTIPSSSLESNRSRTPITLPTPEA 60

Query: 49  SAAETSD--TDELEDSQSXXXXXXXXXLQSILGHAVXXXXXXXXXXXXXXXXXXXXXXXK 106
           SA E SD  T+  +DS S                 +                       K
Sbjct: 61  SAHEHSDSNTNYNDDSDS-----------------ISNTNTLSDDEYNSDSTGTTNEETK 103

Query: 107 HVKNKYYKPQETYELWTTGPE-----------NRVPLNTTSMTYKQYKKIHKAAHRRVTR 155
              N+Y +PQE++E+W T  +            R+P+N   +++ +  ++ K  ++++  
Sbjct: 104 FF-NRYDRPQESFEVWNTSIDTLNSKTKLKSNGRIPINRNKISFNRLNRVKKFTNKKLEA 162

Query: 156 TLSYSSKNSAAFFSAIYNGYE-PYETSQLENYQTTHIRNLTNLLHVNVMEQNWEIAYRCF 214
            L + +K       AI  GYE  Y   Q  ++   HI NL NLL+ N+ E+N+  AY  F
Sbjct: 163 RLQHCTKRLKTHIKAISEGYETSYRDKQTTSFNNIHIENLINLLYYNICEKNFNQAYHIF 222

Query: 215 SILIRLPGVDIRSIWGIG-VRILKEIDRKRSEEFLEWMSSVFSTKNNFNQGTNHAMDPVF 273
           S++IRLP +DIR+ W +G + +LK++  + S  FL W+ S++S+   +N   N+   P F
Sbjct: 223 SLIIRLPNIDIRNFWNLGSIILLKKVSIQESLNFLNWIHSIYSSNQKYNNSINYKTAPAF 282

Query: 274 RSGSKTHTPKFVTSWLWETLMGCTSKDENNGNRDVNKL-----------QFLTEKISELV 322
              S+ HT KF TS+LW TL    +K  +  +R++ ++           +   EK+SE+V
Sbjct: 283 TQSSRNHTGKFTTSFLWMTLSLIHTKFSDLTSRNIKEIVEELNYLKKKLKKFVEKLSEMV 342

Query: 323 LTPPYMDDPKIWFIYALCHIVEADHLSQQFIENEHIKNGSRRDIARNQVIQHITNAKNFL 382
           L PP+++D +IW+IY+L H++ A  L  +   N+  +    +DI +N++I +I + K+ L
Sbjct: 343 LAPPFIEDSEIWYIYSLSHLILARMLMFETRNNDISQTSVEKDITKNEIISNIQHCKSHL 402

Query: 383 QTCQE-KGGFQFPKQHIEKQLSNFENRLYQRTEDLLNNFDSDSSASNE-FNRQDFQDVNP 440
           Q  +E +  + F  Q IE +L + E +LY            D+S+  E  N ++F D   
Sbjct: 403 QKVRENQNDYNFKFQKIEIELKDMEKKLY------------DTSSDEEILNEEEFLDNED 450

Query: 441 IVYEEENVFG 450
           ++  EEN F 
Sbjct: 451 VLDNEENNFN 460

>TPHA0J00510 Chr10 complement(114098..115411) [1314 bp, 437 aa] {ON}
           Anc_6.46 YML043C
          Length = 437

 Score =  211 bits (538), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 144/446 (32%), Positives = 223/446 (50%), Gaps = 52/446 (11%)

Query: 1   MFELPVVRTNKKIRS--KRKLRYQYINTLNKKHEQLNPKKQTVGLPTPESSAAETSDTDE 58
           MFELPV  +N  I +   +KLRYQYIN +N KH +L+  +    LPTP +S  +T   D 
Sbjct: 1   MFELPV-SSNITINAFNLKKLRYQYINDINAKHNELSKNE----LPTPVTSENDTGGEDL 55

Query: 59  LEDSQSXXXXXXXXXLQ--------SILGHAVXXXXXXXXXXXXXXXXXXXXXXXKHVKN 110
             DS+           Q        SI+G A+                          K 
Sbjct: 56  DGDSEHNLTSEDAEVAQERRIRRWKSIMGEAIDDDEDDNNHDDDVDNEFEDNGPTDEEKK 115

Query: 111 ---KYYKPQETYELWTTGPENRVP-LNTTSMTYKQYKKIHKAAHRRVTRTLSYSSKNSAA 166
              +Y KPQE++E W +    R   +N   +TY ++KK  K   ++      + +KN   
Sbjct: 116 YFLRYDKPQESFEKWESNNLKRQRHVNKNFITYYRFKKTRKQIDKKYKVKTMHLNKNVKN 175

Query: 167 FFSAIYNGYEPYETSQ------LENYQTTHIRNLTNLLHVNVMEQNWEIAYRCFSILIRL 220
            F  + +G+EP   +       L+NY   H+  LT+L++ N+ +Q W+IAY+CF+ L+R+
Sbjct: 176 NFELMIDGFEPINDNNISRNRNLQNYNKHHLSLLTDLMYSNIFKQKWDIAYKCFTFLLRI 235

Query: 221 PGVDIRSIWGIGVRILKEIDRKRSEEFLEWMSSVFSTKN-NFNQGTNHAMDPV-FRSGSK 278
           P VDIR +W +G  IL+ ID  +  +FL+W+S+V+S KN +F QG N+  D   F  GS+
Sbjct: 236 PDVDIRRVWNLGSIILQNIDTTKLIDFLQWLSNVYSNKNRSFVQGINYRNDQTNFNGGSR 295

Query: 279 THTPKFVTSWLWETLMGCTSKDENNGNRDVNKLQFLTEKISELVLTPPYMDDPKIWFIYA 338
             TP +  + LW  L    S D      +++    L E+I+E+V+ PPY +D +IW+I+A
Sbjct: 296 RLTPLYTKTLLWHKL--TLSSDSETCESEIDS---LIEQIAEMVVIPPYSEDNEIWYIFA 350

Query: 339 LCHIVEADHLSQQFIENEHIKNGSRR--------------DIARNQVIQHITNAKNFLQT 384
           LCH+V+AD+LS      E +   SRR              +I  N++   I N K +L+ 
Sbjct: 351 LCHLVKADNLS------EKLYFMSRRNPEVDEMDTYPYDTEIYNNKITICINNCKKYLRK 404

Query: 385 CQEKGGFQFPKQHIEKQLSNFENRLY 410
             +   F +P + IE +L   E R +
Sbjct: 405 ATQDKNFDYPARTIETKLKTIETRTF 430

>Kpol_1037.11 s1037 (23974..25179) [1206 bp, 401 aa] {ON}
           (23974..25179) [1206 nt, 402 aa]
          Length = 401

 Score =  197 bits (501), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 124/418 (29%), Positives = 225/418 (53%), Gaps = 28/418 (6%)

Query: 1   MFELPVVRTNKK-IRSKRKLRYQYINTLNKKHEQLNPKKQTVGLPTPESSAAETSDTDEL 59
           MFE+P + + K+ + + +KLRYQY+N +   +E+    K   GLPTP SS  E + +++ 
Sbjct: 1   MFEVPTIDSTKRSVVNFKKLRYQYMNHM---YERNRYNKNGQGLPTPVSSENEMNASED- 56

Query: 60  EDSQSXXXXXXXXXLQSILGHAVXXXXXXXXXXXXXXXXXXXXXXXKHVKNKYYKPQETY 119
           E S           +   +                           K   ++Y KP++++
Sbjct: 57  EVSHKRVRKRWRRIVGESVSSD------EEEEEEEEDEQEQEGDEEKKYFSRYDKPEDSF 110

Query: 120 ELWTTGPENRVPLNTTSMTYKQYKKIHKAAHRRVTRTLSYSSKNSAAFFSAIYNGYEPYE 179
           E W +  ++R  +N   M+YK+Y K+ K + +++   L  S++     F ++ +GYE  +
Sbjct: 111 ERWASNTKHRKSINRKMMSYKKYNKLTKYSRKKIQVPLIRSNRKLQENFLSVIDGYELID 170

Query: 180 --TSQLENYQTTHIRNLTNLLHVNVMEQNWEIAYRCFSILIRLPGVDIRSIWGIGVRILK 237
              +  EN+   +++ LT+L++ ++ ++NW+IAYRCF++LIRLP   IR IW +G  I++
Sbjct: 171 DNINLKENFTMVNVKLLTDLMYESIFKENWKIAYRCFTLLIRLPKTSIRKIWNLGSMIIE 230

Query: 238 EIDR-KRSEEFLEWMSSVFS--TKNNFNQGTNHAMDPVFRSGSKTHTPKFVTSWLWETLM 294
            ++   ++ EFL+  +++ S   K  FNQ  N+   PVF  GS+  TP ++ + LW+ + 
Sbjct: 231 NLEGINKTIEFLKLFNNIHSRYKKKIFNQTVNYREAPVFNDGSRNKTPIYIKTLLWKEIT 290

Query: 295 GCTSKDENNGNRDVNKLQFLTEKISELVLTPPYMDDPKIWFIYALCHIVEADHLS---QQ 351
             ++    + N +      L E +SEL L PP+M+D +IW+IY + H+  A+ LS   + 
Sbjct: 291 TTSTSSRTSSNYNE-----LIEYLSELTLIPPFMEDSEIWYIYGIVHLQRANELSMNLEH 345

Query: 352 FIENEHIKNGSRRDIARNQVIQHITNAKNFLQTCQEKGGFQFPKQHIEKQLSNFENRL 409
           +I+N    + S +DIA N+V+Q+I  A+ FL+  +E    + P++ I   + N E R+
Sbjct: 346 YIDN----SSSSKDIANNEVVQNIKLAQKFLKKAKELSKIEVPERQITLMIKNIEGRM 399

>TBLA0A06590 Chr1 (1614194..1615279) [1086 bp, 361 aa] {ON}
           Anc_3.353 YBR105C
          Length = 361

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 2/77 (2%)

Query: 153 VTRTLSYSSKNSAAFFSAIYNGYEPYETSQLENYQTTHIRNL-TNLLHVNVMEQNWEIA- 210
           +T + S+   N+ +F   +   Y PY TS  +  QT  IR++ TN L  N+    ++I+ 
Sbjct: 99  LTPSKSFIKANNHSFGKYMVQDYSPYNTSTPQTIQTPMIRSVRTNYLRPNMRFTGYQISG 158

Query: 211 YRCFSILIRLPGVDIRS 227
           Y+ + + I L  VD+ S
Sbjct: 159 YKRYQVSILLKTVDLPS 175

>KLLA0B04565g Chr2 (409720..410298) [579 bp, 192 aa] {ON} highly
           similar to uniprot|P25719 Saccharomyces cerevisiae
           YML078W CPR3 Mitochondrial peptidyl-prolyl cis- trans
           isomerase (cyclophilin) catalyzes the cis-trans
           isomerization of peptide bonds N-terminal to proline
           residues involved in protein refolding after import into
           mitochondria
          Length = 192

 Score = 30.4 bits (67), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 43/106 (40%), Gaps = 6/106 (5%)

Query: 360 NGSRRDIARNQVIQHIT--NAKNFLQTCQEKGGFQFPKQHIEKQLSNFENRLYQRTEDLL 417
           NG++ D    ++   I    A+NF   C  + GF +      + + NF   L     DL 
Sbjct: 39  NGNKMDRIEFELYDDIVPKTAENFRALCTGEKGFGYKGVPFHRIIPNF--MLQGGDTDLT 96

Query: 418 NNFDSDSSASNEFNRQDFQD--VNPIVYEEENVFGELGDAQFDIDT 461
           N +   S   N+F  ++FQ+    P +    N       +QF I T
Sbjct: 97  NGYGGKSIYGNKFADENFQEKHTKPGLLSMANAGPNTNGSQFFITT 142

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,401,548
Number of extensions: 2289841
Number of successful extensions: 8920
Number of sequences better than 10.0: 51
Number of HSP's gapped: 9117
Number of HSP's successfully gapped: 61
Length of query: 465
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 352
Effective length of database: 40,524,141
Effective search space: 14264497632
Effective search space used: 14264497632
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)