Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E01958g6.45ON52452424970.0
KLTH0C10604g6.45ON51552511611e-154
TDEL0G042506.45ON51753610881e-143
Kwal_56.225226.45ON51353110771e-141
ZYRO0C07194g6.45ON55857610261e-133
Skud_15.1486.45ON5485498481e-106
YOL013C (HRD1)6.45ON5515548421e-106
Smik_15.1576.45ON5505558411e-105
Suva_15.1596.45ON5505488191e-102
TPHA0F024806.45ON6055998131e-101
TBLA0B005606.45ON4925377971e-100
KAFR0A052406.45ON5535627913e-98
Kpol_1035.506.45ON6015797605e-93
NCAS0D020106.45ON5105197395e-91
CAGL0E02299g6.45ON5454166772e-81
NDAI0C027706.45ON6305056797e-81
KNAG0E027406.45ON5564276372e-75
ACL019C6.45ON5755666279e-74
KLLA0C05874g6.45ON5535546102e-71
Ecym_30486.45ON6703935009e-55
AGR034W3.279ON159891162e-06
SAKL0A09812g2.545ON751571215e-06
KAFR0B030708.317ON643491162e-05
AFR275W2.545ON753571162e-05
TDEL0B063402.545ON762781152e-05
KLTH0D07216g2.545ON747571143e-05
Ecym_72412.545ON758581144e-05
KLTH0G12408g8.317ON603291135e-05
Smik_4.3878.317ON634521125e-05
YKL034W (TUL1)2.545ON758591126e-05
Suva_11.1892.545ON758591126e-05
KAFR0B014602.545ON761591126e-05
KLLA0E04071g8.317ON704321126e-05
Skud_11.1922.545ON758591117e-05
Skud_4.4028.317ON612501117e-05
TBLA0I014902.545ON750571118e-05
Kwal_26.80992.545ON750591118e-05
TPHA0C042602.545ON757781101e-04
NDAI0H008405.628ON341561081e-04
NCAS0C033108.317ON570321091e-04
NDAI0A074503.279ON173811041e-04
Ecym_42508.317ON657371091e-04
CAGL0L01947g2.545ON757591092e-04
NCAS0A047602.545ON761571082e-04
TBLA0A096405.628ON325761062e-04
Kpol_1036.668.317ON668631073e-04
KLLA0F25674g2.545ON757671073e-04
Smik_11.2132.545ON759591063e-04
CAGL0E01441g8.317ON717291063e-04
KNAG0A070902.545ON762751054e-04
TDEL0A049405.628ON326541025e-04
ZYRO0E05632g2.545ON765281046e-04
KLTH0C05258g3.279ON15281986e-04
NCAS0A113503.405ON428561027e-04
Kwal_27.105463.279ON10480947e-04
Kpol_1002.72.545ON754591037e-04
KLLA0E16677g5.628ON305661000.001
Skud_2.1863.279ON17874970.001
Suva_2.4335.628ON337661000.001
AER390W5.628ON316661000.001
KNAG0G023908.317ON688291010.001
SAKL0G07370g5.628ON321561000.001
TDEL0D034603.279ON14438950.001
Suva_2.3048.317ON624371000.001
SAKL0A09526gna 1ON662881000.002
Kpol_526.345.628ON32877990.002
NCAS0A04680singletonON27481980.002
YDR143C (SAN1)8.317ON610411000.002
Skud_4.5285.628ON33749980.002
Ecym_13285.628ON32049980.002
SAKL0D08272g1.389ON14911221000.002
Kwal_26.8030na 1ON66088990.002
CAGL0M08690g5.628ON32849970.002
YDR265W (PEX10)5.628ON33754960.003
KLTH0D06886gna 1ON66488970.003
NDAI0K018102.545ON76225970.003
Kwal_56.239008.317ON58937970.004
ZYRO0C11176g5.628ON36849960.004
Kpol_1052.193.279ON10357880.004
SAKL0H17116gsingletonON54441960.005
Smik_4.5165.628ON33766950.005
KLLA0F12166g1.389ON1528135960.005
TBLA0A039008.317ON69851960.005
CAGL0K02563g2.542ON58653950.005
Kwal_55.199995.628ON15249900.006
TPHA0C008508.317ON78129950.006
NDAI0G026308.317ON66129950.006
YBR062C3.279ON18071910.007
Suva_4.3023.279ON15035900.007
SAKL0C01760gsingletonON147462950.007
SAKL0C03586gsingletonON147462950.007
Smik_2.1963.279ON18535900.009
TDEL0A03090na 1ON58648920.013
CAGL0K08052g3.405ON30553910.013
CAGL0B05049g1.389ON147026930.013
Ecym_54453.405ON32155910.014
Ecym_26583.279ON15947870.015
ZYRO0D05830g8.317ON78029920.015
CAGL0I04576g3.190ON14984860.018
KLLA0F18458g3.279ON14089860.019
KLTH0E02464g5.628ON32949890.023
TDEL0F044408.317ON55484890.030
KNAG0C056602.542ON50780890.030
KAFR0A019902.542ON56053890.032
SAKL0H15686g8.317ON59937890.033
KNAG0I013801.389ON149326890.033
TPHA0A039903.279ON17528850.034
KNAG0J008503.279ON16247850.035
Ecym_7253na 1ON61781870.051
Kpol_1048.731.389ON154949880.055
NCAS0A082803.279ON11838810.056
NDAI0B018202.542ON62549870.056
KLTH0G18150g1.389ON155467870.059
NCAS0A087801.389ON150250870.059
Suva_8.422.542ON58549870.060
SAKL0D03058g3.279ON15575820.064
ZYRO0B02046gna 1ON44586860.068
ZYRO0E05192g1.389ON152026870.070
ABR104W3.405ON32829850.072
TBLA0I019603.279ON18435830.075
Smik_8.322.542ON58549860.077
NCAS0C052905.628ON33049850.082
YHL010C (ETP1)2.542ON58549850.083
Skud_8.352.542ON58549850.084
TBLA0G023102.542ON67430850.091
KNAG0A074303.405ON10255780.096
KAFR0C004603.279ON15795810.096
SAKL0G09284g5.339ON29659830.10
KAFR0H005605.628ON32749830.11
Kwal_56.231123.190ON13545790.12
TDEL0H033703.190ON153134800.13
TDEL0D008604.332ON458103840.13
TDEL0B061701.389ON147026840.13
CAGL0H10274g3.279ON17569800.16
ZYRO0C17424g3.405ON27352820.17
TPHA0C042502.542ON55626830.17
TPHA0I005608.808ON39460820.17
TPHA0C003505.628ON27844810.19
ZYRO0B02244g2.542ON56349820.19
NDAI0G052001.389ON158649830.21
TDEL0F02870na 2ON26046810.21
AAL030C1.389ON1539159830.22
KNAG0A012803.28ON11426760.23
Kpol_1002.82.542ON55826810.26
TDEL0A031802.542ON56749810.27
ZYRO0E06996g3.279ON17238780.29
TPHA0A033403.405ON38453800.31
Kwal_14.12871.389ON151850810.31
NCAS0A125502.542ON57226800.34
SAKL0A09746g2.542ON54839800.34
KNAG0I020902.157ON42793800.35
KLLA0C15697g3.405ON30452790.39
TBLA0B026708.808ON47857800.39
Kpol_480.228.808ON42557790.41
KLTH0D07150g2.542ON54049790.47
KAFR0I020901.389ON146626790.50
KLLA0F25740g2.542ON51750790.51
Kwal_55.21206singletonON27562780.53
YPR093C (ASR1)3.405ON28827780.55
CAGL0H07315g5.339ON27860770.61
TBLA0C013301.389ON145256790.62
KLLA0E18503gna 1ON65048780.65
TPHA0A003803.22ON131057780.66
Suva_10.3441.389ON156091780.73
AER016C3.190ON14782740.79
KLTH0F07062g5.339ON28759760.92
YLR247C (IRC20)1.389ON155626771.0
TPHA0B036501.389ON157626771.1
CAGL0B02013g8.288ON112033761.1
KNAG0J015605.628ON30929751.1
Kwal_26.80902.542ON52049761.2
TBLA0B087103.28ON12251711.3
NDAI0D02810na 2ON252112741.3
KLTH0F18502gsingletonON26757741.5
KLLA0E07151g3.28ON11051701.5
Smik_14.153.29ON33483741.6
SAKL0B08976g3.405ON32269741.7
Kwal_55.220543.28ON11126691.8
Kwal_56.235438.247ON96592751.8
KLLA0E17711g3.190ON16237711.8
YOL138C (RTC1)3.22ON134125751.8
SAKL0C13178g3.28ON13826702.0
KAFR0C017803.28ON11826692.0
Kpol_1014.163.28ON10752692.0
CAGL0E01567g3.28ON10226682.0
KAFR0F028406.332ON44524732.1
KLTH0F19228g3.28ON11022692.2
Skud_12.3281.389ON155726742.3
Suva_15.223.22ON133625742.4
SAKL0A06072g6.154ON44593732.4
KAFR0D046405.339ON30272722.5
NDAI0G038103.22ON139351742.5
NDAI0I004006.332ON48126732.5
Smik_12.3201.389ON155326742.5
Smik_4.587.294ON8523672.5
YDL181W (INH1)7.294ON8523672.5
Skud_15.163.22ON133225732.5
KAFR0I028603.22ON136558732.6
Skud_15.203.28ON12126692.6
TPHA0P014703.28ON11126682.7
Suva_2.2918.288ON115133732.7
KAFR0H007103.405ON22851712.7
TDEL0A004103.22ON126241732.8
NCAS0B009908.808ON39238722.9
ZYRO0C03058g3.28ON11626683.0
NCAS0C044803.28ON10926673.1
TDEL0A004703.28ON11826683.2
NDAI0G038603.28ON12326683.2
NDAI0E004408.808ON41652723.3
YOL054W (PSH1)8.808ON40657713.6
TDEL0E028705.339ON28841713.6
Kpol_538.53.405ON33527713.7
Smik_15.1138.808ON40657713.7
YOL133W (HRT1)3.28ON12126673.7
Smik_15.203.28ON12126673.9
CAGL0I09988g8.808ON38786713.9
Suva_15.263.28ON12226674.0
SAKL0A01474g6.332ON46824714.1
Suva_15.1158.808ON41157714.5
Skud_15.1028.808ON40657704.7
Kpol_339.65.339ON30939704.8
Kpol_1028.466.332ON44824704.9
KLTH0A06556g6.332ON46024705.5
KLTH0F11044g3.405ON29129695.6
Smik_16.3333.405ON29027695.7
Smik_15.163.22ON132625706.6
KLLA0C08756g6.332ON42724696.8
CAGL0L06336g8.247ON60052696.9
ZYRO0G13376g8.808ON44558697.2
Skud_16.3793.405ON28827687.6
KLLA0E20967g3.22ON132152697.7
KAFR0B046002.157ON40878688.2
AGL191W8.317ON58228689.0
TBLA0F032803.405ON55526689.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E01958g
         (524 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E01958g Chr5 (149087..150661) [1575 bp, 524 aa] {ON} simila...   966   0.0  
KLTH0C10604g Chr3 complement(878953..880500) [1548 bp, 515 aa] {...   451   e-154
TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {O...   423   e-143
Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013...   419   e-141
ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {...   399   e-133
Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {...   331   e-106
YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON} ...   328   e-106
Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {...   328   e-105
Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {...   320   e-102
TPHA0F02480 Chr6 (546818..548635) [1818 bp, 605 aa] {ON} Anc_6.4...   317   e-101
TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.4...   311   e-100
KAFR0A05240 Chr1 (1036153..1037814) [1662 bp, 553 aa] {ON} Anc_6...   309   3e-98
Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON} (1244...   297   5e-93
NCAS0D02010 Chr4 complement(371205..372737) [1533 bp, 510 aa] {O...   289   5e-91
CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {...   265   2e-81
NDAI0C02770 Chr3 (640635..642527) [1893 bp, 630 aa] {ON} Anc_6.4...   266   7e-81
KNAG0E02740 Chr5 complement(544981..546651) [1671 bp, 556 aa] {O...   249   2e-75
ACL019C Chr3 complement(328044..329771) [1728 bp, 575 aa] {ON} S...   246   9e-74
KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {...   239   2e-71
Ecym_3048 Chr3 (91031..93043) [2013 bp, 670 aa] {ON} similar to ...   197   9e-55
AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic hom...    49   2e-06
SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {...    51   5e-06
KAFR0B03070 Chr2 complement(638210..640141) [1932 bp, 643 aa] {O...    49   2e-05
AFR275W Chr6 (928482..930743) [2262 bp, 753 aa] {ON} Non-synteni...    49   2e-05
TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa] ...    49   2e-05
KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {...    49   3e-05
Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar t...    49   4e-05
KLTH0G12408g Chr7 (1055265..1057076) [1812 bp, 603 aa] {ON} weak...    48   5e-05
Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON...    48   5e-05
YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}  TUL1Golgi...    48   6e-05
Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034...    48   6e-05
KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.5...    48   6e-05
KLLA0E04071g Chr5 (369201..371315) [2115 bp, 704 aa] {ON} some s...    48   6e-05
Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034...    47   7e-05
Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON...    47   7e-05
TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.5...    47   8e-05
Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {O...    47   8e-05
TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {O...    47   1e-04
NDAI0H00840 Chr8 complement(189570..190595) [1026 bp, 341 aa] {O...    46   1e-04
NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317     47   1e-04
NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [...    45   1e-04
Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 b...    47   1e-04
CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} simil...    47   2e-04
NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.5...    46   2e-04
TBLA0A09640 Chr1 complement(2375252..2376180,2376263..2376311) [...    45   2e-04
Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa] ...    46   3e-04
KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} simi...    46   3e-04
Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034...    45   3e-04
CAGL0E01441g Chr5 (135312..137465) [2154 bp, 717 aa] {ON} some s...    45   3e-04
KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa] ...    45   4e-04
TDEL0A04940 Chr1 (872976..873072,873142..874025) [981 bp, 326 aa...    44   5e-04
ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {...    45   6e-04
KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459...    42   6e-04
NCAS0A11350 Chr1 complement(2249991..2251277) [1287 bp, 428 aa] ...    44   7e-04
Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {O...    41   7e-04
Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON} (19006.....    44   7e-04
KLLA0E16677g Chr5 complement(1481372..1482289) [918 bp, 305 aa] ...    43   0.001
Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 b...    42   0.001
Suva_2.433 Chr2 (765490..766503) [1014 bp, 337 aa] {ON} YDR265W ...    43   0.001
AER390W Chr5 (1370316..1370364,1370423..1371324) [951 bp, 316 aa...    43   0.001
KNAG0G02390 Chr7 complement(548272..550338) [2067 bp, 688 aa] {O...    44   0.001
SAKL0G07370g Chr7 (604332..604383,604452..605365) [966 bp, 321 a...    43   0.001
TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.27...    41   0.001
Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON...    43   0.001
SAKL0A09526g Chr1 (834338..836326) [1989 bp, 662 aa] {ON} conser...    43   0.002
Kpol_526.34 s526 (83624..84610) [987 bp, 328 aa] {ON} (83624..84...    43   0.002
NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON}      42   0.002
YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}  ...    43   0.002
Skud_4.528 Chr4 (941613..942626) [1014 bp, 337 aa] {ON} YDR265W ...    42   0.002
Ecym_1328 Chr1 complement(681157..682070,682146..682194) [963 bp...    42   0.002
SAKL0D08272g Chr4 complement(687452..691927) [4476 bp, 1491 aa] ...    43   0.002
Kwal_26.8030 s26 (616729..618711) [1983 bp, 660 aa] {ON} [contig...    43   0.002
CAGL0M08690g Chr13 complement(865182..866168) [987 bp, 328 aa] {...    42   0.002
YDR265W Chr4 (998864..999877) [1014 bp, 337 aa] {ON}  PEX10Perox...    42   0.003
KLTH0D06886g Chr4 (600181..602175) [1995 bp, 664 aa] {ON} conser...    42   0.003
NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2....    42   0.003
Kwal_56.23900 s56 complement(764530..766299) [1770 bp, 589 aa] {...    42   0.004
ZYRO0C11176g Chr3 (866350..866539,866607..867523) [1107 bp, 368 ...    42   0.004
Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON} (60008.....    39   0.004
SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]...    42   0.005
Smik_4.516 Chr4 (931711..932724) [1014 bp, 337 aa] {ON} YDR265W ...    41   0.005
KLLA0F12166g Chr6 complement(1116715..1121301) [4587 bp, 1528 aa...    42   0.005
TBLA0A03900 Chr1 complement(974843..976939) [2097 bp, 698 aa] {O...    42   0.005
CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa] ...    41   0.005
Kwal_55.19999 s55 (206149..206607) [459 bp, 152 aa] {ON} YDR265W...    39   0.006
TPHA0C00850 Chr3 (177213..179558) [2346 bp, 781 aa] {ON} Anc_8.3...    41   0.006
NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317     41   0.006
YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, ...    40   0.007
Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 b...    39   0.007
SAKL0C01760g Chr3 complement(149641..154065) [4425 bp, 1474 aa] ...    41   0.007
SAKL0C03586g Chr3 (337347..341771) [4425 bp, 1474 aa] {ON} weakl...    41   0.007
Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}...    39   0.009
TDEL0A03090 Chr1 (550834..552594) [1761 bp, 586 aa] {ON}               40   0.013
CAGL0K08052g Chr11 complement(800991..801908) [918 bp, 305 aa] {...    40   0.013
CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some ...    40   0.013
Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON} ...    40   0.014
Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar ...    38   0.015
ZYRO0D05830g Chr4 (495428..497770) [2343 bp, 780 aa] {ON} some s...    40   0.015
CAGL0I04576g Chr9 (408872..409321) [450 bp, 149 aa] {ON} similar...    38   0.018
KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa] ...    38   0.019
KLTH0E02464g Chr5 (216256..216301,216358..217301) [990 bp, 329 a...    39   0.023
TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {O...    39   0.030
KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa] ...    39   0.030
KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.5...    39   0.032
SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, ...    39   0.033
KNAG0I01380 Chr9 (265230..269711) [4482 bp, 1493 aa] {ON} Anc_1....    39   0.033
TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.27...    37   0.034
KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {O...    37   0.035
Ecym_7253 Chr7 complement(534000..535853) [1854 bp, 617 aa] {ON}...    38   0.051
Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON} (207...    39   0.055
NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3....    36   0.056
NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542     38   0.056
KLTH0G18150g Chr7 complement(1564780..1569444) [4665 bp, 1554 aa...    38   0.059
NCAS0A08780 Chr1 (1735117..1739625) [4509 bp, 1502 aa] {ON} Anc_...    38   0.059
Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON} Y...    38   0.060
SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468...    36   0.064
ZYRO0B02046g Chr2 (164680..166017) [1338 bp, 445 aa] {ON} conser...    38   0.068
ZYRO0E05192g Chr5 (393899..398461) [4563 bp, 1520 aa] {ON} simil...    38   0.070
ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic hom...    37   0.072
TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 ...    37   0.075
Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON} Y...    38   0.077
NCAS0C05290 Chr3 (1076165..1077157) [993 bp, 330 aa] {ON} Anc_5....    37   0.082
YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}  ET...    37   0.083
Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON} Y...    37   0.084
TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.5...    37   0.091
KNAG0A07430 Chr1 complement(1165740..1166048) [309 bp, 102 aa] {...    35   0.096
KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, ...    36   0.096
SAKL0G09284g Chr7 (795241..796131) [891 bp, 296 aa] {ON} similar...    37   0.10 
KAFR0H00560 Chr8 complement(99045..100028) [984 bp, 327 aa] {ON}...    37   0.11 
Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {O...    35   0.12 
TDEL0H03370 Chr8 complement(560397..560858) [462 bp, 153 aa] {ON...    35   0.13 
TDEL0D00860 Chr4 (158917..160293) [1377 bp, 458 aa] {ON} Anc_4.3...    37   0.13 
TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_...    37   0.13 
CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483) ...    35   0.16 
ZYRO0C17424g Chr3 complement(1357940..1358761) [822 bp, 273 aa] ...    36   0.17 
TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.5...    37   0.17 
TPHA0I00560 Chr9 (112560..113744) [1185 bp, 394 aa] {ON} Anc_8.8...    36   0.17 
TPHA0C00350 Chr3 complement(58374..59210) [837 bp, 278 aa] {ON} ...    36   0.19 
ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} simila...    36   0.19 
NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_...    37   0.21 
TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON}      36   0.21 
AAL030C Chr1 complement(284758..289377) [4620 bp, 1539 aa] {ON} ...    37   0.22 
KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28 Y...    34   0.23 
Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON...    36   0.26 
TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.5...    36   0.27 
ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519...    35   0.29 
TPHA0A03340 Chr1 (734754..735908) [1155 bp, 384 aa] {ON} Anc_3.4...    35   0.31 
Kwal_14.1287 s14 (263082..267638) [4557 bp, 1518 aa] {ON} YLR247...    36   0.31 
NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON} Anc_2...    35   0.34 
SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} simila...    35   0.34 
KNAG0I02090 Chr9 complement(407893..409176) [1284 bp, 427 aa] {O...    35   0.35 
KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON} simil...    35   0.39 
TBLA0B02670 Chr2 (615206..616642) [1437 bp, 478 aa] {ON} Anc_8.8...    35   0.39 
Kpol_480.22 s480 (52842..54119) [1278 bp, 425 aa] {ON} (52842..5...    35   0.41 
KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} simila...    35   0.47 
KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {...    35   0.50 
KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]...    35   0.51 
Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {O...    35   0.53 
YPR093C Chr16 complement(719558..720424) [867 bp, 288 aa] {ON}  ...    35   0.55 
CAGL0H07315g Chr8 (715930..716766) [837 bp, 278 aa] {ON} similar...    34   0.61 
TBLA0C01330 Chr3 (291659..296017) [4359 bp, 1452 aa] {ON} Anc_1....    35   0.62 
KLLA0E18503g Chr5 complement(1645113..1647065) [1953 bp, 650 aa]...    35   0.65 
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    35   0.66 
Suva_10.344 Chr10 complement(595952..600634) [4683 bp, 1560 aa] ...    35   0.73 
AER016C Chr5 complement(659572..660015) [444 bp, 147 aa] {ON} Sy...    33   0.79 
KLTH0F07062g Chr6 (616169..617032) [864 bp, 287 aa] {ON} similar...    34   0.92 
YLR247C Chr12 complement(628684..633354) [4671 bp, 1556 aa] {ON}...    34   1.0  
TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {...    34   1.1  
CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highl...    34   1.1  
KNAG0J01560 Chr10 (287736..288665) [930 bp, 309 aa] {ON} Anc_5.6...    33   1.1  
Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {O...    34   1.2  
TBLA0B08710 Chr2 complement(2075746..2076114) [369 bp, 122 aa] {...    32   1.3  
NDAI0D02810 Chr4 complement(650919..651677) [759 bp, 252 aa] {ON}      33   1.3  
KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON} conse...    33   1.5  
KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar...    32   1.5  
Smik_14.15 Chr14 complement(26568..27572) [1005 bp, 334 aa] {ON}...    33   1.6  
SAKL0B08976g Chr2 complement(766719..767687) [969 bp, 322 aa] {O...    33   1.7  
Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa] ...    31   1.8  
Kwal_56.23543 s56 complement(591514..594411) [2898 bp, 965 aa] {...    33   1.8  
KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa] ...    32   1.8  
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    33   1.8  
SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa] ...    32   2.0  
KAFR0C01780 Chr3 complement(363161..363517) [357 bp, 118 aa] {ON...    31   2.0  
Kpol_1014.16 s1014 complement(29615..29938) [324 bp, 107 aa] {ON...    31   2.0  
CAGL0E01567g Chr5 (148425..148733) [309 bp, 102 aa] {ON} similar...    31   2.0  
KAFR0F02840 Chr6 complement(564020..565357) [1338 bp, 445 aa] {O...    33   2.1  
KLTH0F19228g Chr6 complement(1556655..1556987) [333 bp, 110 aa] ...    31   2.2  
Skud_12.328 Chr12 complement(575254..579927) [4674 bp, 1557 aa] ...    33   2.3  
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    33   2.4  
SAKL0A06072g Chr1 (551181..552518) [1338 bp, 445 aa] {ON} simila...    33   2.4  
KAFR0D04640 Chr4 complement(911653..912561) [909 bp, 302 aa] {ON...    32   2.5  
NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {...    33   2.5  
NDAI0I00400 Chr9 complement(80973..82418) [1446 bp, 481 aa] {ON}...    33   2.5  
Smik_12.320 Chr12 complement(573526..578187) [4662 bp, 1553 aa] ...    33   2.5  
Smik_4.58 Chr4 (112121..112375) [255 bp, 85 aa] {ON} YDL181W (REAL)    30   2.5  
YDL181W Chr4 (135179..135436) [258 bp, 85 aa] {ON}  INH1Protein ...    30   2.5  
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    33   2.5  
KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3....    33   2.6  
Skud_15.20 Chr15 (35550..35915) [366 bp, 121 aa] {ON} YOL133W (R...    31   2.6  
TPHA0P01470 Chr16 complement(301305..301640) [336 bp, 111 aa] {O...    31   2.7  
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    33   2.7  
KAFR0H00710 Chr8 (132097..132783) [687 bp, 228 aa] {ON} Anc_3.40...    32   2.7  
TDEL0A00410 Chr1 complement(70940..74728) [3789 bp, 1262 aa] {ON...    33   2.8  
NCAS0B00990 Chr2 complement(154925..156103) [1179 bp, 392 aa] {O...    32   2.9  
ZYRO0C03058g Chr3 complement(236925..237275) [351 bp, 116 aa] {O...    31   3.0  
NCAS0C04480 Chr3 (919123..919452) [330 bp, 109 aa] {ON} Anc_3.28       30   3.1  
TDEL0A00470 Chr1 (82852..83208) [357 bp, 118 aa] {ON} Anc_3.28 Y...    31   3.2  
NDAI0G03860 Chr7 (925672..926043) [372 bp, 123 aa] {ON} Anc_3.28...    31   3.2  
NDAI0E00440 Chr5 (80965..82215) [1251 bp, 416 aa] {ON} Anc_8.808...    32   3.3  
YOL054W Chr15 (228614..229834) [1221 bp, 406 aa] {ON}  PSH1E3 ub...    32   3.6  
TDEL0E02870 Chr5 (548115..548981) [867 bp, 288 aa] {ON} Anc_5.33...    32   3.6  
Kpol_538.5 s538 (7029..8036) [1008 bp, 335 aa] {ON} (7029..8036)...    32   3.7  
Smik_15.113 Chr15 (194228..195448) [1221 bp, 406 aa] {ON} YOL054...    32   3.7  
YOL133W Chr15 (70325..70690) [366 bp, 121 aa] {ON}  HRT1RING fin...    30   3.7  
Smik_15.20 Chr15 (38383..38748) [366 bp, 121 aa] {ON} YOL133W (R...    30   3.9  
CAGL0I09988g Chr9 complement(951638..952801) [1164 bp, 387 aa] {...    32   3.9  
Suva_15.26 Chr15 (48168..48536) [369 bp, 122 aa] {ON} YOL133W (R...    30   4.0  
SAKL0A01474g Chr1 complement(140890..142296) [1407 bp, 468 aa] {...    32   4.1  
Suva_15.115 Chr15 (200851..202086) [1236 bp, 411 aa] {ON} YOL054...    32   4.5  
Skud_15.102 Chr15 (187319..188539) [1221 bp, 406 aa] {ON} YOL054...    32   4.7  
Kpol_339.6 s339 complement(10896..11825) [930 bp, 309 aa] {ON} c...    32   4.8  
Kpol_1028.46 s1028 complement(110464..110775,110777..111811) [13...    32   4.9  
KLTH0A06556g Chr1 (545636..547018) [1383 bp, 460 aa] {ON} simila...    32   5.5  
KLTH0F11044g Chr6 (937668..938543) [876 bp, 291 aa] {ON} weakly ...    31   5.6  
Smik_16.333 Chr16 complement(596750..597622) [873 bp, 290 aa] {O...    31   5.7  
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    32   6.6  
KLLA0C08756g Chr3 complement(765847..767130) [1284 bp, 427 aa] {...    31   6.8  
CAGL0L06336g Chr12 (715056..716858) [1803 bp, 600 aa] {ON} some ...    31   6.9  
ZYRO0G13376g Chr7 complement(1066321..1067658) [1338 bp, 445 aa]...    31   7.2  
Skud_16.379 Chr16 complement(683736..684602) [867 bp, 288 aa] {O...    31   7.6  
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    31   7.7  
KAFR0B04600 Chr2 complement(956458..957684) [1227 bp, 408 aa] {O...    31   8.2  
AGL191W Chr7 (339295..341043) [1749 bp, 582 aa] {ON} Syntenic ho...    31   9.0  
TBLA0F03280 Chr6 complement(805882..807549) [1668 bp, 555 aa] {O...    31   9.6  

>SAKL0E01958g Chr5 (149087..150661) [1575 bp, 524 aa] {ON} similar
           to uniprot|Q08109 Saccharomyces cerevisiae YOL013C HRD1
           Ubiquitin-protein ligase required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins genetically linked to the unfolded protein
           response (UPR) regulated through association with Hrd3p
           contains an H2 ring finger
          Length = 524

 Score =  966 bits (2497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/524 (91%), Positives = 477/524 (91%)

Query: 1   MPVSQNRRGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNG 60
           MPVSQNRRGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNG
Sbjct: 1   MPVSQNRRGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNG 60

Query: 61  VLLWKXXXXXXXXXXXXIEYEHVFERLSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIFLK 120
           VLLWK            IEYEHVFERLSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIFLK
Sbjct: 61  VLLWKLLTRLLFGELRLIEYEHVFERLSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIFLK 120

Query: 121 VFHWILKDRLEFVFQNANENTNLKKMXXXXXXXXXXXXASVDYQMVRYCLSNSISNDQWT 180
           VFHWILKDRLEFVFQNANENTNLKKM            ASVDYQMVRYCLSNSISNDQWT
Sbjct: 121 VFHWILKDRLEFVFQNANENTNLKKMLFSRFNFNLLFLASVDYQMVRYCLSNSISNDQWT 180

Query: 181 SSSVYLMFGIDFAMLLVDTLSIGLHGVVNFVEVYRLQSHNSHYDEEFLGLEGKFMYEKLI 240
           SSSVYLMFGIDFAMLLVDTLSIGLHGVVNFVEVYRLQSHNSHYDEEFLGLEGKFMYEKLI
Sbjct: 181 SSSVYLMFGIDFAMLLVDTLSIGLHGVVNFVEVYRLQSHNSHYDEEFLGLEGKFMYEKLI 240

Query: 241 DMGARXXXXXXXXXXXIPFRMPXXXXXXXXXXXXSLYQTATSLWKTWKNAKKLDEKLPDV 300
           DMGAR           IPFRMP            SLYQTATSLWKTWKNAKKLDEKLPDV
Sbjct: 241 DMGARLLKMLLHIALLIPFRMPIMIIKDIIWDAISLYQTATSLWKTWKNAKKLDEKLPDV 300

Query: 301 TEEELNQGNNMCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICR 360
           TEEELNQGNNMCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICR
Sbjct: 301 TEEELNQGNNMCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICR 360

Query: 361 LPVFDERGNVTRMDSSSQEQQLPHNLQRQEAEGEVVQMTTSPFHTTSASVGPTSTTPTQA 420
           LPVFDERGNVTRMDSSSQEQQLPHNLQRQEAEGEVVQMTTSPFHTTSASVGPTSTTPTQA
Sbjct: 361 LPVFDERGNVTRMDSSSQEQQLPHNLQRQEAEGEVVQMTTSPFHTTSASVGPTSTTPTQA 420

Query: 421 NRSVIMPQVPRVPQDWYAFPIEATQTTKDKVVFKLVDSDNNEITANLLTKTRPQFQKVTE 480
           NRSVIMPQVPRVPQDWYAFPIEATQTTKDKVVFKLVDSDNNEITANLLTKTRPQFQKVTE
Sbjct: 421 NRSVIMPQVPRVPQDWYAFPIEATQTTKDKVVFKLVDSDNNEITANLLTKTRPQFQKVTE 480

Query: 481 VSGGQRITIPQSCIEQKEEIESLKRKISEMENKLDALTKRVRTE 524
           VSGGQRITIPQSCIEQKEEIESLKRKISEMENKLDALTKRVRTE
Sbjct: 481 VSGGQRITIPQSCIEQKEEIESLKRKISEMENKLDALTKRVRTE 524

>KLTH0C10604g Chr3 complement(878953..880500) [1548 bp, 515 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013C HRD1 Ubiquitin-protein ligase required for
           endoplasmic reticulum-associated degradation (ERAD) of
           misfolded proteins genetically linked to the unfolded
           protein response (UPR) regulated through association
           with Hrd3p contains an H2 ring finger
          Length = 515

 Score =  451 bits (1161), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 233/525 (44%), Positives = 322/525 (61%), Gaps = 22/525 (4%)

Query: 7   RRGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNGVLLWKX 66
           +R QF+ Y+VFTY+AA WSV D L  S++FL   +KLCEG+NL++L NF ++N +LLWK 
Sbjct: 6   QRRQFVGYTVFTYTAAAWSVLDCLQPSLSFLDACLKLCEGLNLVVLCNFAIVNSILLWKG 65

Query: 67  XXXXXXXXXXXIEYEHVFERLSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIFLKVFHWIL 126
                      +EYEH+FERLSFTIVN  F+SS F E  FLTV++  A+L F++VFHW+L
Sbjct: 66  LTRLLFGELRLLEYEHIFERLSFTIVNCFFMSSAFPEYQFLTVMILFALLTFIRVFHWVL 125

Query: 127 KDRLEFVFQNANENTNLKKMXXXXXXXXXXXXASVDYQMVRYCLSNSISN--DQWTSSSV 184
           KDRLE+VFQ+ +E TN+ ++            A VDYQMVR+CL NS++N  D   S+ V
Sbjct: 126 KDRLEYVFQHTDERTNIARLLCSRFFLNVIIFAVVDYQMVRFCLRNSLTNKHDPSPSAPV 185

Query: 185 YLMFGIDFAMLLVDTLSIGLHGVVNFVEVYRLQSHNSHYDEEFLGLEGKFMYEKLIDMGA 244
           Y++F +DF+MLLVD   + +  V+N +E+ + +       ++F+GL+GKFMYEKL+ +  
Sbjct: 186 YILFCVDFSMLLVDVAEVAMKSVINLIELIQCKRAFERDGDDFVGLDGKFMYEKLVQLVC 245

Query: 245 RXXXXXXXXXXXIPFRMPXXXXXXXXXXXXSLYQTATSLWKTWKNAKKLDEKLPDVTEEE 304
           +            PF MP            +L+ T  S+W+TWK+ +++DEKLPDVTE +
Sbjct: 246 QVLKLGLRVASLAPFSMPLMIAKDIIWDGIALFHTGKSVWRTWKSNRQIDEKLPDVTEAQ 305

Query: 305 LNQG-NNMCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICRLPV 363
           LN   + MCIVCM+DMLP SE  +A  KPKKLPC H LHL CLKSWMERSQTCPICR+ V
Sbjct: 306 LNASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSV 365

Query: 364 FDERGNVTRMDSSSQEQQLPHN--LQRQEAEGEVVQMTTSPFHTTSASVGPTSTTPTQAN 421
           FD +GNV   + ++ +Q +  +  + +Q         +TS   T + S+G  S++     
Sbjct: 366 FDSKGNVALPNQNAAQQPISEDASVAQQPLSAANESNSTSLASTHTGSLGAVSSSN---- 421

Query: 422 RSVIMPQVPRVPQDWYAFPIEATQTTKDKVV-FKLVDSDNNEITANLLTKTRPQFQKVTE 480
                P  P     WY FP+  T +  D  V FK+ D +  EI A L+ K RP F    E
Sbjct: 422 -----PNFP----TWYTFPV--TLSDNDGAVDFKVRDINGVEINAKLIIKKRPGFDVPKE 470

Query: 481 VSG-GQRITIPQSCIEQKEEIESLKRKISEMENKLDALTKRVRTE 524
                QR+ I      Q ++IE LKR+ISE+ENK+D LTK+ RTE
Sbjct: 471 QDQESQRVVINDPPATQYQDIERLKRRISELENKVDELTKKARTE 515

>TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {ON}
           Anc_6.45 YOL013C
          Length = 517

 Score =  423 bits (1088), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 216/536 (40%), Positives = 320/536 (59%), Gaps = 31/536 (5%)

Query: 1   MPVSQNRRGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNG 60
           M +S+ R+ QFIV+S+F Y+  I+SVY++  +S++FLQT ++L EG N++I+  F  LN 
Sbjct: 1   MAISETRKRQFIVFSIFVYALTIYSVYNATRTSISFLQTVLRLTEGFNIVIITVFFTLNS 60

Query: 61  VLLWKXXXXXXXXXXXXIEYEHVFERLSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIFLK 120
           VLLWK            IEYEH+FERL FTI+N++ +SSMF E DFLTV ++  +L+F+K
Sbjct: 61  VLLWKLSTSLLFGSLRLIEYEHIFERLPFTIINTMLMSSMFSEHDFLTVAIYGLLLLFMK 120

Query: 121 VFHWILKDRLEFVFQNANENTNLKKMXXXXXXXXXXXXASVDYQMVRYCLSNSISNDQWT 180
           VFHWIL+DRLE + Q   E+T L  +            A  DYQ++ +C+SNS+ N    
Sbjct: 121 VFHWILRDRLEALLQTIQESTTLSDLIFTRFTFNLVLLAIADYQIISHCVSNSLDNSFGA 180

Query: 181 SSSVYLMFGIDFAMLLVDTLSIGLHGVVNFVEVYRLQSH-------NSHYDEEFLGLEGK 233
           S+SV+LM G++FA+LL+D L+  LH  + F E Y+ Q+H       +   D +F GLEGK
Sbjct: 181 SASVHLMMGMEFALLLIDLLNTTLHAALCFYEFYQSQTHGRRNAVNDDEDDTQFSGLEGK 240

Query: 234 FMYEKLIDMGARXXXXXXXXXXXIPFRMPXXXXXXXXXXXXSLYQTATSLWKTWKNAKKL 293
           F+YE++ID+  R           +PFRMP            +L+Q A  LWK W+N K+L
Sbjct: 241 FIYERVIDISTRFLKTVLHALLLVPFRMPIMLIKDVLWDCLTLHQNAKGLWKIWRNNKQL 300

Query: 294 DEKLPDVTEEELNQGNNMCIVCMDDMLPNSE---TRNANLKPKKLPCGHILHLSCLKSWM 350
           D+KLP ++E++L   +NMCI+CMD+++P  +   TRN   KPK+LPCGH+LHL CLK+WM
Sbjct: 301 DDKLPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWM 360

Query: 351 ERSQTCPICRLPVFDERGNVTRMDSSSQEQQLPHNLQRQEAEGEVVQMTTSPFHTTSASV 410
           ERSQTCPICRL VFDE GNV +    +  +  P +         VV+ +          +
Sbjct: 361 ERSQTCPICRLAVFDEMGNVVQSTVPTTAEVTPTD--EINVPETVVERSQEQIQDNQQQM 418

Query: 411 GPTSTTPTQANRSVIMPQVPRVPQDWYAFPIEATQTTKDKVVFKLVDSDNNE-ITANLLT 469
           G                    V   WY+FP+E  +T+++ V F + +S  NE + A+LL 
Sbjct: 419 GEGQVA---------------VLDSWYSFPVE--ETSENLVTFSMKNSATNETVPASLLI 461

Query: 470 -KTRPQFQKVTEVSGGQRITIPQSCIEQKEEIESLKRKISEMENKLDALTKRVRTE 524
            +T    +   +    + I IP   ++Q + IE+LKR++SE+E++++ L KRVR +
Sbjct: 462 ERTNASERYDDDDDQVETIIIPDEVVDQAQTIENLKRRVSELESQVEHLNKRVRKD 517

>Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013C
           (HRD1) - required to degrade misfolded ER lumenal and
           integral membrane proteins [contig 185] FULL
          Length = 513

 Score =  419 bits (1077), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 222/531 (41%), Positives = 320/531 (60%), Gaps = 25/531 (4%)

Query: 1   MPVSQNRRGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNG 60
           M V   RR QF  Y   +Y+AA W++  ++  S++FL+ + +LCEG+NLI+L NF  +NG
Sbjct: 1   MAVRVQRR-QFAAYVFASYAAAAWAIIGTVQESLSFLELSARLCEGLNLILLCNFAAVNG 59

Query: 61  VLLWKXXXXXXXXXXXXIEYEHVFERLSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIFLK 120
           VLLWK            +EYEH+FERLSFTIVN  F+SS F E +F++V+ F+A LIF+K
Sbjct: 60  VLLWKALTHLLFGELRLLEYEHIFERLSFTIVNCFFMSSAFSESEFMSVMAFSAALIFVK 119

Query: 121 VFHWILKDRLEFVFQNANENTNLKKMXXXXXXXXXXXXASVDYQMVRYCLSNS--ISNDQ 178
           VFHW+L+DRLE VFQ+ +E+TN  ++              +D+QM ++C+  +   S   
Sbjct: 120 VFHWVLRDRLEHVFQHTDEHTNFARLLLSRFFFNIFLLGFLDFQMTKFCIQGTRFFSRSG 179

Query: 179 WTSS--SVYLMFGIDFAMLLVDTLSIGLHGVVNFVEVYRLQSHNSHYDEEFLGLEGKFMY 236
           + SS  SV+LMF ++FAMLLVD   + +  ++N VEVY+ +   +   E++ GLEGKFMY
Sbjct: 180 FYSSSLSVHLMFAVEFAMLLVDVTEVAMKSIINLVEVYQCKRSFARDGEDYTGLEGKFMY 239

Query: 237 EKLIDMGARXXXXXXXXXXXIPFRMPXXXXXXXXXXXXSLYQTATSLWKTWKNAKKLDEK 296
           EK++ +  +           +PF MP            +++ TA SL  TWK+ +++DEK
Sbjct: 240 EKVVQLICQLTRMGLHIMLMMPFSMPLMIAKDILWDAFAVFHTAKSLLLTWKSNRQIDEK 299

Query: 297 LPDVTEEELNQGNN-MCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQT 355
           LPDV+E +L   ++ MCIVCMDDML  SE  NA  KPK+LPC H LHL CLKSWMERSQT
Sbjct: 300 LPDVSEAQLAASDDKMCIVCMDDMLAPSECTNAKQKPKRLPCNHCLHLGCLKSWMERSQT 359

Query: 356 CPICRLPVFDERGNVTRMDSSSQEQQLPHNLQRQEAEGEVVQMTTSPFHTTSASVGPTST 415
           CPICR+PVFD++GNV    +S Q    P               T+S   +T+      +T
Sbjct: 360 CPICRVPVFDKKGNVVV--TSDQTNNQPG--------------TSSAVESTADETSTAAT 403

Query: 416 TPTQANRSVI-MPQVPRVPQDWYAFPIEATQTTKDKVVFKLVDSDNNEITANLLTKTRPQ 474
           T   +  S I +  VP   + WYAFP       +  +  K+ D+   EI A L+ K R +
Sbjct: 404 TSVSSQSSSIAVTDVPSHQRGWYAFPTVQVH-DEGSIDIKVTDTSGAEIKATLVCKDRHE 462

Query: 475 FQKV-TEVSGGQRITIPQSCIEQKEEIESLKRKISEMENKLDALTKRVRTE 524
           F+ + T+  G +++ +   C+ Q ++IE LKR+ISE+ENK+D L+K+ RTE
Sbjct: 463 FEAIETDAQGPRKVVVKNDCVYQNQDIERLKRRISELENKVDELSKKARTE 513

>ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013C HRD1 Ubiquitin-protein ligase required for
           endoplasmic reticulum-associated degradation (ERAD) of
           misfolded proteins genetically linked to the unfolded
           protein response (UPR) regulated through association
           with Hrd3p contains an H2 ring finger
          Length = 558

 Score =  399 bits (1026), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 224/576 (38%), Positives = 315/576 (54%), Gaps = 74/576 (12%)

Query: 1   MPVSQNRRGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNG 60
           M  S  RR Q   +++  Y+  I++VY+S  +SV+FLQ TIKL  G N++IL  F +LN 
Sbjct: 1   MATSDTRRRQVACFALSVYALTIYAVYNSARTSVSFLQATIKLTTGFNVVILTVFTILNS 60

Query: 61  VLLWKXXXXXXXXXXXXIEYEHVFERLSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIFLK 120
            +LWK            +EYEH+FERL FTI+N++F+SSMF EQDF TV +F  +L+++K
Sbjct: 61  AVLWKLSTAILFGNLSLLEYEHIFERLPFTIINTVFMSSMFHEQDFFTVTLFGLLLLYMK 120

Query: 121 VFHWILKDRLEFVFQNANENTNLKKMXXXXXXXXXXXXASVDYQMVRYCLSNSISNDQWT 180
           VFHWILKDRLE + Q+ +E+T LK +            A +DY++V  C++NS+SN    
Sbjct: 121 VFHWILKDRLEALLQSIHESTTLKSLICTRFSFNLVLLAILDYKIVSGCITNSLSNSFGA 180

Query: 181 SSSVYLMFGIDFAMLLVDTLSIGLHGVVNFVEVYRLQ--SHNSHYDEE------------ 226
           S+SV+LM G++FAMLL+D L++ +H V+NF E YR Q  +H S  D +            
Sbjct: 181 STSVHLMVGMEFAMLLIDLLNLAMHTVLNFYEFYRTQVDAHLSSVDTDTDGGDEENEDED 240

Query: 227 -----FLGLEGKFMYEKLIDMGARXXXXXXXXXXXIPFRMPXXXXXXXXXXXXSLYQTAT 281
                F GLEGKFMYE++ID+  R           IPFRM             +L Q  +
Sbjct: 241 VNGSSFAGLEGKFMYERVIDVFTRFLKTLIHAIMLIPFRMSILLIKDVFWDVLTLCQIVS 300

Query: 282 SLWKTWKNAKKLDEKLPDVTEEELNQGNNMCIVCMDDMLPNSE-----------TRNANL 330
           SLW+ W+N K+LD+KL  ++  EL+  +N+CIVCMD++  + E            +    
Sbjct: 301 SLWRIWQNNKQLDDKLKTMSPVELSATDNICIVCMDELCADLEEVVQGPDREKVAKTGKY 360

Query: 331 KPKKLPCGHILHLSCLKSWMERSQTCPICRLPVFDERGNVTRMDSSSQEQQLPHNLQ--- 387
           KPK+LPCGH+LHL CLK+WMERSQTCPICRLPVFDE GNV +  SS+  +      Q   
Sbjct: 361 KPKRLPCGHVLHLFCLKNWMERSQTCPICRLPVFDENGNVVQSQSSTTNRTTQATNQSTN 420

Query: 388 ---------------------RQEAEGEVVQMTTSPFHTTSASVGPTSTTPTQANRSVIM 426
                                  ++ G     T S   +T  ++G  + TPT A+ +   
Sbjct: 421 VTTTAATTTTTTTTTTTTSTTEMDSSGGSTASTPSSRQSTQQTLGDLTPTPTTADSN--- 477

Query: 427 PQVPRVPQDWYAFPIEATQTTKDKVV-FKLVDS-DNNEITANLLTKTRPQFQKVTEVSGG 484
                +   WY++PI   Q  KD VV F L DS   N + A L      +          
Sbjct: 478 ---SNIANLWYSYPI---QEAKDGVVTFSLRDSVSGNPVRAKLTLNNDNE---------T 522

Query: 485 QRITIPQSCIEQKEEIESLKRKISEMENKLDALTKR 520
           QRITIP  CI   E I+ LKR+ISE+E ++  +++ 
Sbjct: 523 QRITIPNECIHHLESIQGLKRRISELEAQVREMSEH 558

>Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {ON}
           YOL013C (REAL)
          Length = 548

 Score =  331 bits (848), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 215/549 (39%), Positives = 295/549 (53%), Gaps = 58/549 (10%)

Query: 3   VSQNRRGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNGVL 62
           V +NRR Q IV+ V TY    + VY +  +SV+FLQ T+KL EG NL++L  F LLN  L
Sbjct: 2   VPENRRKQLIVFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNSTL 61

Query: 63  LWKXXXXXXXXXXXXIEYEHVFERLSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIFLKVF 122
           LW+            IE+EH+FERL FTI+N++F+SSMF E+ F TV  F  +L++LKVF
Sbjct: 62  LWQLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKVF 121

Query: 123 HWILKDRLEFVFQNANENTNLKKMXXXXXXXXXXXXASVDYQMVRYCLSNSISNDQW--T 180
           HWILKDRLE + Q+ N++T +K +            A VD+Q++  C+S+  +N      
Sbjct: 122 HWILKDRLEALLQSINDSTTMKNLILSRFSFNLVLLAVVDFQILIRCISSIYTNQNIDII 181

Query: 181 SSSVYLMFGIDFAMLLVDTLSIGLHGVVNFVEVYRLQ-------SHNSHYD--------- 224
           S+S+YLM  ++F MLL+D L++ L   +NF E YR Q       +H  H D         
Sbjct: 182 STSLYLMQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSQSNESNHIVHDDTPNGVGFEE 241

Query: 225 ------------EEFLGLEGKFMYEKLIDMGARXXXXXXXXXXXIPFRMPXXXXXXXXXX 272
                        +F GLEGKFMYEK ID+  R           IPFRMP          
Sbjct: 242 AHAVLNDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPLMLLKDVVWD 301

Query: 273 XXSLYQTATSLWKTWKNAKKLDEKLPDVTEEEL-NQGN--NMCIVCMDDML---PNSETR 326
             +LYQ+ TSLWK W+N K+LD+ L  VT E+L N  N  N+CI+CMD+++    +   +
Sbjct: 302 VLALYQSGTSLWKIWRNNKQLDDALITVTAEQLQNSANEDNICIICMDELMHSQADQTWK 361

Query: 327 NANLKPKKLPCGHILHLSCLKSWMERSQTCPICRLPVFDERGNVTRMDSSSQEQQLPHNL 386
           N N KPK+LPCGHILHLSCLK+WMERSQTCPICRL VFDE+GNV +   +S       N 
Sbjct: 362 NKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLSVFDEKGNVVQSTFTSNTGTTSTNT 421

Query: 387 QRQEAEGEVV-------QMTTSPFHTTSASVG--PTSTTPTQANRSVIMPQVPRVPQDWY 437
               A    +       Q    P  TTS  VG  P     T A+RS        +   WY
Sbjct: 422 TVTGATSATINRQVFTNQTELLPTRTTSPDVGIIPNHNINTLASRSTSTSTSSTM---WY 478

Query: 438 AFPIEATQTTKDK---VVFKLVDSDNNEITANLLTKTRPQFQKVTEVSGGQ-------RI 487
            FP++ T    ++     ++ + +++NE    +  K   +  +V  + GG+       RI
Sbjct: 479 TFPLQQTDDDSNESKCSTYEFLMTNSNEKEDRIPVKLTVESHEVNSLQGGEEVQGTQKRI 538

Query: 488 TIPQSCIEQ 496
            IP   I+ 
Sbjct: 539 VIPDKFIQH 547

>YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON}
           HRD1Ubiquitin-protein ligase; required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins; genetically linked to the unfolded protein
           response (UPR); regulated through association with
           Hrd3p; contains an H2 ring finger; likely plays a
           general role in targeting proteins that persistently
           associate with and potentially obstruct the ER-localized
           translocon
          Length = 551

 Score =  328 bits (842), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 211/554 (38%), Positives = 296/554 (53%), Gaps = 65/554 (11%)

Query: 3   VSQNRRGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNGVL 62
           V +NRR Q  ++ V TY    + VY +  +SV+FLQ T+KL EG NL++L  F LLN  L
Sbjct: 2   VPENRRKQLAIFVVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNSTL 61

Query: 63  LWKXXXXXXXXXXXXIEYEHVFERLSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIFLKVF 122
           LW+            IE+EH+FERL FTI+N++F+SS+F E+ F TV  F  +L++LKVF
Sbjct: 62  LWQLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSLFHERYFFTVAFFGLLLLYLKVF 121

Query: 123 HWILKDRLEFVFQNANENTNLKKMXXXXXXXXXXXXASVDYQMVRYCLSNSISNDQ--WT 180
           HWILKDRLE + Q+ N++T +K +            A VDYQ++  C+S+  +N +    
Sbjct: 122 HWILKDRLEALLQSINDSTTMKTLIFSRFSFNLVLLAVVDYQIITRCISSIYTNQKSDIE 181

Query: 181 SSSVYLMFGIDFAMLLVDTLSIGLHGVVNFVEVYRLQ-------SHNSHYD--------- 224
           S+S+YL+  ++F MLL+D L++ L   +NF E YR Q       +H  H D         
Sbjct: 182 STSLYLIQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSLSNENNHIVHGDPTDENTVES 241

Query: 225 -----------------EEFLGLEGKFMYEKLIDMGARXXXXXXXXXXXIPFRMPXXXXX 267
                             +F GLEGKFMYEK ID+  R           IPFRMP     
Sbjct: 242 DQSQPVLNDDDDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLK 301

Query: 268 XXXXXXXSLYQTATSLWKTWKNAKKLDEKLPDVTEEEL-NQGN--NMCIVCMDDML--PN 322
                  +LYQ+ TSLWK W+N K+LD+ L  VT E+L N  N  N+CI+CMD+++  PN
Sbjct: 302 DVVWDILALYQSGTSLWKIWRNNKQLDDTLVTVTVEQLQNSANDDNICIICMDELIHSPN 361

Query: 323 SET-RNANLKPKKLPCGHILHLSCLKSWMERSQTCPICRLPVFDERGNVTRMDSSSQEQQ 381
            +T +N N KPK+LPCGHILHLSCLK+WMERSQTCPICRLPVFDE+GNV +   +S    
Sbjct: 362 QQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQTTFTSNSDI 421

Query: 382 LPHNLQRQ------EAEGEVVQMTTSPFHTTSASVG--PTSTTPTQA--NRSVIMPQVPR 431
                         + +G   ++   P  TTS  +   PT    T A   RS   P    
Sbjct: 422 TTQTTVTDSTGIATDQQGFANEVDLLPTRTTSPDIRIVPTQNIDTLAMRTRSTSTPS--- 478

Query: 432 VPQDWYAFPIEAT---QTTKDKVVFKLVDSDNNEITANLLTKTRPQFQKVTEVSG----- 483
               WY FP+  T        +  ++ + ++++E    +  K   +  +V  + G     
Sbjct: 479 --PTWYTFPLHKTGDNSVGSSRSAYEFLITNSDEKENGIPVKLTIENHEVNSLHGDGGEQ 536

Query: 484 -GQRITIPQSCIEQ 496
             ++I IP   I+ 
Sbjct: 537 IAKKIVIPDKFIQH 550

>Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score =  328 bits (841), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 212/555 (38%), Positives = 304/555 (54%), Gaps = 68/555 (12%)

Query: 3   VSQNRRGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNGVL 62
           V +NRR Q +V+ V TY    + VY +  +SV+FLQ T+KL EG NL++L  F LLN  L
Sbjct: 2   VPENRRKQLVVFIVITYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFVLLNSTL 61

Query: 63  LWKXXXXXXXXXXXXIEYEHVFERLSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIFLKVF 122
           LW             IE+EH+FERL FTI+N++F+SSMF E+ F TV  F  +L++LKVF
Sbjct: 62  LWHLLTRLLFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKVF 121

Query: 123 HWILKDRLEFVFQNANENTNLKKMXXXXXXXXXXXXASVDYQMVRYCLSNSISNDQ--WT 180
           HWILKDRLE + Q+ N++T +K +            A++DYQ++ +C+S+  +N +    
Sbjct: 122 HWILKDRLEALLQSINDSTTMKTLIFSRFSLNLVLLAALDYQIIVHCISSIYTNQKIDIV 181

Query: 181 SSSVYLMFGIDFAMLLVDTLSIGLHGVVNFVEVYRLQ-------SHNSHYD--------- 224
           S+S+YLM  ++F MLL+D L++ L   +NF E YR Q       +H  H D         
Sbjct: 182 STSLYLMQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSQSDDGNHIVHDDLSDGNRVDF 241

Query: 225 ----------------EEFLGLEGKFMYEKLIDMGARXXXXXXXXXXXIPFRMPXXXXXX 268
                            +F GLEGKFMYEK ID+  R           IPFRMP      
Sbjct: 242 DGSQHALNDDGDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKD 301

Query: 269 XXXXXXSLYQTATSLWKTWKNAKKLDEKLPDVTEEEL-NQGN--NMCIVCMDDML--PNS 323
                 +LYQ+AT LWK W+N K+LD+ L  VT E+L N  N  N+CI+CMD+++   N 
Sbjct: 302 VIWDILALYQSATGLWKIWRNNKQLDDSLLTVTVEQLQNSANEDNICIICMDELIHSTNQ 361

Query: 324 ET-RNANLKPKKLPCGHILHLSCLKSWMERSQTCPICRLPVFDERGNVTRMDSSSQEQ-- 380
           +T +N N KPK+LPCGHILHLSCLK+WMERSQTCPICRLPVFD++GNV +   +S+    
Sbjct: 362 QTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDDKGNVVQTTFTSETNSS 421

Query: 381 ---------QLPHNLQRQEAEGEVV-QMTTSPFHTTSASVGPTSTTPTQANRSVIMPQVP 430
                    +   N Q    E E++   TTSP       + P   T T A+R+       
Sbjct: 422 ITMAATDNTRTIVNSQDFANETELLPTRTTSP----DVRILPNQNTNTFASRATSTSTSS 477

Query: 431 RVPQDWYAFPIEATQ--TTKDKVVFKLVDSDNNEITANLLTKTRPQFQKVTEVSG---GQ 485
                W  FP++ T+    + +  ++ + + ++E  +++  K   +  ++  + G   GQ
Sbjct: 478 TT---WCKFPLQQTEDNDVESRSTYEFLMTSSDEKESSIPVKLTIESHEIDYLQGDGEGQ 534

Query: 486 ----RITIPQSCIEQ 496
               +I IP   I+ 
Sbjct: 535 TAQKKIVIPSKFIQH 549

>Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score =  320 bits (819), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 209/548 (38%), Positives = 293/548 (53%), Gaps = 54/548 (9%)

Query: 3   VSQNRRGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNGVL 62
           V +NRR Q + + V TY    + VY +  +SV+FLQ T+KL EG NL++L  F LLN  L
Sbjct: 2   VPENRRKQLVAFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNSTL 61

Query: 63  LWKXXXXXXXXXXXXIEYEHVFERLSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIFLKVF 122
           LW+            IE+EH+FERL FTI+N++F+SSMF E+ F TV  F  +L++LKVF
Sbjct: 62  LWQLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKVF 121

Query: 123 HWILKDRLEFVFQNANENTNLKKMXXXXXXXXXXXXASVDYQMVRYCLSNSISNDQW--T 180
           HWI+KDRLE + Q+ N++T LK +            A  DYQ++  C+S+  +N      
Sbjct: 122 HWIIKDRLEALLQSINDSTTLKTLIFSRFSFNLALLALTDYQIITRCISSIYTNKNIDVV 181

Query: 181 SSSVYLMFGIDFAMLLVDTLSIGLHGVVNFVEVYRLQ----SHNSHY------DE----- 225
           S+S+YLM  ++F MLL+D L++ L   +NF E Y  Q    + N+H       DE     
Sbjct: 182 STSLYLMQVMEFTMLLIDLLNLFLQTSLNFWEFYCSQQSQSNENNHIVQDEVEDENEVDS 241

Query: 226 ----------------EFLGLEGKFMYEKLIDMGARXXXXXXXXXXXIPFRMPXXXXXXX 269
                           +F GLEGKFMYEK ID+  R           IPFRMP       
Sbjct: 242 GEPHAELDDDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKDV 301

Query: 270 XXXXXSLYQTATSLWKTWKNAKKLDEKLPDVTEEEL-NQGN--NMCIVCMDDMLPNSET- 325
                +LYQ+AT+LWK W+N K+LD+ L  VT E++ N  N  N+CI+CMD+++ ++   
Sbjct: 302 VWDVLALYQSATTLWKIWRNNKQLDDTLITVTIEQMQNSANEDNICIICMDELIHSANQQ 361

Query: 326 --RNANLKPKKLPCGHILHLSCLKSWMERSQTCPICRLPVFDERGNVTRMDSSSQEQQLP 383
             +N N KPK+LPCGHILHLSCLK+WMERSQTCPICRLPVFDE+GNV +   +S      
Sbjct: 362 AWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQTPFTSNSTTTR 421

Query: 384 HNLQRQEAEGEVVQMTTSPFHTTSASVGPTSTTPTQANRS-----VIMPQVPRVPQDWYA 438
           +N    +        T     T    + PT T P  A  +      +   +      WY 
Sbjct: 422 NNTSTTDTTRTATTATNQYISTNDTELIPTRTIPHDAGIASSQNMNMSASMSASSNTWYT 481

Query: 439 FPIEATQTTKDK---VVFKLVDSDNNEITANLLTKTRPQFQKVT------EVSGGQ-RIT 488
           FP++ T  T  +     ++ + S +NE   ++  K   +  ++       E  G Q RI 
Sbjct: 482 FPLQQTGNTSGESKCSTYEFLISSSNEKDNSIPVKLTVESHELNSEQGREEEQGAQKRIV 541

Query: 489 IPQSCIEQ 496
           IP   I+ 
Sbjct: 542 IPDQFIQH 549

>TPHA0F02480 Chr6 (546818..548635) [1818 bp, 605 aa] {ON} Anc_6.45
           YOL013C
          Length = 605

 Score =  317 bits (813), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 208/599 (34%), Positives = 310/599 (51%), Gaps = 85/599 (14%)

Query: 3   VSQNRRGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNGVL 62
           +S  R+ Q  + +   Y++ I+  Y ++ SS ++LQ TIKL +G+N+IIL  F LLN   
Sbjct: 4   LSVTRKYQLALITFVIYTSTIFVTYLAIQSSSSYLQVTIKLTKGLNVIILVLFGLLNVAF 63

Query: 63  LWKXXXXXXXXXXXXIEYEHVFERLSFTIVNSIFVSSMFKEQDF-LTVLVFTAVLIFLKV 121
           +WK            IEYEH+ ERL FTI+N   +SSMF E+D  +++  +  +LIF+KV
Sbjct: 64  IWKGLMYLLFSSLRLIEYEHILERLPFTIINFCLLSSMFNERDIIMSISSYGMILIFMKV 123

Query: 122 FHWILKDRLEFVFQNANENTNLKKMXXXXXXXXXXXX-ASVDYQMVRYCLSNSISNDQWT 180
            HW+LKDRLE + Q+ N+N++++ +             A +DYQM+  C++NSI N    
Sbjct: 124 AHWVLKDRLESLLQSMNDNSSIRSLIFSNRFFLNLGLFAVIDYQMMMQCVTNSIKNSMGA 183

Query: 181 SSSVYLMFGIDFAMLLVDTLSIGLHGVVNFVEVYR-LQSHNSHY-----------DEEFL 228
           S+S++L+ G++F MLLVD +++ LH  +N  E ++ ++  N +            +EEF 
Sbjct: 184 STSIHLLLGVEFTMLLVDLVNLFLHTCLNLYEFHKSIEDRNLNIVGEDEDGLVDDEEEFN 243

Query: 229 GLEGKFMYEKLIDMGARXXXXXXXXXXXIPFRMPXXXXXXXXXXXXSLYQTATSLWKTWK 288
            LEGKFMYEK ID+  R           IPFRM             +LYQ+  SLWKTW+
Sbjct: 244 ELEGKFMYEKAIDIFTRFLKTLLHLLMFIPFRMKIVLLKDVIWDVITLYQSTVSLWKTWR 303

Query: 289 NAKKLDEKLPDVTEEEL-NQGNNMCIVCMDDMLP---NS-----------ETRNANL--- 330
           N+K+LDEKLP V+ EEL +  N+MCIVCMD ++    NS           +  NA +   
Sbjct: 304 NSKQLDEKLPTVSLEELKSSDNDMCIVCMDSLINIDFNSTEETENKEKEEQIYNAAIHSK 363

Query: 331 -KPKKLPCGHILHLSCLKSWMERSQTCPICRLPVFDERGNV-----TRMDSSSQEQQLPH 384
            KPKKLPC HILHL CLK+WMERSQTCPICRL VFD  GN+     TR D+    +    
Sbjct: 364 QKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNGNILPFNNTRSDTMRNTELTAT 423

Query: 385 NL-----QRQEAEGEVVQMTTSPFHTT-----------SASVG----------------- 411
           N      +  E + E+  + +S    +            +S+G                 
Sbjct: 424 NSNDAADESTENDTEMDALLSSQVQESVGDTLARDINFRSSIGDADVEGENNDNYDLDNE 483

Query: 412 ---PTSTTPTQ-ANRSVIMPQVPRVPQDWYAFPIEATQTTKDKVVFKLVDSDNNE--ITA 465
              P S  P+Q  N      +       W +F I++    K+ + F+L D  N +  I  
Sbjct: 484 LEIPNSDNPSQLLNSESQNAECEFNNVKWKSFLIKSVN--KESISFELTDLKNPDQTILT 541

Query: 466 NLLTKTRPQFQKVTEVSGGQRITIPQSCIEQKEE---IESLKRKISEMENKLDALTKRV 521
            L+ K +P  +    +   +++ I    I    E   I+SL  KI+E+E KL  ++ ++
Sbjct: 542 KLIIKEKPILKDSKNI---KQVVIKDEDIWMATEPKTIKSLNDKINELERKLKDISSKI 597

>TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.45
           YOL013C
          Length = 492

 Score =  311 bits (797), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 190/537 (35%), Positives = 294/537 (54%), Gaps = 74/537 (13%)

Query: 1   MPVSQNRRGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNG 60
           MP  Q+R  QF+++++F Y     SVY ++SSS++FLQ TIKL +G N+II+  F ++N 
Sbjct: 1   MPFYQSRTAQFVLFTLFIYVLTFASVYFAISSSISFLQVTIKLTQGFNIIIISIFSIINS 60

Query: 61  VLLWKXXXXXXXXXXXXIEYEHVFERLSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIFLK 120
           ++LWK            IEYEHV ERL FT++N +F+SSMF E D  T ++ + +L+++K
Sbjct: 61  IILWKFSNYLLFGELRLIEYEHVLERLPFTVINMVFMSSMFNEHDIFTTIILSLLLLYMK 120

Query: 121 VFHWILKDRLEFVFQNANENTNLKKMXXXXXXXXXXXXAS-VDYQMVRYCLSNSI--SND 177
           V +WIL+DRLE + Q  N++T +  +             S +DY M+ +C+SNS+  +++
Sbjct: 121 VSNWILRDRLESLLQTVNDSTTIFNLIFSTQFFFNLILFSLIDYLMMNFCISNSLLSNSN 180

Query: 178 QWTSSSVYLMFGIDFAMLLVDTLSIGLHGVVNFVEVYR-----LQSHNSHYDEE-----F 227
             +S+SVYL+ G++F MLLVD  +I  H ++N  E Y+     L +H +  DEE     F
Sbjct: 181 IGSSASVYLLMGMEFTMLLVDLFNILCHSILNIYEFYKSSLVSLDTHLTSEDEEDDESGF 240

Query: 228 LGLEGKFMYEKLIDMGARXXXXXXXXXXXIPFRMPXXXXXXXXXXXXSLYQTATSLWKTW 287
            GLEGKF+YEK+ID   R           IPF MP            +L Q   ++WK W
Sbjct: 241 NGLEGKFIYEKIIDTFTRFLKTIIHILLLIPFAMPVMLSKDVVIDLVTLSQNINTIWKIW 300

Query: 288 KNAKKLDEKLPDVTEEELNQ-GNNMCIVCMDDMLPNSETRN-ANLKPKKLPCGHILHLSC 345
            N +KLD++LP VT+ +L+   + +CI+CMDD+  NS  +N    KPK LPCGHILH++C
Sbjct: 301 VNNRKLDDQLPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNC 360

Query: 346 LKSWMERSQTCPICRLPVFDERGNVTRMDSSSQEQQLPHNLQRQEAEGEVVQMTTSPFHT 405
           LK+WMERSQTCP+CRLPVF+E+G V           LP   +R                 
Sbjct: 361 LKNWMERSQTCPMCRLPVFNEKGEV-----------LPTRRER----------------- 392

Query: 406 TSASVGPTSTTPTQANRSVIMPQVPRVPQDWYAFPIEATQTTKDKVVFKLVDSDNNEITA 465
                   +TTP  +  +          ++W +FPIE    +   + F L + D      
Sbjct: 393 --------ATTPEPSTSTS---SDSEENEEWVSFPIETIDDS--TITFNLANDDGR---- 435

Query: 466 NLLTKTRPQFQKVTEVSGGQRITIPQSCIEQKEEIESLKRKISEMENKLDALTKRVR 522
             + K+R      T+ +            +  ++I  LK+KI++++++++ L K ++
Sbjct: 436 --ILKSRLLINSTTDTT------------QNSDDILGLKQKINQLQDQINQLNKNMK 478

>KAFR0A05240 Chr1 (1036153..1037814) [1662 bp, 553 aa] {ON} Anc_6.45
           YOL013C
          Length = 553

 Score =  309 bits (791), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 197/562 (35%), Positives = 294/562 (52%), Gaps = 77/562 (13%)

Query: 3   VSQNRRGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNGVL 62
           + Q+R+ Q +++S+  Y   I +++ S  SS TFLQ TIKL +G+N++IL  F  LN  L
Sbjct: 2   IVQSRKQQLVIFSMIIYLLTIITIFTSYKSSKTFLQCTIKLTQGINVLILAIFTALNLFL 61

Query: 63  LWKXXXXXXXXXXXXIEYEHVFERLSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIFLKVF 122
           LW+            IE+EH+FERL FTI+N +F+ S+F E  F   LVF  +L  LKVF
Sbjct: 62  LWEFLRWILFGELRLIEHEHIFERLPFTIINVLFMISIFNEYQFFNALVFALILSVLKVF 121

Query: 123 HWILKDRLEFVFQNANENTNLKKMXXXXXXXXXXXXASVDYQMVRYCL------------ 170
           HWILKDRLE + Q+ N+ T+LK +            + +D+ +                 
Sbjct: 122 HWILKDRLESLLQSINDATDLKNLIFSRYMLNLAIFSVLDFWICSNTYRAFRGYDNNNST 181

Query: 171 --------SNSISNDQWTSS---SVYLMFGIDFAMLLVDTLSIGLHGVVNFVEVYRLQSH 219
                   SN ++ +  T +   +++L+FG++F +L +D +++ +H V+NF E Y  Q  
Sbjct: 182 NNNQNADSSNLMNKNNLTPTNKKALFLLFGMEFFVLFLDLINLAMHTVLNFYEFYCSQRA 241

Query: 220 NSHYD-------------------EEFLGLEGKFMYEKLIDMGARXXXXXXXXXXXIPFR 260
            +H++                     F GLEGKFMYEKLID+  +           I  +
Sbjct: 242 TAHHNVNAGTDEESEEEADGDDDDANFNGLEGKFMYEKLIDVSTKFFKTIVHIFVLIQTK 301

Query: 261 MPXXXXXXXXXXXXSLYQTATSLWKTWKNAKKLDEKLPDVTEEEL-NQGNNMCIVCMDDM 319
           +             +LYQ + SLWK +KN K+LD+KLP ++  ++ N  +N+CIVCMDD+
Sbjct: 302 LQIMVLKDVVWDCLTLYQDSISLWKIYKNNKQLDDKLPTLSVNDVENDNDNICIVCMDDL 361

Query: 320 LPNSETRNA-------------NLKPKKLPCGHILHLSCLKSWMERSQTCPICRLPVFDE 366
           +P+   + A             + +PKKLPCGH+LHLSCLK+WMERSQTCPICRLPVFDE
Sbjct: 362 VPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPICRLPVFDE 421

Query: 367 RGNVTR-MDSSSQEQQLPHN-------LQRQEAEGEVVQMTTSPFHT-TSASVGPTSTTP 417
            GNV   + +++     P+N                   MT  P  T TSAS   TS+  
Sbjct: 422 NGNVKPFLHTTTNNNMQPNNDADVTSTTATNSRTDTSTPMTDVPTPTRTSASALTTSSII 481

Query: 418 TQANRSVIMPQVPRVPQDWYAFPIEATQTTKDKVVFKL--VDSDNNEITANLLTKTRPQF 475
           TQ  ++ I P +  V  +WYAF I++    +++V F +    S+N  I   LL       
Sbjct: 482 TQDFKNGITP-IDSV--EWYAFEIDSISDARNEVKFNVRNASSNNRSIPMKLL------I 532

Query: 476 QKVTEVSGGQRITIPQSCIEQK 497
           +++ E + GQ I IP S   ++
Sbjct: 533 ERMEETAEGQ-IVIPDSAFSRE 553

>Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON}
           (124427..126232) [1806 nt, 602 aa]
          Length = 601

 Score =  297 bits (760), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 204/579 (35%), Positives = 291/579 (50%), Gaps = 80/579 (13%)

Query: 21  AAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNGVLLWKXXXXXXXXXXXXIEY 80
           A   S+Y ++ SS ++LQ TIKL +G N I+L  F +LNG  +W+            IEY
Sbjct: 23  ATFLSIYFAVLSSTSYLQVTIKLSQGFNAIVLVLFAILNGTYVWRFFIWLAFGNLRLIEY 82

Query: 81  EHVFERLSFTIVNSIFVSSMFKEQDF-LTVLVFTAVLIFLKVFHWILKDRLEFVFQNANE 139
           EHV ERL FTI+N +   SMF ++    T  +F   LIF+KV HWIL+DRL+ + Q+ N+
Sbjct: 83  EHVMERLPFTILNMVITYSMFNDKSIAFTGSIFGFFLIFMKVLHWILRDRLDAIVQSFND 142

Query: 140 NTNLKKMXXXXXXXXXXXXAS-VDYQMVRYCLSNSISNDQWTSSSVYLMFGIDFAMLLVD 198
           ++ L  +             + VDY+MV YC+SNS+SN    S++V+L+ G++F MLL+D
Sbjct: 143 SSTLTSIILSNNFFLNLIIFTIVDYKMVSYCVSNSLSNSMGASTTVHLLLGMEFTMLLID 202

Query: 199 TLSIGLHGVVNFVEVYRLQSHNSH-------------YDEEFLGLEGKFMYEKLIDMGAR 245
            L++ LH  +N  E +      S               + +F  LEGKFMYEK ID+  R
Sbjct: 203 LLNLFLHTCLNLYEFHLTTLERSSNIIQEDGEDDEEDDELQFNSLEGKFMYEKTIDVFTR 262

Query: 246 XXXXXXXXXXXIPFRMPXXXXXXXXX-XXXSLYQTATSLWKTWKNAKKLDEKLPDVTEEE 304
                      IP RM              SLY+   SLWKTWKN K+LD+KLP  + EE
Sbjct: 263 FLKTFIHILMLIPLRMKFFLLLKDVIWNVISLYKHTGSLWKTWKNNKQLDDKLPTASIEE 322

Query: 305 L-NQGNNMCIVCMDDMLP--NSETRNANL-------------KPKKLPCGHILHLSCLKS 348
           L N  NN+CIVCMDD+LP  NSE  ++               KPKKLPCGHILHL+CLK+
Sbjct: 323 LKNTDNNICIVCMDDLLPRINSEKYDSQREKELYDHIMKSKQKPKKLPCGHILHLNCLKN 382

Query: 349 WMERSQTCPICRLPVFDERGNVTRMDSSS----------------------QEQQLPHNL 386
           WMERSQTCPICRLPVFD++GNV     S                       Q +  P   
Sbjct: 383 WMERSQTCPICRLPVFDDKGNVMPSTHSQNQTETQQQQPQTQTQSTTELQPQTEVQPDLN 442

Query: 387 QRQEA--EGEVVQMTTSPFHTTSASVGPTSTTPTQANRSVIMPQVPRV------------ 432
           QRQE   +  V  +  +P    SA       T + ++ ++   QV               
Sbjct: 443 QRQETNIQHNVQNVIETP-GRDSAQDASRGGTGSNSDHNLTNTQVSSEGSSNEQQGNVTN 501

Query: 433 ----PQDWYAFPIEATQTTKDKVVFKLVDSDN--NEITANLLTKTRPQFQKVTEVSGGQR 486
                  WY+FPI+   ++   + F + D+ +      A L  + +   + +    G  +
Sbjct: 502 SILNTSSWYSFPIKT--SSDSSITFDISDAHDPAKVYPAKLSVEEKVSSRTLNSDGGMLQ 559

Query: 487 ITIPQSCIE---QKEEIESLKRKISEMENKLDALTKRVR 522
           + I    I+     + I+ LK++I+E+E K+D+L   V+
Sbjct: 560 VVIKDKDIKTVTDSKTIDLLKKRITELEEKVDSLAANVQ 598

>NCAS0D02010 Chr4 complement(371205..372737) [1533 bp, 510 aa] {ON}
           Anc_6.45 YOL013C
          Length = 510

 Score =  289 bits (739), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 168/519 (32%), Positives = 259/519 (49%), Gaps = 71/519 (13%)

Query: 5   QNRRGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNGVLLW 64
           Q RR Q I ++   Y   I  + +S   S +FL  ++KL +G N++I+  F LLN +LLW
Sbjct: 3   QTRRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMIITIFILLNALLLW 62

Query: 65  KXXXXXXXXXXXXIEYEHVFERLSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIFLKVFHW 124
           K            IE EH+ ERL FTI+N IF+S+MF E+ F+T+  +  +L+++K+F+W
Sbjct: 63  KFLNFLLFKELRLIEQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIFYW 122

Query: 125 ILKDRLEFVFQNANENTNLKKMXXXXXXXXXXXXASVDYQMVRYCL-------------- 170
           ILKDRLEF+ Q +N N ++ +             ++++ Q+++ C+              
Sbjct: 123 ILKDRLEFLIQ-SNTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLNS 181

Query: 171 --------------SNSISNDQWTSSSVYLMFGIDFAMLLVDTLSIGLHGVVNFVEVYRL 216
                         S   SN     + +YLM  ++FA+LL++ +++ LH +++  E+Y+ 
Sbjct: 182 TSILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFAILLINFINLFLHSILSLYEIYK- 240

Query: 217 QSHNSHYDE--------------------EFLGLEGKFMYEKLIDMGARXXXXXXXXXXX 256
              ++ YD+                    +F GLE KF+YEK+ID+  R           
Sbjct: 241 ---SNQYDQLNAIIEDIEDENDDDDDTPADFNGLENKFIYEKIIDLFTRSLMTMIHISLA 297

Query: 257 IPFRMPXXXXXXXXXXXXSLYQTATSLWKTWKNAKKLDEKLPDVTEEELNQGNNMCIVCM 316
           +P  +P            SLYQ    L++  KN K LD KLPD+  E+L   +N+CIVCM
Sbjct: 298 LPLNLPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPEDLQDSDNVCIVCM 357

Query: 317 DDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICRLPVFDERGNVTRMDSS 376
           DD+L     +    K K+LPCGH LHLSCLK+WMERSQTCPICRLPVFDE GNV      
Sbjct: 358 DDLLSEEHKKK---KAKRLPCGHFLHLSCLKNWMERSQTCPICRLPVFDESGNV------ 408

Query: 377 SQEQQLPHNLQRQEAEGEVVQMTTSPFHTTSASVGPTSTTPTQANRSVIMPQVPRVPQD- 435
            +E + P       A      +          S   + + P    +  + P+   +  + 
Sbjct: 409 -KESERP-------ATAADADVDVDVAAAQPPSTSSSPSIPHSPIQETLEPEEASIDNNT 460

Query: 436 WYAFPIEATQTTKDKVVFKLVDSDNNEITANLLTKTRPQ 474
           WY+FPI      K  + F+L D   +  T  L+ +T+ +
Sbjct: 461 WYSFPITHINKDKSVISFELRDDKESSETVQLIRETKTE 499

>CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013c HRD1
          Length = 545

 Score =  265 bits (677), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 150/416 (36%), Positives = 228/416 (54%), Gaps = 43/416 (10%)

Query: 7   RRGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNGVLLWKX 66
            + +F++++  TY   I+ V  +  SSV+FLQ  +KL EG N++I+  F LLN  LLW+ 
Sbjct: 6   HKREFLIFTAITYVLTIYCVISACQSSVSFLQIALKLSEGFNILIITVFTLLNSTLLWQF 65

Query: 67  XXXXXXXXXXXIEYEHVFERLSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIFLKVFHWIL 126
                      IE+EH+FERL F ++N+IF+ S F E+ F T+     VL+++KVFHWIL
Sbjct: 66  LTSMLFGELRIIEHEHIFERLPFAVINTIFMFSTFNEKYFFTLATCALVLLYMKVFHWIL 125

Query: 127 KDRLEFVFQNANENTNLKKMXXXXXXXXXXXXASVDYQMVRYCLSNS--ISNDQWTSSS- 183
           +DRL+ + Q  NE+T  K +              +D  ++ +C+S +  I++  +T+ + 
Sbjct: 126 RDRLDLLLQGINEDTRWKDLLVNRYICNLLLLVVIDSYVISFCVSTAYNIASSIFTAGTN 185

Query: 184 ---------------VYLMFGIDFAMLLVDTLSIGLHGVVNFVEVY---RLQSHNSHY-- 223
                          +Y+M  ++F  L++D +++ L+  + F E +   +   +N  +  
Sbjct: 186 SIVLGGGSPLTQRALIYIMQAMEFTNLMIDLVNLILNTGLQFYEFHLSRKFSQNNPTFNS 245

Query: 224 -------------DEEFLGLEGKFMYEKLIDMGARXXXXXXXXXXXIPFRMPXXXXXXXX 270
                        D +F GLEGKFMYEKLID+  R           +   +P        
Sbjct: 246 ISAEDADTESEDGDSQFNGLEGKFMYEKLIDVVTRFLQTLVHVVMAMVLNLPLMLVKDIF 305

Query: 271 XXXXSLYQTATSLWKTWKNAKKLDEKLPDVTEEELNQG---NNMCIVCMDDML---PNSE 324
                LY  + SL   WKN+K+LD KLP +T ++LN     +N+CIVCMD+++   P+  
Sbjct: 306 VDVWVLYMNSKSLLAIWKNSKQLDTKLPTMTSDDLNNDPNFDNVCIVCMDELVSENPHHH 365

Query: 325 TRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICRLPVFDERGNVTRMDSSSQEQ 380
             +   KPKKLPCGH+LHLSCLK+WMERSQTCPICRLPVFDE G +    S++  Q
Sbjct: 366 QSDGK-KPKKLPCGHVLHLSCLKNWMERSQTCPICRLPVFDENGEILAPSSANVSQ 420

>NDAI0C02770 Chr3 (640635..642527) [1893 bp, 630 aa] {ON} Anc_6.45
           YOL013C
          Length = 630

 Score =  266 bits (679), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 156/505 (30%), Positives = 251/505 (49%), Gaps = 97/505 (19%)

Query: 7   RRGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNGVLLWKX 66
           ++ QF+++S+  Y    +++ ++ +SS +FL   +KL EG N++I+  F LLN +L WK 
Sbjct: 11  KKFQFVIFSISVYLITFFTIINAANSSTSFLHLCLKLNEGFNIMIITIFILLNSLLSWKL 70

Query: 67  XXXXXXXXXXXIEYEHVFERLSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIFLKVFHWIL 126
                      IE EH+ ERL FT++N I +++MF E+ F T+ ++  +LI L+V+HWIL
Sbjct: 71  ITWFLFNDLRLIEQEHIMERLPFTVINFIVMATMFNERFFFTLTIYGLLLISLRVYHWIL 130

Query: 127 KDRLEFVFQNANENTNLKKMXXXXXXXXXXXXASVDYQMVRYCL---------------- 170
           KDRLEF+ Q  N++T++ K+            + ++ ++++ CL                
Sbjct: 131 KDRLEFIIQTINDSTSMTKIIFSKFSFNLISLSLINLKLIQNCLTWDDINFWKNNQNLFN 190

Query: 171 ---------------SNSISNDQWTSSSVYLMFGIDFAMLLVDTLSIGLHGVVNFVEVYR 215
                          SN I+N    S+ VYLM G++F++LL++  ++  H +++  E Y+
Sbjct: 191 SIMNYLINPISSTTISNGINNH---SNPVYLMLGMEFSILLLEYFNVLFHSLLSLFEFYK 247

Query: 216 LQ-----------------SHNSHYDEE--------------------FLGLEGKFMYEK 238
            +                 +  +  DE                     F GLEGKF+YEK
Sbjct: 248 SKQFSIQQQQIRQNNLINRAQTTQNDENEINIGLDIDIDDDEEDDDETFNGLEGKFIYEK 307

Query: 239 LIDMGARXXXXXXXXXXXIPFRMPXXXXXXXXXXXXSLYQTATSLWKTWKNAKKLDEKLP 298
           +ID+  R           +P  +P            SLY+ A SL+K WKN +KL+  LP
Sbjct: 308 IIDLFTRFLMTIIHVSLLLPLNIPMILVKDILWDFFSLYRNAMSLYKIWKNNQKLESALP 367

Query: 299 DVTEEELNQGNNMCIVCMDDMLPNSETRN-----ANLKPKK--------------LPCGH 339
           ++T ++L   +N+CI+CMDD+LP+ ET       ++  P                LPCGH
Sbjct: 368 NMTPDDLQHSDNVCIICMDDLLPSLETLEHATNVSSTTPSSNHYLNIKKKKKPKKLPCGH 427

Query: 340 ILHLSCLKSWMERSQTCPICRLPVFDERGNVTRMDSSSQEQQLPHNLQRQEAEGEVVQMT 399
            LH SCLK+WMERSQTCPICRL VFD+ GNV    +++    +  +   Q +E       
Sbjct: 428 FLHFSCLKNWMERSQTCPICRLDVFDKNGNVKVYPNTNTNTNVNDSSHDQTSENR----- 482

Query: 400 TSPFHTTSASVGPTSTTPTQANRSV 424
             P  T+++++ P S T    N  +
Sbjct: 483 --PPSTSTSNIIPGSNTNITTNTPI 505

>KNAG0E02740 Chr5 complement(544981..546651) [1671 bp, 556 aa] {ON}
           Anc_6.45 YOL013C
          Length = 556

 Score =  249 bits (637), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 148/427 (34%), Positives = 216/427 (50%), Gaps = 61/427 (14%)

Query: 5   QNRRGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNGVLLW 64
           ++R+ QF +  V  Y    ++V ++  +S TFL+ T  L +GVN +I+  F LLN VLLW
Sbjct: 7   RSRKQQFALLVVVIYLLTAFTVINAFGNSHTFLEWTTGLTQGVNYVIIAAFSLLNIVLLW 66

Query: 65  KXXXXXXXXXXXXIEYEHVFERLSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIFLKVFHW 124
           K            IE EH+FER+  T++N I +SS+  ++    +++   +L+ LKV HW
Sbjct: 67  KGFTYMVFGDLRLIEEEHIFERIPLTVINLIMISSLLSDKYMFDIVLLGGLLLVLKVSHW 126

Query: 125 ILKDRLEFVFQNANENTNLKKMXXXXXXXXXXXXASVDYQMVRYCLSNSISN---DQWTS 181
           IL+DRLE   Q  N+ T L  +              +DY + + C  N   N       S
Sbjct: 127 ILRDRLEGFLQRINDTTTLTSLLFSKFSRNLLIFGILDYFVTKICFFNHFGNFYHHGDFS 186

Query: 182 SSVYLMFGIDFAMLLVDTLSIGLHGVVNFVEVYRLQSHNSHYDEEFL------------- 228
           +   +MFG+++A++ +D ++I  H V+NF   +R Q  ++ ++ E +             
Sbjct: 187 NITQIMFGLEYAVVFIDLINILCHTVLNFYAFHRTQLQSARFNLEMMNDDFSEDENDSGV 246

Query: 229 ----GLEGKFMYEKLIDMGARXXXXXXXXXXXIPFRMPXXXXXXXXXXXXSLYQTATSLW 284
               GLEGKF+YEKLID  A            IP R              +L     SLW
Sbjct: 247 NADGGLEGKFIYEKLIDFVAGVLRTGLHFTMLIPLRFQSMLVKDFVWDLFNLVNNGNSLW 306

Query: 285 KTWKNAKKLDEKLPDVTEEELNQGNNMCIVCMDDML-------------------PNSE- 324
           K +KN ++L++KLP++  E+L   +NMCIVCMDD++                    N+E 
Sbjct: 307 KIYKNNRQLNKKLPNIAIEDLLDHDNMCIVCMDDLVLVHHPTKRRQSVQEECDDEKNTEK 366

Query: 325 ----TRNANL-----------------KPKKLPCGHILHLSCLKSWMERSQTCPICRLPV 363
               T   +L                 KPKKLPCGH+LH SCLK+WMERSQTCPICR+PV
Sbjct: 367 DKPSTTEEDLSEVEPTQGDIDRMADSKKPKKLPCGHMLHFSCLKNWMERSQTCPICRVPV 426

Query: 364 FDERGNV 370
           FD+ GNV
Sbjct: 427 FDKDGNV 433

>ACL019C Chr3 complement(328044..329771) [1728 bp, 575 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL013C
           (HRD1)
          Length = 575

 Score =  246 bits (627), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 174/566 (30%), Positives = 262/566 (46%), Gaps = 68/566 (12%)

Query: 18  TYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNGVLLWKXXXXXXXXXXXX 77
           TY+ A WS Y   +S    L        GV+ +I GNF +++  L               
Sbjct: 17  TYALAGWSAYSCATSFDDPLSALFMASSGVHFVIWGNFLIVHYCLFVWAIIRVLFGQLTA 76

Query: 78  IEYEHVFERLSFTIVN-SIFVSSMFKE--QDFLTVLVFTAVLIFLKVFHWILKDRLEFVF 134
           IEY+H+FERL   +V  +  V +M K      +T+L +T  L    V HW+L+DR++FVF
Sbjct: 77  IEYDHIFERLHVVLVTLASIVITMRKTYMAGHMTILFYTLCL----VAHWVLRDRMDFVF 132

Query: 135 QNANENTNLKKMXXXXXXXXXXXXASVDYQMVRYCLSNSISNDQWTSSSVYLMFGIDFAM 194
           Q    +++L  +              VDY+M+++C+ N+  N       +YLM  + FA 
Sbjct: 133 QVHGTDSSLLGILCSRFMFSLLVLGMVDYKMLKFCVQNT--NVDGKRHELYLMLALSFAQ 190

Query: 195 LLVDTLSIGLHGVVNFVEVYR---LQSHNSHYD---------EEFLGLEGKFMYEKLIDM 242
           L++D L + L   +N  E+ R    +S N  Y+         +E   LEGK++YE + D+
Sbjct: 191 LILDVLHVVLLTSLNLFEMVRSRRTRSANLVYEGGTTDDDADDEVFILEGKYIYETVFDL 250

Query: 243 GARXXXXXXXXXXXIPFRMPXXXXXXXXXXXXSLYQTATSLWKTWKNAKKLDEKLPDVTE 302
                         +                    ++   ++  WKN KKL EKL DV+E
Sbjct: 251 TITVLKVILDIIQEVFVPWSITVVYSIFVRSIKAGESFLLVYNYWKNNKKLYEKLSDVSE 310

Query: 303 EELNQGNNMCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICRLP 362
           E+L+  ++MCI+CMDDMLP +ET   N + K LPCGH+LH  CLKSWMERSQTCPICRL 
Sbjct: 311 EQLDDTDSMCIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQTCPICRLS 370

Query: 363 VFDERGNVTRMDSSSQEQQLPHNLQRQ--EAEGEVVQM------TTSPFHTTSASVGPTS 414
           VF    N +   + ++EQ  P  LQ +  +   +V+ M      + S    T+   G T 
Sbjct: 371 VFANDSN-SHATTQAREQTPPDLLQERGIDEHIDVIGMQDMSVQSISLHEGTAVRRGTTG 429

Query: 415 TTPTQANRSVIMPQVPRVPQDWYAFPIEATQTTKDKVVFKLVDSDNN-EITANLLTKTR- 472
               QA    ++    R    W AFPIE      +KV F L DS  + +  A+  +  R 
Sbjct: 430 NCMNQAYDGGLLSHEERDQAGWVAFPIEF--RADNKVFFNLNDSQGDRQWMASYTSYPRQ 487

Query: 473 --------------------PQFQKVTEVSGGQR--------------ITIPQSCIEQKE 498
                               P      E +  Q                 I  S +EQ +
Sbjct: 488 NMVNSDDPDNASESHSRIPSPSLPGSLEGTSSQVDVTVSAKDAPANACFVIATSKLEQTK 547

Query: 499 EIESLKRKISEMENKLDALTKRVRTE 524
           E+E LKRK+ E+E++++ L+KR++T+
Sbjct: 548 EVEHLKRKVEELESRVEELSKRIKTD 573

>KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {ON}
           weakly similar to uniprot|Q08109 Saccharomyces
           cerevisiae YOL013C HRD1 Ubiquitin-protein ligase
           required for endoplasmic reticulum-associated
           degradation (ERAD) of misfolded proteins genetically
           linked to the unfolded protein response (UPR) regulated
           through association with Hrd3p contains an H2 ring
           finger
          Length = 553

 Score =  239 bits (610), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 169/554 (30%), Positives = 268/554 (48%), Gaps = 64/554 (11%)

Query: 10  QFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNGVLLWKXXXX 69
           +FI YS+ +Y+AA WS++  +++S ++L    K+ EG++ +I GN  LLN VL+ K    
Sbjct: 25  KFIAYSLMSYTAAAWSLHYCVTTSFSYLHAMTKITEGIHAMIWGNLFLLNSVLILKGVIH 84

Query: 70  XXXXXXXXIEYEHVFERLSFTIVNSIF-VSSMFKEQDFLTVLVFTAVL-IFLKVFHWILK 127
                   IEYEH+ ER+S+T++  +   SSM      ++V+    VL +  +  HWILK
Sbjct: 85  MLFGQLRLIEYEHILERISYTVITLLLSCSSM---NGLISVMQIHCVLFVCCRTLHWILK 141

Query: 128 DRLEFVFQNANENTNLKKMXXXXXXXXXXXXASVDYQMVRYCLSNSI--SNDQWTSSSVY 185
           DR+E  FQ  +    LK +             +VD  +V Y ++  +  SN   T    Y
Sbjct: 142 DRMEVTFQANDMRLTLKDILLSRFMFNLLVLTAVDGIIVAYYVNKILYKSNIDVT----Y 197

Query: 186 LMFGID-FAMLLVDTLSIGLHGVVNFVEVYRLQSH-------NSHYDEEFL--------- 228
            +F I  +A+L  D L + L   +N  E+  +Q+        + H DE  +         
Sbjct: 198 TLFIISQYAILGTDLLQVILRTGLNLFELSTIQNRARIRRNADHHVDEPVINHEERPNAV 257

Query: 229 -------------GLEGKFMYEKLIDMGARXXXXXXXXXXXIPFRMPXXXXXXXXXXXXS 275
                        GLEGKF+YEKLID+                F               +
Sbjct: 258 AIEEDEDEDEENAGLEGKFIYEKLIDVFISTVKVIIKFASS--FSTGRVMMVTVLWEAIT 315

Query: 276 LYQTATSLWKTWKNAKKLDEKLPDVTEEELNQGN-NMCIVCMDDMLPNSETRNANLKPKK 334
            +++A  LWK WK++K LD  L D T+ ++  G  ++CIVCM+D LP+ + ++   K K 
Sbjct: 316 TFKSARGLWKNWKSSKSLDASLMDATDIQIESGEIDICIVCMEDFLPSHQRKSDGKKVKI 375

Query: 335 LPCGHILHLSCLKSWMERSQTCPICRLPVFDERGNVTRMDSSSQEQQLPHNLQRQEAEGE 394
           LPC H LHLSCLK+W+ RS TCPICRLP+FDE GNV      SQ    P+   ++ + G 
Sbjct: 376 LPCTHALHLSCLKNWIARSPTCPICRLPIFDENGNVMPYQDHSQSTD-PNTTAQEISPGI 434

Query: 395 VV----QMTTSPFHTTSASVGPTSTTPTQANRSVIMPQVPRVPQDWYAFPIEATQTTKDK 450
            V    Q   +   TT+ ++  +    T  N + +  +   +       PI+     K K
Sbjct: 435 AVETNSQTNINTLETTNQNITLSPDNSTAQNLAFLPTRNTSL-----IIPIQREDEHKHK 489

Query: 451 VVFKLVDSDNNEITANLLTKTRPQFQKVTEVSGGQRITIPQSCIEQKEEIESLKRKISEM 510
             FK++     EI  +L+ +      K +       + +PQ  +  ++    LKRKI+++
Sbjct: 490 --FKILTESGKEIEGSLILRNNIDTTKGS-------VVLPQDLLIDQDA-SQLKRKIADL 539

Query: 511 ENKLDALTKRVRTE 524
           E+KL+ L+K+V+ E
Sbjct: 540 ESKLEELSKKVKRE 553

>Ecym_3048 Chr3 (91031..93043) [2013 bp, 670 aa] {ON} similar to
           Ashbya gossypii ACL019C
          Length = 670

 Score =  197 bits (500), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 127/393 (32%), Positives = 188/393 (47%), Gaps = 32/393 (8%)

Query: 1   MP--VSQNRRGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLL 58
           MP  VS + R QFI     TY+ A WS+Y+  S+S++FLQ   K   GV+LII GNF L+
Sbjct: 1   MPREVSWSIRLQFIA---VTYALAAWSLYNCTSTSLSFLQAMYKATYGVHLIIWGNFLLV 57

Query: 59  NGVLLWKXXXXXXXXXXXXIEYEHVFERLSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIF 118
           +  +               +EYEH+FERL  T+++S+ V      ++    ++     + 
Sbjct: 58  HYFIGGWLVVRMLFGRLTLLEYEHIFERLHLTVLSSLSVLITMDRKNSKIGVIAIPFHVL 117

Query: 119 LKVFHWILKDRLEFVFQNA-NENTNLKKMXXXXXXXXXXXXASVDYQMVRYCLSNSIS-- 175
            +V HW+++DR+EFVF         +K +              VD++++ Y      +  
Sbjct: 118 CQVLHWVVRDRMEFVFAPPIGTRMAMKDLLFSRFMLSIVVLGVVDFKLMMYFYRQHQAEQ 177

Query: 176 ----------NDQWTSSS-VYLMFGIDFAMLLVDTLSIGLHGVVNFVEVY----RLQSH- 219
                     N Q TS   + L  G+DF +L +D L + L   + FVE++    R+Q H 
Sbjct: 178 GYLYYLLFSDNGQNTSEDRLSLSLGVDFGLLFLDWLQVVLLNCLKFVELFKAGRRVQEHQ 237

Query: 220 --------NSHYDEEFLGLEGKFMYEKLIDMGARXXXXXXXXXXXIPFRMPXXXXXXXXX 271
                   N   D+    LE KF+YEK+++                              
Sbjct: 238 LLDNNELENDIEDDGAFILEEKFIYEKIVETVLEILKILLNIFLITSGIHSFVVFYNIFI 297

Query: 272 XXXSLYQTATSLWKTWKNAKKLDEKLPDVTEEELNQGNNMCIVCMDDMLPNSETRNANLK 331
                 +    L+  WKN ++L EKL DVT   L+  +  C +CMDDMLP+ + +  N K
Sbjct: 298 KSIETCERCVLLFNYWKNNRRLHEKLLDVTAGHLDGVDITCTICMDDMLPSKDVKVNNKK 357

Query: 332 PKKLPCGHILHLSCLKSWMERSQTCPICRLPVF 364
            K LPCGH+LH  CLKSWM+R+QTCPICR PVF
Sbjct: 358 AKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVF 390

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 28/37 (75%)

Query: 488 TIPQSCIEQKEEIESLKRKISEMENKLDALTKRVRTE 524
            IP S +EQ EE+E LKR+ISE+EN +  L KR++T+
Sbjct: 634 VIPTSRLEQTEELERLKRRISELENTVGDLLKRIKTD 670

>AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR062C
          Length = 159

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 29/89 (32%), Positives = 43/89 (48%), Gaps = 16/89 (17%)

Query: 295 EKLPDVTEEELNQGNNMCIVC---MDDMLPNSETRNANLKPKKLP-CGHILHLSCLKSWM 350
           + LP V ++ L +G+N  I C   ++D  P            +LP CGH   L C+  W+
Sbjct: 74  DTLPRVPKKRLAEGDNCAICCCGYLEDEYP---------LVVELPNCGHTFDLQCVSVWL 124

Query: 351 ERSQTCPICRLPVFDERGNVTRMDSSSQE 379
            RS TCP+CR  V   +  +   D S+ E
Sbjct: 125 SRSTTCPMCRSDVLVRKPEI---DGSAAE 150

>SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 751

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 5/57 (8%)

Query: 312 CIVCMDDMLPN----SETRNANLKPKKL-PCGHILHLSCLKSWMERSQTCPICRLPV 363
           C +CM D+        ET   ++    + PCGHI H  CL+SWM     CP+CR P+
Sbjct: 692 CAICMTDVPIYVSDIEETHKVDINSYMVTPCGHIFHTQCLESWMSYKLQCPVCRAPL 748

>KAFR0B03070 Chr2 complement(638210..640141) [1932 bp, 643 aa] {ON}
           Anc_8.317 YDR143C
          Length = 643

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 27/49 (55%)

Query: 332 PKKLPCGHILHLSCLKSWMERSQTCPICRLPVFDERGNVTRMDSSSQEQ 380
           P KLPCGHI    CL  W +   TCP+CR  + +   N   +DSS + Q
Sbjct: 299 PLKLPCGHIFGRECLFKWSKVENTCPLCRHVIIENNQNEANVDSSVEAQ 347

>AFR275W Chr6 (928482..930743) [2262 bp, 753 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YKL034W (TUL1)
          Length = 753

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 5/57 (8%)

Query: 312 CIVCMDDMLPN----SETRNANLKPKKL-PCGHILHLSCLKSWMERSQTCPICRLPV 363
           C +CM ++  +     ET  AN+    + PC H+ H  CL++WM     CP+CR P+
Sbjct: 694 CAICMSELAIHVEDIPETHKANIHDYMVTPCSHLFHTGCLENWMSYKLQCPVCRAPL 750

>TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 40/78 (51%), Gaps = 14/78 (17%)

Query: 298 PDVTEEELNQGNNM-----CIVCMDDM------LPNSETRNANLKPK-KLPCGHILHLSC 345
           P   +E +  G+++     C +CM ++      +P  ET   +L+     PCGH+ H  C
Sbjct: 684 PMSAQELMEHGSSVDHTVDCAICMSEVPVYVEDVP--ETHKVDLQTYMTTPCGHVFHTQC 741

Query: 346 LKSWMERSQTCPICRLPV 363
           L++WM     CP+CR P+
Sbjct: 742 LENWMSYKLQCPVCRSPL 759

>KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 747

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 5/57 (8%)

Query: 312 CIVCMDDMLPNSETRNANLKPKK-----LPCGHILHLSCLKSWMERSQTCPICRLPV 363
           C +CM+D+    +      K  K      PC HI H  CL+SWM     CP+CR P+
Sbjct: 688 CAICMNDVPVYVDDIPKTHKVDKESYMITPCSHIFHTQCLESWMSYKLQCPVCRAPL 744

>Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar to
           Ashbya gossypii AFR275W
          Length = 758

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 7/58 (12%)

Query: 312 CIVCMDDM------LPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICRLPV 363
           C +CM ++      +P +   N N +    PC H+ H  CL++WM     CP+CR P+
Sbjct: 699 CAICMSEVAIYVEDIPETHKTNPN-EYMVTPCAHVFHTECLENWMSYKLQCPVCRAPL 755

>KLTH0G12408g Chr7 (1055265..1057076) [1812 bp, 603 aa] {ON} weakly
           similar to uniprot|P22470 Saccharomyces cerevisiae
           YDR143C SAN1 Ubiquitin-protein ligase controls turnover
           of a specific class of unstable nuclear proteins
           including Sir4p but not Sir2p or Sir3p san1 mutations
           suppress sir4 spt16 and cdc68 mutations suggesting a
           role in chromatin silencing
          Length = 603

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 18/29 (62%)

Query: 332 PKKLPCGHILHLSCLKSWMERSQTCPICR 360
           P KLPCGHI    C++ W     TCPICR
Sbjct: 226 PLKLPCGHIFGRECIRQWTNEHNTCPICR 254

>Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON}
           YDR143C (REAL)
          Length = 634

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 319 MLPNSETRNANLK--PKKLPCGHILHLSCLKSWMERSQTCPICRLPVFDERG 368
           + PN E  N + K  P KLPCGHI    C+  W     +CP+CR  + +  G
Sbjct: 247 LTPNDEETNPSYKHSPIKLPCGHIFGRECIYKWSRLENSCPLCRHKISENAG 298

>YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}
           TUL1Golgi-localized RING-finger ubiquitin ligase (E3),
           involved in ubiquitinating and sorting membrane proteins
           that contain polar transmembrane domains to
           multivesicular bodies for delivery to the vacuole for
           quality control purposes
          Length = 758

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 9/59 (15%)

Query: 312 CIVCMDDM------LPNSETRNANLKPKKL-PCGHILHLSCLKSWMERSQTCPICRLPV 363
           C +CM D+      +P  ET   +     + PC H+ H SCL++WM     CP+CR P+
Sbjct: 699 CAICMSDVPIYIEEIP--ETHKVDQHSYMVTPCNHVFHTSCLENWMNYKLQCPVCRSPL 755

>Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 9/59 (15%)

Query: 312 CIVCMDDM------LPNSETRNANLKPKKL-PCGHILHLSCLKSWMERSQTCPICRLPV 363
           C +CM D+      +P  ET   +     + PC H+ H SCL++WM     CP+CR P+
Sbjct: 699 CAICMSDVPIYIEEIP--ETHKVDQHSYMVTPCNHVFHTSCLENWMSYKLQCPVCRSPL 755

>KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 9/59 (15%)

Query: 312 CIVCMDDM------LPNSETRNANLKPKKL-PCGHILHLSCLKSWMERSQTCPICRLPV 363
           C +CM ++      LP  ET   +     + PC HI H SCL++WM     CP+CR P+
Sbjct: 702 CSICMSEIPVYVEELP--ETHKVDQHSYMVTPCNHIFHTSCLENWMSYKLQCPVCRAPL 758

>KLLA0E04071g Chr5 (369201..371315) [2115 bp, 704 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 704

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 18/32 (56%)

Query: 335 LPCGHILHLSCLKSWMERSQTCPICRLPVFDE 366
           LPCGH+    CL  W     +CPICR P+  E
Sbjct: 217 LPCGHVFGRECLYKWTTEHNSCPICRAPILSE 248

>Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 9/59 (15%)

Query: 312 CIVCMDDM------LPNSETRNANLKPKKL-PCGHILHLSCLKSWMERSQTCPICRLPV 363
           C +CM D+      +P  ET   +     + PC H+ H SCL++WM     CP+CR P+
Sbjct: 699 CTICMSDVPIYIEEIP--ETHKVDQHSYMVTPCDHVFHTSCLENWMSYKLQCPVCRSPL 755

>Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON}
           YDR143C (REAL)
          Length = 612

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 321 PNSETRNANLK--PKKLPCGHILHLSCLKSWMERSQTCPICRLPVFDERG 368
           PN E  N + K  P KLPCGHI    C+  W +   +CP+CR  + +  G
Sbjct: 238 PNDEETNPSYKHSPIKLPCGHIFGRECIYKWSKLENSCPLCRHKISESAG 287

>TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.545
           YKL034W
          Length = 750

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 5/57 (8%)

Query: 312 CIVCMDD----MLPNSETRNANLKPKKL-PCGHILHLSCLKSWMERSQTCPICRLPV 363
           C +CM +    +    ET N +     + PC HI H +CL++WM     CP+CR P+
Sbjct: 691 CTICMSEVPVYIQDIEETHNIDKDTYMITPCNHIFHTTCLENWMSYKLQCPVCRAPL 747

>Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {ON}
           YKL034W (TUL1) -  [contig 55] FULL
          Length = 750

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 29/59 (49%), Gaps = 9/59 (15%)

Query: 312 CIVCMD------DMLPNSETRNANLKPKKL-PCGHILHLSCLKSWMERSQTCPICRLPV 363
           C +CM       D +P  ET   +     + PC HI H  CL+SWM     CP+CR P+
Sbjct: 691 CAICMSEVAVYVDDIP--ETHKVDKDDYMITPCSHIFHTQCLESWMSYKLQCPVCRAPL 747

>TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {ON}
           Anc_2.545 YKL034W
          Length = 757

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 40/78 (51%), Gaps = 14/78 (17%)

Query: 298 PDVTEEELNQGNNM-----CIVCMDDM------LPNSETRNANLKPKKL-PCGHILHLSC 345
           P +++E L  G +      C +CM ++      +P  ET   + +   + PC HI H +C
Sbjct: 679 PVLSQELLEHGASENHTVDCAICMSEVPVYVKDIP--ETHAVDQQSYMVTPCNHIFHTAC 736

Query: 346 LKSWMERSQTCPICRLPV 363
           L++WM     CP+CR P+
Sbjct: 737 LENWMGYKLQCPVCRAPL 754

>NDAI0H00840 Chr8 complement(189570..190595) [1026 bp, 341 aa] {ON}
           Anc_5.628 YDR265W
          Length = 341

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 10/56 (17%)

Query: 312 CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICRLPVFDER 367
           CI+C++DM+           P   PCGHI    CL  W +    CP+CR P   ++
Sbjct: 290 CILCLNDMV----------DPSCSPCGHIFCWRCLMDWCQERAECPLCRQPCLPQQ 335

>NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317
          Length = 570

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 19/32 (59%)

Query: 329 NLKPKKLPCGHILHLSCLKSWMERSQTCPICR 360
           N  P KLPCGHI    CL  W +   TCP+CR
Sbjct: 227 NHSPTKLPCGHIFGRECLYRWCKLENTCPLCR 258

>NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [522
           bp, 173 aa] {ON} Anc_3.279 YBR062C
          Length = 173

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 36/81 (44%), Gaps = 4/81 (4%)

Query: 290 AKKLDEKLPDVTEEELNQGNNMCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSW 349
           +K+  + LP +    +   N  C +C    L +     A L      CGH   L C+  W
Sbjct: 82  SKEFIDSLPRIKANSIKDKNAECAICFCKFLEDKYPLVAELPH----CGHRFDLECISVW 137

Query: 350 MERSQTCPICRLPVFDERGNV 370
           + +S TCP+CR  V   + ++
Sbjct: 138 LSKSDTCPLCRDSVLSHKTDI 158

>Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 bp,
           657 aa] {ON} similar to Ashbya gossypii AGL191W 1-intron
          Length = 657

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 22/37 (59%)

Query: 332 PKKLPCGHILHLSCLKSWMERSQTCPICRLPVFDERG 368
           P +LPCGHI    C+  W +   +CPICR  + ++ G
Sbjct: 276 PTELPCGHIFGRDCIFKWTKEHNSCPICRSRIVEDEG 312

>CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034w
          Length = 757

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 9/59 (15%)

Query: 312 CIVCMDDM------LPNSETRNANLKPKKL-PCGHILHLSCLKSWMERSQTCPICRLPV 363
           C +CM +       LP  ET   +     + PC H+ H SCL+SWM     CP+CR P+
Sbjct: 698 CAICMAEFPVYVEELP--ETHQVDKDSYMITPCDHMFHTSCLESWMSYKLQCPVCRSPL 754

>NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 5/57 (8%)

Query: 312 CIVCMDD----MLPNSETRNANLKPKKL-PCGHILHLSCLKSWMERSQTCPICRLPV 363
           C +CM +    +    ET N +     + PC HI H  CL++WM     CP+CR P+
Sbjct: 702 CAICMSEVPVYIEEAEETHNIDQHSYMVTPCDHIFHTDCLENWMGYKLQCPVCRTPL 758

>TBLA0A09640 Chr1 complement(2375252..2376180,2376263..2376311) [978
           bp, 325 aa] {ON} Anc_5.628 YDR265W
          Length = 325

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 37/76 (48%), Gaps = 19/76 (25%)

Query: 289 NAKKLDEK----LPDVTEEELNQGNNMCIVCMDDMLPNSETRNANLKPKKLPCGHILHLS 344
           N +K+D K    LP + EE     +  CI+CM  M+           P   PCGHI   +
Sbjct: 253 NNEKIDLKNPKILPYIPEE-----SRKCILCMSFMI----------NPSCAPCGHIYCWN 297

Query: 345 CLKSWMERSQTCPICR 360
           CL +W +  + CP+CR
Sbjct: 298 CLINWCKEKEECPLCR 313

>Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa]
           {ON} complement(182540..184546) [2007 nt, 669 aa]
          Length = 668

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 28/63 (44%), Gaps = 5/63 (7%)

Query: 301 TEEELNQGNNMCIVCMDDMLPNSETRNANL---KPKKLPCGHILHLSCLKSWMERSQTCP 357
           TE   NQG         + LPN E  N  +    P +LPC HI    CL  W     TCP
Sbjct: 227 TENGPNQG--TTSTQNSNTLPNQEESNEPVYLESPVELPCHHIFGRECLYKWTRHENTCP 284

Query: 358 ICR 360
           +CR
Sbjct: 285 LCR 287

>KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034W TUL1
           Transmembrane Ubiquitin Ligase
          Length = 757

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 7/67 (10%)

Query: 304 ELNQGNN--MCIVCMDDML----PNSETRNANLKPKKL-PCGHILHLSCLKSWMERSQTC 356
           E    NN  +C +CM D+        ET   + +   + PC HI H  CL++WM     C
Sbjct: 688 EYGSQNNCFVCPICMVDVPVYVEETEETHKIDAQSYMITPCSHIFHTECLENWMSYKLQC 747

Query: 357 PICRLPV 363
           P+CR P+
Sbjct: 748 PVCRAPL 754

>Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034W
           (REAL)
          Length = 759

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 9/59 (15%)

Query: 312 CIVCMDDM------LPNSETRNANLKPKKL-PCGHILHLSCLKSWMERSQTCPICRLPV 363
           C +CM D+      +P  ET   +     + PC H+ H  CL++WM     CP+CR P+
Sbjct: 700 CAICMSDVPIYIEEVP--ETHKVDQHSYMVTPCNHVFHTPCLENWMSYKLQCPVCRSPL 756

>CAGL0E01441g Chr5 (135312..137465) [2154 bp, 717 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143c SAN1 mating-type regulation protein
          Length = 717

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 18/29 (62%)

Query: 332 PKKLPCGHILHLSCLKSWMERSQTCPICR 360
           P K+PCGHI   SCL  W     +CP+CR
Sbjct: 290 PVKIPCGHIFGRSCLYEWTRLENSCPLCR 318

>KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 6/75 (8%)

Query: 295 EKLPDVTEEELNQGNNM-CIVCMDDMLPNSETRNANLKPKKL-----PCGHILHLSCLKS 348
           + L +  +E L + N++ C +CM  +    + +    K  +      PC HI H  CL++
Sbjct: 685 QYLAEHGDESLVETNSVDCSICMSGIPLYVDDKPETHKVDQYSYMVTPCNHIFHTECLEN 744

Query: 349 WMERSQTCPICRLPV 363
           WM     CP+CR P+
Sbjct: 745 WMSYKLQCPVCRTPL 759

>TDEL0A04940 Chr1 (872976..873072,873142..874025) [981 bp, 326 aa]
           {ON} Anc_5.628 YDR265W
          Length = 326

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 10/54 (18%)

Query: 307 QGNNMCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICR 360
           Q +  CI+C+          NA   P   PCGHI    C+ SW +    CP+CR
Sbjct: 271 QASRSCILCL----------NAMTDPSCAPCGHIFCWDCILSWCKERPECPLCR 314

>ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 765

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 336 PCGHILHLSCLKSWMERSQTCPICRLPV 363
           PC HI H  CL++WM     CP+CR P+
Sbjct: 735 PCAHIFHTQCLENWMSYKLQCPVCRSPL 762

>KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459
           bp, 152 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 152

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 39/81 (48%), Gaps = 15/81 (18%)

Query: 295 EKLPDVTEEELNQGNNMCIVC----MDDMLPNSETRNANLKPKKLP-CGHILHLSCLKSW 349
           + LP V + +L +G + C +C    +DD  P            KLP C H   L C+  W
Sbjct: 67  DSLPRVNKCDL-KGADACSICCCGYLDDTHP---------LVVKLPHCSHRFDLECVAVW 116

Query: 350 MERSQTCPICRLPVFDERGNV 370
           + +S+TCP+CR  V   +  V
Sbjct: 117 LSKSRTCPLCRDDVLSHKPKV 137

>NCAS0A11350 Chr1 complement(2249991..2251277) [1287 bp, 428 aa]
           {ON} Anc_3.405 YPR093C
          Length = 428

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 7/56 (12%)

Query: 307 QGNNMCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQT--CPICR 360
           +G+N+C +C DD L +++     LKP    C H  H  C++ W   S    CP+CR
Sbjct: 7   EGDNICPICFDD-LNDTDILQGKLKP----CNHKYHYDCIRRWHGYSDNSDCPLCR 57

>Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {ON}
           YBR062C - Hypothetical ORF [contig 35] FULL
          Length = 104

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 35/80 (43%), Gaps = 13/80 (16%)

Query: 295 EKLPDVTEEELNQGNNMCIVC---MDDMLPNSETRNANLKPKKLP-CGHILHLSCLKSWM 350
           + LP V + +L       I C    DD  P            +LP C H   L C+  W+
Sbjct: 19  DSLPRVEKGKLKDAEACSICCCNYRDDKYP---------LVVELPHCNHRFDLECVAVWL 69

Query: 351 ERSQTCPICRLPVFDERGNV 370
            +S+TCP+CR  V   + NV
Sbjct: 70  SKSRTCPLCRDDVLSHKPNV 89

>Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON}
           (19006..21270) [2265 nt, 755 aa]
          Length = 754

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 9/59 (15%)

Query: 312 CIVCMD------DMLPNSETRNANLKPKKL-PCGHILHLSCLKSWMERSQTCPICRLPV 363
           C +CM       D +P   T   +L    + PC H+ H  CL++WM     CP+CR P+
Sbjct: 695 CAICMSEVPVYVDDVPT--THKVDLDSFMITPCNHVFHTQCLENWMGYKLQCPVCRAPL 751

>KLLA0E16677g Chr5 complement(1481372..1482289) [918 bp, 305 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import interacts
           with Pex12p links ubiquitin-conjugating Pex4p to protein
           import machinery mutations in human homolog cause a
           variety of peroxisomal disorders
          Length = 305

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 15/66 (22%)

Query: 295 EKLPDVTEEELNQGNNMCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQ 354
           E LP + E+     +  C++C++ ML  S T          PCGH+    C+  W    Q
Sbjct: 243 EVLPFIKED-----SRKCVLCLNYMLDPSAT----------PCGHLFCWDCIMEWTLERQ 287

Query: 355 TCPICR 360
            CP+CR
Sbjct: 288 ECPLCR 293

>Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 bp,
           178 aa] {ON} YBR062C (REAL)
          Length = 178

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 36/74 (48%), Gaps = 11/74 (14%)

Query: 297 LPDVTEEELNQGNNMCIVCMDDMLPNSETRNANLKP--KKLP-CGHILHLSCLKSWMERS 353
           LP +  ++LN  +N C +C  + L +         P   +LP C H   L CL  W+ RS
Sbjct: 93  LPRINRKKLNSTDN-CSICYTNYLEDE-------YPLVVELPHCNHRFDLECLSVWLSRS 144

Query: 354 QTCPICRLPVFDER 367
            TCP+CR  V   R
Sbjct: 145 TTCPLCRDDVMGHR 158

>Suva_2.433 Chr2 (765490..766503) [1014 bp, 337 aa] {ON} YDR265W
           (REAL)
          Length = 337

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 31/66 (46%), Gaps = 15/66 (22%)

Query: 295 EKLPDVTEEELNQGNNMCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQ 354
           ++LP + E      +  CI+C+ DM   S T          PCGH+    CL SW +   
Sbjct: 274 DQLPYIPE-----ASRKCILCLMDMTDPSCT----------PCGHLFCWDCLMSWCKERP 318

Query: 355 TCPICR 360
            CP+CR
Sbjct: 319 ECPLCR 324

>AER390W Chr5 (1370316..1370364,1370423..1371324) [951 bp, 316 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDR265W (PEX10); 1-intron
          Length = 316

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 15/66 (22%)

Query: 295 EKLPDVTEEELNQGNNMCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQ 354
           E  P ++E+     +  CI+C+ DM            P  LPCGH+   +C+  W     
Sbjct: 254 EIFPFISEQ-----SRKCILCLADMT----------DPSCLPCGHMFCWACVMQWCNERN 298

Query: 355 TCPICR 360
            CP+CR
Sbjct: 299 ECPLCR 304

>KNAG0G02390 Chr7 complement(548272..550338) [2067 bp, 688 aa] {ON}
           Anc_8.317 YDR143C
          Length = 688

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 17/29 (58%)

Query: 332 PKKLPCGHILHLSCLKSWMERSQTCPICR 360
           P KLPCGHI    C+  W     +CP+CR
Sbjct: 335 PTKLPCGHIFGRDCIFKWSHLENSCPLCR 363

>SAKL0G07370g Chr7 (604332..604383,604452..605365) [966 bp, 321 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import
          Length = 321

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 10/56 (17%)

Query: 305 LNQGNNMCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICR 360
           +N+ +  CI+C+ +M            P   PCGHI   +C+ +W +    CP+CR
Sbjct: 264 INESSRKCILCLTEMK----------DPSCAPCGHIFCWNCIINWCKERSECPLCR 309

>TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.279
           YBR062C
          Length = 144

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 334 KLP-CGHILHLSCLKSWMERSQTCPICRLPVFDERGNV 370
           +LP CGH   L CL  W  +S +CP+CR  V   R  V
Sbjct: 92  RLPHCGHDFDLECLSVWFSKSTSCPLCRDDVLSHRAEV 129

>Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON}
           YDR143C (REAL)
          Length = 624

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 20/37 (54%)

Query: 332 PKKLPCGHILHLSCLKSWMERSQTCPICRLPVFDERG 368
           P +LPCGH+    CL  W     +CP+CR  + +  G
Sbjct: 270 PIRLPCGHVFGRECLYKWSRLENSCPLCRHKISESAG 306

>SAKL0A09526g Chr1 (834338..836326) [1989 bp, 662 aa] {ON} conserved
           hypothetical protein
          Length = 662

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 39/88 (44%), Gaps = 18/88 (20%)

Query: 307 QGNNMCI---------VCMDDMLPNSETRNANLKP--KKLPCGHILHLSCLKSWMERSQT 355
           QGN+ CI         +C D M         +++P     PCGH +H  C   + + S  
Sbjct: 366 QGNHKCIERATMSNCPICGDYMF-------TSVRPVVYMSPCGHAIHQHCFDEYTKHSYK 418

Query: 356 CPICRLPVFDERGNVTRMDSSSQEQQLP 383
           CP C++ V +       +DS  +EQ LP
Sbjct: 419 CPHCQVTVLNMDAQFRVLDSEIEEQPLP 446

>Kpol_526.34 s526 (83624..84610) [987 bp, 328 aa] {ON}
           (83624..84610) [987 nt, 329 aa]
          Length = 328

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 36/77 (46%), Gaps = 14/77 (18%)

Query: 288 KNAKKLDEKLPDVTEEE----LNQGNNMCIVCMDDMLPNSETRNANLKPKKLPCGHILHL 343
           KN    D K  ++++E     + + +  CI+C++ M+           P   PCGHI   
Sbjct: 250 KNTNLKDSKHIELSDESVFKFIPEESRNCILCLNSMV----------DPSAAPCGHIFCW 299

Query: 344 SCLKSWMERSQTCPICR 360
            C+ +W +    CP+CR
Sbjct: 300 DCIINWCKERPECPLCR 316

>NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON} 
          Length = 274

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 39/81 (48%), Gaps = 6/81 (7%)

Query: 295 EKLPDVTEEELNQGNNMCIVCMDDMLPNSETRNANLKPKKLP-CGHILHLSCLKSWMERS 353
           E+LP     EL+  ++ C +C      + ET     +   LP C H  H  C+K W++++
Sbjct: 193 EQLPRTNCAELSNSSDECPICRIAYSDDFET-----EITCLPNCSHHFHFECIKLWLQKN 247

Query: 354 QTCPICRLPVFDERGNVTRMD 374
             CP+CR  V + +   T  D
Sbjct: 248 SLCPLCRDNVMECKAETTEED 268

>YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}
           SAN1Ubiquitin-protein ligase; involved in the
           proteasome-dependent degradation of aberrant nuclear
           proteins; targets substrates with regions of exposed
           hydrophobicity containing 5 or more contiguous
           hydrophobic residues; contains intrinsically disordered
           regions that contribute to substrate recognition
          Length = 610

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 22/41 (53%), Gaps = 2/41 (4%)

Query: 322 NSETRNANLK--PKKLPCGHILHLSCLKSWMERSQTCPICR 360
           N E  N + K  P KLPCGHI    C+  W     +CP+CR
Sbjct: 240 NDEETNPSYKHSPIKLPCGHIFGRECIYKWSRLENSCPLCR 280

>Skud_4.528 Chr4 (941613..942626) [1014 bp, 337 aa] {ON} YDR265W
           (REAL)
          Length = 337

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 10/49 (20%)

Query: 312 CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICR 360
           CI+C+ DM   S T          PCGH+   +CL SW +    CP+CR
Sbjct: 286 CILCLMDMTDPSCT----------PCGHLFCWNCLMSWCKERPECPLCR 324

>Ecym_1328 Chr1 complement(681157..682070,682146..682194) [963 bp,
           320 aa] {ON} similar to Ashbya gossypii AER390W
           1-intron
          Length = 320

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 10/49 (20%)

Query: 312 CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICR 360
           CI+C+ DM+           P  LPCGH+   +C+  W      CP+CR
Sbjct: 270 CILCLVDMV----------DPSCLPCGHLFCWNCIMHWCTERSECPLCR 308

>SAKL0D08272g Chr4 complement(687452..691927) [4476 bp, 1491 aa] {ON}
            similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1491

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/122 (21%), Positives = 51/122 (41%), Gaps = 12/122 (9%)

Query: 335  LPCGHILHLSCLKSWMERSQTCPICRLPVFDERGNVTRMDSSSQEQQLPHNLQRQEAEGE 394
            + CGH    SC+ SW+     CP+C++       N+T + S   + +   + + ++   E
Sbjct: 1177 IKCGHFFCKSCIHSWLRNKNACPLCKMET-----NITEVYSFKLQDE---DRKTEDTSNE 1228

Query: 395  VVQMTTSPFHTTSASVGPTSTTPTQANRSVIMPQVPRVPQDWYAFPIEATQTTKDKVVFK 454
                   P H+   +   ++T      +  I P + ++ Q      I+ +  TK   V K
Sbjct: 1229 SSMGENGPKHSVDKTKIGSATDAVYLYKYQIYPHLDKINQ----LTIKESYGTKIDFVVK 1284

Query: 455  LV 456
            L+
Sbjct: 1285 LI 1286

>Kwal_26.8030 s26 (616729..618711) [1983 bp, 660 aa] {ON} [contig
           55] FULL
          Length = 660

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 38/88 (43%), Gaps = 18/88 (20%)

Query: 307 QGNNMCI---------VCMDDMLPNSETRNANLKP--KKLPCGHILHLSCLKSWMERSQT 355
           QGN+ CI         +C D M         ++KP     PCGH +H  C   + + S  
Sbjct: 372 QGNHRCIERATMSSCPICGDFMF-------TSVKPVVYMSPCGHAIHQHCFDEYTKHSYK 424

Query: 356 CPICRLPVFDERGNVTRMDSSSQEQQLP 383
           CP C++ V +       +D   +EQ LP
Sbjct: 425 CPSCQVSVLNMEAQFRVLDKEIEEQPLP 452

>CAGL0M08690g Chr13 complement(865182..866168) [987 bp, 328 aa] {ON}
           similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265w peroxisomal assembly protein - peroxin
          Length = 328

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 10/49 (20%)

Query: 312 CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICR 360
           CI+C+ +M            P  LPCGH+    C+  W + +  CP+CR
Sbjct: 277 CILCLMEMT----------DPSCLPCGHVFCWDCITDWTKENPECPLCR 315

>YDR265W Chr4 (998864..999877) [1014 bp, 337 aa] {ON}
           PEX10Peroxisomal membrane E3 ubiquitin ligase, required
           for for Ubc4p-dependent Pex5p ubiquitination and
           peroxisomal matrix protein import; contains zinc-binding
           RING domain; mutations in human homolog cause various
           peroxisomal disorders
          Length = 337

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 10/54 (18%)

Query: 307 QGNNMCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICR 360
           + +  CI+C+ +M            P   PCGH+   SCL SW +    CP+CR
Sbjct: 281 EASRKCILCLMNMS----------DPSCAPCGHLFCWSCLMSWCKERPECPLCR 324

>KLTH0D06886g Chr4 (600181..602175) [1995 bp, 664 aa] {ON} conserved
           hypothetical protein
          Length = 664

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 38/88 (43%), Gaps = 18/88 (20%)

Query: 307 QGNNMCI---------VCMDDMLPNSETRNANLKP--KKLPCGHILHLSCLKSWMERSQT 355
           QGN+ CI         +C D M         ++KP     PCGH +H  C   + + S  
Sbjct: 371 QGNHKCIERATMSSCPICGDFMF-------TSVKPVVYMSPCGHAIHQHCFDEYTKHSYK 423

Query: 356 CPICRLPVFDERGNVTRMDSSSQEQQLP 383
           CP C++ + +       +D   +EQ LP
Sbjct: 424 CPSCQVSILNMEAQFRVLDKEIEEQPLP 451

>NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2.545
           YKL034W
          Length = 762

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 16/25 (64%)

Query: 336 PCGHILHLSCLKSWMERSQTCPICR 360
           PC HI H  CL++WM     CP+CR
Sbjct: 732 PCNHIFHTECLENWMGYKLQCPVCR 756

>Kwal_56.23900 s56 complement(764530..766299) [1770 bp, 589 aa] {ON}
           YDR143C (SAN1) - (putative) transcriptional regulator
           [contig 171] FULL
          Length = 589

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 19/37 (51%)

Query: 332 PKKLPCGHILHLSCLKSWMERSQTCPICRLPVFDERG 368
           P +LPC H+    C++ W     TCPICR  +    G
Sbjct: 222 PVQLPCSHVFGRECIRQWTNLHNTCPICRANIVGADG 258

>ZYRO0C11176g Chr3 (866350..866539,866607..867523) [1107 bp, 368 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import,
           interacts with Pex12p, links ubiquitin-conjugating Pex4p
           to protein import machinery; mutations in human homolog
           cause a variety of peroxisomal disorders
          Length = 368

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 10/49 (20%)

Query: 312 CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICR 360
           CI+C+++M            P   PCGH+   +C+ +W +  + CP+CR
Sbjct: 318 CILCLNEMT----------DPSCPPCGHLFCWACIMNWCKEREECPLCR 356

>Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON}
           (60008..60319) [312 nt, 104 aa]
          Length = 103

 Score = 38.5 bits (88), Expect = 0.004,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 14/57 (24%)

Query: 309 NNMCIVC----MDDMLPNSETRNANLKPKKLP-CGHILHLSCLKSWMERSQTCPICR 360
           N+ C +C     DD  P            KLP CGH     CL  W+ +++TCP+CR
Sbjct: 31  NDSCSICCCTYADDKYP---------LISKLPHCGHNFDYECLSIWLSKNKTCPMCR 78

>SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]
           {ON} weakly similar to uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 544

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 22/41 (53%)

Query: 332 PKKLPCGHILHLSCLKSWMERSQTCPICRLPVFDERGNVTR 372
           P +L CGH+    C+  W + + +CPICR  +    G + R
Sbjct: 226 PTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREGLIQR 266

>Smik_4.516 Chr4 (931711..932724) [1014 bp, 337 aa] {ON} YDR265W
           (REAL)
          Length = 337

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 15/66 (22%)

Query: 295 EKLPDVTEEELNQGNNMCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQ 354
           ++LP + E      +  CI+C+ +M            P   PCGH+    CL SW +   
Sbjct: 274 KQLPYIPE-----SSRKCILCLTNMT----------DPSCAPCGHLFCWDCLMSWCKERP 318

Query: 355 TCPICR 360
            CP+CR
Sbjct: 319 ECPLCR 324

>KLLA0F12166g Chr6 complement(1116715..1121301) [4587 bp, 1528 aa]
            {ON} similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1528

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 54/135 (40%), Gaps = 31/135 (22%)

Query: 306  NQGNNMCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICRLPVFD 365
            N  N  C VC  D+   S           L CGH     C+  W +++ +CP+C+     
Sbjct: 1202 NGENISCAVCYSDIYTGS----------ILKCGHFFCKDCVTHWFKKNTSCPMCK----- 1246

Query: 366  ERGNVTRMDSSS------QEQQLPHNLQRQEAEGEVVQMTTSPFHTTSASVGPTSTTPTQ 419
                  RM SS       +E++L     ++E + +  +  T     T++S     TT  +
Sbjct: 1247 -----NRMSSSEVYHFKFREEEL-----KEEDDTDNPEQVTKDDDQTNSSSDGNDTTHEE 1296

Query: 420  ANRSVIMPQVPRVPQ 434
               +VI  +  + P+
Sbjct: 1297 DTEAVITRKYTKFPR 1311

>TBLA0A03900 Chr1 complement(974843..976939) [2097 bp, 698 aa] {ON}
           Anc_8.317 YDR143C
          Length = 698

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 6/51 (11%)

Query: 316 MDDMLPNSETRNANLK------PKKLPCGHILHLSCLKSWMERSQTCPICR 360
           MD  +P S T + N K      P +L C HI   SCL  W +   +CP+CR
Sbjct: 310 MDSTIPTSSTPDENKKHEYHNSPVQLSCKHIFCRSCLYEWSKLKNSCPLCR 360

>CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa]
           {ON} similar to uniprot|P38748 Saccharomyces cerevisiae
           YHL010c
          Length = 586

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 8/53 (15%)

Query: 312 CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICRLPVF 364
           C VC++ M  +SET         +PC H  H  CL  W  ++  CP+CRL  F
Sbjct: 247 CPVCLERM--DSETTGLIT----IPCQHTFHCQCLDKW--KNSKCPVCRLSSF 291

>Kwal_55.19999 s55 (206149..206607) [459 bp, 152 aa] {ON} YDR265W
           (PEX10) - C3HC4 zinc-binding integral peroxisomal
           membrane protein [contig 157] PARTIAL
          Length = 152

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 22/49 (44%), Gaps = 10/49 (20%)

Query: 312 CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICR 360
           CI+C+  ML           P   PCGH+    CL SW      CP+CR
Sbjct: 102 CILCLGFML----------DPSCAPCGHVFCWKCLLSWCNERPECPLCR 140

>TPHA0C00850 Chr3 (177213..179558) [2346 bp, 781 aa] {ON} Anc_8.317
           YDR143C
          Length = 781

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 16/29 (55%)

Query: 332 PKKLPCGHILHLSCLKSWMERSQTCPICR 360
           P +LPC HI    CL  W     TCP+CR
Sbjct: 276 PTELPCKHIFGRECLYKWTRVQNTCPLCR 304

>NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317
          Length = 661

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 17/29 (58%)

Query: 332 PKKLPCGHILHLSCLKSWMERSQTCPICR 360
           P KLPC HI    CL  W +   +CP+CR
Sbjct: 241 PVKLPCDHIFGRECLYKWSKLENSCPLCR 269

>YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, 180
           aa] {ON} Protein of unknown function that interacts with
           Msb2p; may play a role in activation of the filamentous
           growth pathway.
          Length = 180

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 33/71 (46%), Gaps = 5/71 (7%)

Query: 297 LPDVTEEELNQGNNMCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTC 356
           LP + +++L   +N C +C  + L +       L      C H   L CL  W+ RS TC
Sbjct: 95  LPRINKKKLKATDN-CSICYTNYLEDEYPLVVELPH----CHHKFDLECLSVWLSRSTTC 149

Query: 357 PICRLPVFDER 367
           P+CR  V   R
Sbjct: 150 PLCRDNVMGHR 160

>Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 bp,
           150 aa] {ON} YBR062C (REAL)
          Length = 150

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 20/35 (57%), Gaps = 1/35 (2%)

Query: 334 KLP-CGHILHLSCLKSWMERSQTCPICRLPVFDER 367
           +LP C H   L CL  W+ RS TCP+CR  V   R
Sbjct: 96  ELPHCHHKFDLECLSVWLSRSTTCPLCRDDVMGHR 130

>SAKL0C01760g Chr3 complement(149641..154065) [4425 bp, 1474 aa] {ON}
            weakly similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1474

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 11/62 (17%)

Query: 303  EELNQGNNM-CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICRL 361
            EE  +G  + C VC +++   S  +          CGH    SC+ +W++   TCP+C+ 
Sbjct: 1154 EEHKEGEELSCAVCFNEIFVGSVVK----------CGHFFCYSCIHTWLKEHNTCPLCKT 1203

Query: 362  PV 363
             V
Sbjct: 1204 NV 1205

>SAKL0C03586g Chr3 (337347..341771) [4425 bp, 1474 aa] {ON} weakly
            similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1474

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 11/62 (17%)

Query: 303  EELNQGNNM-CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICRL 361
            EE  +G  + C VC +++   S  +          CGH    SC+ +W++   TCP+C+ 
Sbjct: 1154 EEHKEGEELSCAVCFNEIFVGSVVK----------CGHFFCYSCIHTWLKEHNTCPLCKT 1203

Query: 362  PV 363
             V
Sbjct: 1204 NV 1205

>Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}
           YBR062C (REAL)
          Length = 185

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 20/35 (57%), Gaps = 1/35 (2%)

Query: 334 KLP-CGHILHLSCLKSWMERSQTCPICRLPVFDER 367
           +LP C H   L CL  W+ RS TCP+CR  V   R
Sbjct: 131 ELPHCHHKFDLECLSVWLSRSTTCPLCRDDVMGHR 165

>TDEL0A03090 Chr1 (550834..552594) [1761 bp, 586 aa] {ON} 
          Length = 586

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 23/48 (47%)

Query: 336 PCGHILHLSCLKSWMERSQTCPICRLPVFDERGNVTRMDSSSQEQQLP 383
           PCGH +H  C   +   S  CP C++ V +       +D   +EQ LP
Sbjct: 350 PCGHAIHQHCFDEYTRHSYKCPHCQVTVLNMDAQFRVLDKEIEEQPLP 397

>CAGL0K08052g Chr11 complement(800991..801908) [918 bp, 305 aa] {ON}
           weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093c
          Length = 305

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 8/53 (15%)

Query: 311 MCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQ--TCPICRL 361
           +C +C++D+   S T  + LKP    CGH  H  C++ W   ++   CP+CR+
Sbjct: 5   VCAICLEDICGKSST--SYLKP----CGHEYHSDCIRKWHGHAEDLKCPMCRI 51

>CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some
            similarities with uniprot|Q06554 Saccharomyces cerevisiae
            YLR247c
          Length = 1470

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 19/26 (73%)

Query: 337  CGHILHLSCLKSWMERSQTCPICRLP 362
            CGH+   SC+ SW++  +TCP+C+ P
Sbjct: 1179 CGHLFCTSCIFSWLKNRKTCPLCKHP 1204

>Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON}
           similar to Ashbya gossypii ABR104W
          Length = 321

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 11/55 (20%)

Query: 312 CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWME---RSQTCPICRLPV 363
           C +C D M  N          K +PC H  HLSC++ W       +TCP CR+ +
Sbjct: 9   CPICWDSMADNV--------AKLIPCQHEFHLSCIRKWYHSRISDRTCPNCRVEI 55

>Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar to
           Ashbya gossypii AGR034W
          Length = 159

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 4/47 (8%)

Query: 334 KLP-CGHILHLSCLKSWMERSQTCPICRLPVFDERGNVTRMDSSSQE 379
           KLP C H   L C+  W+ +S TCP+CR  V   +   T++D+S  E
Sbjct: 107 KLPNCNHKFDLQCITLWLSKSSTCPMCRNDVMSSK---TKIDTSMVE 150

>ZYRO0D05830g Chr4 (495428..497770) [2343 bp, 780 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 780

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 17/29 (58%)

Query: 332 PKKLPCGHILHLSCLKSWMERSQTCPICR 360
           P +LPC HI    CL  W +   +CP+CR
Sbjct: 298 PVQLPCAHIFGRECLDKWSQIENSCPLCR 326

>CAGL0I04576g Chr9 (408872..409321) [450 bp, 149 aa] {ON} similar to
           uniprot|Q12157 Saccharomyces cerevisiae YDL008w APC11
           subunit of the anaphase promoting complex
          Length = 149

 Score = 37.7 bits (86), Expect = 0.018,   Method: Composition-based stats.
 Identities = 22/84 (26%), Positives = 35/84 (41%), Gaps = 13/84 (15%)

Query: 283 LWKTWKNAKKLDEKLPDVTEEELNQGNNMCIVCMDDM---LPNSETRNANLKPKKLPCGH 339
           +W   KN  +LDE + D  E+       +C +C        PN      +       CGH
Sbjct: 15  VWDIPKNEDRLDESMADEDED-------VCGICRASYHAPCPNCRYPGESCAIVLGRCGH 67

Query: 340 ILHLSCLKSWMERSQT---CPICR 360
             H+ C+  W++   +   CP+CR
Sbjct: 68  NFHVHCISRWVDTPTSKGLCPMCR 91

>KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa]
           {ON} similar to uniprot|P38239 Saccharomyces cerevisiae
           YBR062C Hypothetical ORF
          Length = 140

 Score = 37.7 bits (86), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 39/89 (43%), Gaps = 16/89 (17%)

Query: 295 EKLPDVTEEELNQGNNMCIVC----MDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWM 350
           + LP V   +L +  + C +C    +DD  P        L  K   C H   L CL  W+
Sbjct: 55  DSLPRVPNSKL-KAEDTCAICQCNFLDDPYP--------LVAKVPRCNHKFDLECLSIWL 105

Query: 351 ERSQTCPICRLPVFDERGNVTRMDSSSQE 379
           + + TCP+CR    D R     +D+S  E
Sbjct: 106 QNNHTCPMCR---DDLRSKKVEIDTSQCE 131

>KLTH0E02464g Chr5 (216256..216301,216358..217301) [990 bp, 329 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import interacts
           with Pex12p links ubiquitin-conjugating Pex4p to protein
           import machinery mutations in human homolog cause a
           variety of peroxisomal disorders
          Length = 329

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 10/49 (20%)

Query: 312 CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICR 360
           CI+C+  M+           P   PCGH+    CL +W +    CP+CR
Sbjct: 279 CILCLSLMV----------DPSCAPCGHLFCWDCLLNWSKERPECPLCR 317

>TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {ON}
           Anc_8.317 YDR143C
          Length = 554

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 35/84 (41%), Gaps = 5/84 (5%)

Query: 332 PKKLPCGHILHLSCLKSWMERSQTCPICRLPVFDERGNVTRMDSSSQEQQLPHNLQRQEA 391
           P  LPC H+    CL  W +   +CP+CR  + +     +  DS+          Q  EA
Sbjct: 213 PVVLPCNHVFGRECLFKWSQLENSCPLCRHKIVEAAAGQSGEDSNGAVAN-----QNAEA 267

Query: 392 EGEVVQMTTSPFHTTSASVGPTST 415
              + Q   +P      + GPTST
Sbjct: 268 FERIRQALYNPSAPDQQTEGPTST 291

>KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa]
           {ON} Anc_2.542 YHL010C
          Length = 507

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 36/80 (45%), Gaps = 17/80 (21%)

Query: 294 DEKLPDVTEEELNQ----GNNM-----CIVCMDDMLPNSETRNANLKPKKLPCGHILHLS 344
           DE+LP +  +   Q    G  +     C VC++ M  +SET         +PC H  H  
Sbjct: 144 DERLPYLLTDPFTQLEKPGGRLVELPACPVCLERM--DSETTGL----ITIPCQHTFHCQ 197

Query: 345 CLKSWMERSQTCPICRLPVF 364
           CL  W  ++  CP+CR   F
Sbjct: 198 CLNRW--KNSKCPVCRYSSF 215

>KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.542
           YHL010C
          Length = 560

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 8/53 (15%)

Query: 312 CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICRLPVF 364
           C VC++ M  +SET         +PC H  H  CL  W  ++  CP+CR   F
Sbjct: 241 CPVCLERM--DSETTGL----ITIPCQHTFHCQCLDKW--KNSQCPVCRYSSF 285

>SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, 599
           aa] {ON} some similarities with uniprot|P22470
           Saccharomyces cerevisiae YDR143C SAN1 Ubiquitin-protein
           ligase controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 599

 Score = 38.9 bits (89), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 18/37 (48%)

Query: 332 PKKLPCGHILHLSCLKSWMERSQTCPICRLPVFDERG 368
           P +L CGH     C+  W +   +CPICR  +    G
Sbjct: 242 PTQLKCGHRFGRMCIYQWTKEHNSCPICRAEIVGREG 278

>KNAG0I01380 Chr9 (265230..269711) [4482 bp, 1493 aa] {ON} Anc_1.389
            YLR247C
          Length = 1493

 Score = 38.9 bits (89), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 17/26 (65%)

Query: 335  LPCGHILHLSCLKSWMERSQTCPICR 360
            + CGH     C+ SW++  +TCPIC+
Sbjct: 1190 MKCGHFFCRDCIHSWLKNQRTCPICK 1215

>TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.279
           YBR062C
          Length = 175

 Score = 37.4 bits (85), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 1/28 (3%)

Query: 334 KLP-CGHILHLSCLKSWMERSQTCPICR 360
           +LP CGH     C+  W+ +++TCPICR
Sbjct: 123 QLPHCGHHFDFECISIWLSKNETCPICR 150

>KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {ON}
           Anc_3.279 YBR062C
          Length = 162

 Score = 37.4 bits (85), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 3/47 (6%)

Query: 334 KLP-CGHILHLSCLKSWMERSQTCPICRLPVFDERGNVTRMDSSSQE 379
           +LP CGHI  L C+  W+    TCP+CR  V   +  V  +D+S  E
Sbjct: 109 QLPHCGHIFDLQCISMWLSNQVTCPMCRDVVNGHK--VQDLDTSKAE 153

>Ecym_7253 Chr7 complement(534000..535853) [1854 bp, 617 aa] {ON}
           similar to KLTH0D06886g KLTH0D06886p Lachancea
           thermotolerans
          Length = 617

 Score = 38.1 bits (87), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 34/81 (41%), Gaps = 4/81 (4%)

Query: 307 QGNNMCI--VCMDDMLPNSETRNANLKP--KKLPCGHILHLSCLKSWMERSQTCPICRLP 362
           QGN+ CI    M +     E    ++KP     PCGH +H  C       S  CP C++ 
Sbjct: 355 QGNHRCIERATMSNCPICGEYMFTSVKPVVYMSPCGHAIHQHCFNDHTRHSYKCPQCQVT 414

Query: 363 VFDERGNVTRMDSSSQEQQLP 383
           V +       MD    +Q LP
Sbjct: 415 VVNMEAQFRIMDREVDDQPLP 435

>Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON}
            (207883..212532) [4650 nt, 1550 aa]
          Length = 1549

 Score = 38.5 bits (88), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 12/49 (24%), Positives = 24/49 (48%), Gaps = 10/49 (20%)

Query: 312  CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICR 360
            C +C++ +   S           + CGH     C++SW++   +CP+C+
Sbjct: 1226 CTICLNQIYTGS----------IIKCGHFFCKKCIQSWLKNKNSCPLCK 1264

>NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3.279
           YBR062C
          Length = 118

 Score = 35.8 bits (81), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 334 KLP-CGHILHLSCLKSWMERSQTCPICRLPVFDERGNV 370
           +LP C H   L C+  W+ +S TCP+CR  V + + N+
Sbjct: 66  ELPRCNHRFDLECISVWLSKSVTCPLCRDNVLEHKLNI 103

>NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542
          Length = 625

 Score = 38.1 bits (87), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 24/49 (48%), Gaps = 8/49 (16%)

Query: 312 CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICR 360
           C VC++ M  +SET         +PC H  H SCL  W      CP+CR
Sbjct: 268 CPVCLERM--DSETTGL----ITIPCQHTFHCSCLDKW--NDSRCPVCR 308

>KLTH0G18150g Chr7 complement(1564780..1569444) [4665 bp, 1554 aa]
            {ON} similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1554

 Score = 38.1 bits (87), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 31/67 (46%), Gaps = 10/67 (14%)

Query: 295  EKLPDVTEEELNQGNNMCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQ 354
            E L  + E   N+    C +C+ ++   S           + CGH    SC+ SW++   
Sbjct: 1206 ETLTKLKEGLKNENTFNCTICLGEIYMGS----------VIKCGHFFCQSCIFSWLKNHA 1255

Query: 355  TCPICRL 361
            +CP+C++
Sbjct: 1256 SCPLCKM 1262

>NCAS0A08780 Chr1 (1735117..1739625) [4509 bp, 1502 aa] {ON} Anc_1.389
          Length = 1502

 Score = 38.1 bits (87), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 10/50 (20%)

Query: 312  CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICRL 361
            C +C+ D+   S           L CGH     C+ SW++  + CP+C++
Sbjct: 1191 CSICLQDISLGS----------MLKCGHFFCKRCITSWLKNKKNCPMCKM 1230

>Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 38.1 bits (87), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 8/49 (16%)

Query: 312 CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICR 360
           C VC++ M  +SET         +PC H  H  CL  W  ++  CP+CR
Sbjct: 240 CPVCLERM--DSETSGL----VTIPCQHTFHCQCLNKW--KNSRCPVCR 280

>SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468
           bp, 155 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 155

 Score = 36.2 bits (82), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 35/75 (46%), Gaps = 11/75 (14%)

Query: 295 EKLPDVTEEELNQGNNMCIVCMDDMLPNSETRNANLKP--KKLP-CGHILHLSCLKSWME 351
           + LP +T   L +G+   I C           N +  P   +LP C H   L CL  W+ 
Sbjct: 70  DSLPRITARNLVKGDECSICC--------SKYNEDDYPLVVELPHCSHRFDLECLTPWLL 121

Query: 352 RSQTCPICRLPVFDE 366
           ++ TCP+CR  V ++
Sbjct: 122 KNSTCPLCRDDVMEK 136

>ZYRO0B02046g Chr2 (164680..166017) [1338 bp, 445 aa] {ON} conserved
           hypothetical protein
          Length = 445

 Score = 37.7 bits (86), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 36/86 (41%), Gaps = 14/86 (16%)

Query: 307 QGNNMCI---------VCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCP 357
           QGN+ CI         +C D M   + TR         PCGH +H  C +     S  CP
Sbjct: 206 QGNHKCIEGATMSNCPICGDYMF--TSTRPVVYMS---PCGHAIHQHCFEEHTRHSYKCP 260

Query: 358 ICRLPVFDERGNVTRMDSSSQEQQLP 383
            C++ V +       +D   +EQ LP
Sbjct: 261 HCQVTVLNMDAQFRVLDVEIEEQPLP 286

>ZYRO0E05192g Chr5 (393899..398461) [4563 bp, 1520 aa] {ON} similar to
            uniprot|Q06554 Saccharomyces cerevisiae YLR247C
            Hypothetical ORF
          Length = 1520

 Score = 38.1 bits (87), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 18/26 (69%)

Query: 335  LPCGHILHLSCLKSWMERSQTCPICR 360
            + CGH     C+ SW++ +Q+CP+C+
Sbjct: 1214 IKCGHFFCRKCIHSWLKNNQSCPLCK 1239

>ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR093C
          Length = 328

 Score = 37.4 bits (85), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 20/29 (68%), Gaps = 3/29 (10%)

Query: 335 LPCGHILHLSCLKSWME---RSQTCPICR 360
           +PCGH  HL+C++ W      +++CP+CR
Sbjct: 33  MPCGHEYHLACIRKWFHLHSGNRSCPVCR 61

>TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 bp,
           184 aa] {ON} Anc_3.279 YBR062C
          Length = 184

 Score = 36.6 bits (83), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 23/35 (65%), Gaps = 1/35 (2%)

Query: 334 KLP-CGHILHLSCLKSWMERSQTCPICRLPVFDER 367
           +LP C H   L C+  W++++ +CPICR  V +++
Sbjct: 132 ELPNCKHYFDLECITLWLQKNSSCPICRNDVLEKK 166

>Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 37.7 bits (86), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 8/49 (16%)

Query: 312 CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICR 360
           C VC++ M  +SET         +PC H  H  CL  W  ++  CP+CR
Sbjct: 240 CPVCLERM--DSETTGL----VTIPCQHTFHCQCLNKW--KNSRCPVCR 280

>NCAS0C05290 Chr3 (1076165..1077157) [993 bp, 330 aa] {ON} Anc_5.628
           YDR265W
          Length = 330

 Score = 37.4 bits (85), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 21/49 (42%), Gaps = 10/49 (20%)

Query: 312 CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICR 360
           CI+C+  M            P   PCGHI    C+  W +    CP+CR
Sbjct: 280 CILCLAYMT----------DPSCSPCGHIFCWECILDWCKERPECPLCR 318

>YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}
           ETP1Putative protein of unknown function that is
           required for growth on ethanol; contains a zinc finger
           region and has homology to human BRAP2, which is a
           cytoplasmic protein that binds nuclear localization
           sequences
          Length = 585

 Score = 37.4 bits (85), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 8/49 (16%)

Query: 312 CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICR 360
           C VC++ M  +SET         +PC H  H  CL  W  ++  CP+CR
Sbjct: 240 CPVCLERM--DSETTGL----VTIPCQHTFHCQCLNKW--KNSRCPVCR 280

>Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 37.4 bits (85), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 8/49 (16%)

Query: 312 CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICR 360
           C VC++ M  +SET         +PC H  H  CL  W  ++  CP+CR
Sbjct: 240 CPVCLERM--DSETTGL----VTIPCQHTFHCQCLNKW--KNSRCPVCR 280

>TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.542
           YHL010C
          Length = 674

 Score = 37.4 bits (85), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 15/30 (50%), Gaps = 2/30 (6%)

Query: 335 LPCGHILHLSCLKSWMERSQTCPICRLPVF 364
           +PC H  H  CL  W  ++  CPICR    
Sbjct: 300 IPCQHTFHCQCLNKW--KNSKCPICRFSTL 327

>KNAG0A07430 Chr1 complement(1165740..1166048) [309 bp, 102 aa] {ON}
           Anc_3.405 YPR093C
          Length = 102

 Score = 34.7 bits (78), Expect = 0.096,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 24/55 (43%), Gaps = 12/55 (21%)

Query: 312 CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWME------RSQTCPICR 360
           C +CM+++ P+          + LPC H  H  C++ W        R   CP CR
Sbjct: 10  CPICMEEIGPHEPL------GELLPCHHKFHSDCIRKWHTTTTGEIRRPLCPFCR 58

>KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, 157
           aa] {ON} Anc_3.279 YBR062C
          Length = 157

 Score = 35.8 bits (81), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 43/95 (45%), Gaps = 24/95 (25%)

Query: 295 EKLPDVTEEELNQGNNMCIVCMDDMLPNSETRNANLKPKKLP-------CGHILHLSCLK 347
           + LP V ++++   N++C +C +           N +  + P       C H   L C+ 
Sbjct: 72  DSLPRVPKDKI--PNDLCSICFE-----------NFREDEYPLVIELPHCSHKFDLQCIS 118

Query: 348 SWMERSQTCPICRLPVFDERGNVTRMDSSSQEQQL 382
            W+  + TCP+CR    D+  +  ++D  + E +L
Sbjct: 119 VWLSSNSTCPVCR----DKVNHNAKLDIDTTEAEL 149

>SAKL0G09284g Chr7 (795241..796131) [891 bp, 296 aa] {ON} similar to
           uniprot|Q6Q5S5 Saccharomyces cerevisiae YDR313C PIB1
           RING-type ubiquitin ligase of the endosomal and vacuolar
           membranes binds phosphatidylinositol(3)- phosphate
           contains a FYVE finger domain
          Length = 296

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 28/59 (47%), Gaps = 9/59 (15%)

Query: 296 KLP--DVTEEELNQGNNMCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMER 352
           K+P  D  EEE  Q    C +C ++MLP         K  +L C  + H  C+KSW  +
Sbjct: 220 KIPKGDTLEEESGQNYPECPICFEEMLPGD-------KVGRLECLCVFHYDCIKSWFRK 271

>KAFR0H00560 Chr8 complement(99045..100028) [984 bp, 327 aa] {ON}
           Anc_5.628 YDR265W
          Length = 327

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 22/49 (44%), Gaps = 10/49 (20%)

Query: 312 CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICR 360
           CI+C+  ++           P   PCGH+    C+ +W      CP+CR
Sbjct: 277 CILCLSKIV----------DPSCAPCGHLYCWDCILNWCNEKPECPLCR 315

>Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {ON}
           YDL008W (APC11) - subunit of the anaphase promoting
           complex (APC) [contig 183] FULL
          Length = 135

 Score = 35.0 bits (79), Expect = 0.12,   Method: Composition-based stats.
 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 6/45 (13%)

Query: 337 CGHILHLSCLKSWMERSQT---CPICRLPVFDERG---NVTRMDS 375
           C H  H+ C++ W+E +     CP+CR     +RG   N  +MDS
Sbjct: 62  CNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVAINECQMDS 106

>TDEL0H03370 Chr8 complement(560397..560858) [462 bp, 153 aa] {ON}
           Anc_3.190 YDL008W
          Length = 153

 Score = 35.4 bits (80), Expect = 0.13,   Method: Composition-based stats.
 Identities = 31/134 (23%), Positives = 54/134 (40%), Gaps = 26/134 (19%)

Query: 286 TWKNAKKLDEKLPDVTEEELNQGNNMCIVCMDDMLPNSETRNANLKPKKLP--------- 336
           TW   K+  +   +  ++  N G+++C +C         + NA     K P         
Sbjct: 15  TWHIPKESQDAHAETIDD--NDGDDVCGIC-------RASYNATCPGCKFPGDGCPLVVG 65

Query: 337 -CGHILHLSCLKSWMERSQT---CPICRLPVFDERGNVTRMDSSSQEQQLPHNLQ---RQ 389
            C H  H+ C+  W++ + +   CP+CR   F  +  +   DS   + Q   N Q   RQ
Sbjct: 66  ECNHNFHVHCIYRWLDTATSRGLCPMCR-QTFQLKKGLAINDSQISKFQELRNKQWQTRQ 124

Query: 390 EAEGEVVQMTTSPF 403
           +  G+     T+P 
Sbjct: 125 QEFGDQQDPETNPL 138

>TDEL0D00860 Chr4 (158917..160293) [1377 bp, 458 aa] {ON} Anc_4.332
           YML068W
          Length = 458

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 47/103 (45%), Gaps = 20/103 (19%)

Query: 300 VTEEELNQGNNMCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPIC 359
           +  E++ + N  C +CM       ET+  + K   LPCGH+L L C KS+ +        
Sbjct: 168 IEREKMERSNFDCCICM-------ETKKGS-KMIALPCGHLLCLLCTKSYFK-------- 211

Query: 360 RLPVFDERGNVTRMDSSSQEQQLPHNLQRQEAEGEVVQMTTSP 402
                 E GN+TR+     E Q   +L + ++  E+ ++   P
Sbjct: 212 ---ALIEEGNLTRVRCPECEYQ-ELDLNKLQSYSEIKKVIFEP 250

>TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_1.389
            YLR247C
          Length = 1470

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 17/26 (65%)

Query: 335  LPCGHILHLSCLKSWMERSQTCPICR 360
            + CGH    SC+ SW++   +CP+C+
Sbjct: 1167 IKCGHFFCRSCIHSWLKNHNSCPMCK 1192

>CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483)
           [528 bp, 175 aa] {ON} similar to uniprot|P38239
           Saccharomyces cerevisiae YBR062c
          Length = 175

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 37/69 (53%), Gaps = 11/69 (15%)

Query: 295 EKLPDVTEEELNQGNNMCIVCMDDMLPNSETRNANLKP--KKLP-CGHILHLSCLKSWME 351
           + LP + +++L + ++ C +C  + +       A+  P   +LP CGH     C+  W+ 
Sbjct: 88  DSLPRIPQKKL-KSDDTCPICCSNFI-------ADEYPLVVELPHCGHKFDFECVSMWLT 139

Query: 352 RSQTCPICR 360
           ++ TCP+CR
Sbjct: 140 KNTTCPMCR 148

>ZYRO0C17424g Chr3 complement(1357940..1358761) [822 bp, 273 aa]
           {ON} weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093C ASR1 Protein involved in a putative
           alcohol-responsive signaling pathway accumulates in the
           nucleus under alcohol stress contains a Ring/PHD finger
           domain
          Length = 273

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 7/52 (13%)

Query: 312 CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQ--TCPICRL 361
           C +C+DD   N E+    L+P    C H  H  CL+ W   +    CPICR+
Sbjct: 5   CPICLDDDRTNIES-IGTLQP----CNHKFHRDCLRRWHLYAHDLVCPICRV 51

>TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.542
           YHL010C
          Length = 556

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 335 LPCGHILHLSCLKSWMERSQTCPICR 360
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 258 IPCSHTFHCQCLDKW--KNSKCPVCR 281

>TPHA0I00560 Chr9 (112560..113744) [1185 bp, 394 aa] {ON} Anc_8.808
           YOL054W
          Length = 394

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 24/60 (40%), Gaps = 14/60 (23%)

Query: 311 MCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQT----CPICRLPVFDE 366
           MC +C D M            P    CGH     CLKSW   ++T    CP CR  V  E
Sbjct: 29  MCSICQDYMFV----------PMMTACGHNYCYGCLKSWFTSNETTELSCPQCRSSVGSE 78

>TPHA0C00350 Chr3 complement(58374..59210) [837 bp, 278 aa] {ON}
           Anc_5.628 YDR265W
          Length = 278

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 19/44 (43%), Gaps = 6/44 (13%)

Query: 323 SETRNANL------KPKKLPCGHILHLSCLKSWMERSQTCPICR 360
           SE+R+  L       P   PCGHI    C+  W      CP CR
Sbjct: 223 SESRDCALCLSKITDPSVGPCGHIFCWDCIVDWCRERPECPFCR 266

>ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} similar
           to uniprot|P38748 YHL010C Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 563

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 8/49 (16%)

Query: 312 CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICR 360
           C VC++ M  +S+T         +PC H  H  CL  W  ++  CP+CR
Sbjct: 234 CPVCLERM--DSDTTGL----ITIPCQHTFHCQCLDKW--KNSKCPVCR 274

>NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_1.389
          Length = 1586

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 21/49 (42%), Gaps = 10/49 (20%)

Query: 312  CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICR 360
            C +C+D          A  K   L CGH     C+  W++    CPIC+
Sbjct: 1267 CTICLD----------AITKGCMLKCGHFFCEDCIYDWLQTRTICPICK 1305

>TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON} 
          Length = 260

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 20/46 (43%), Gaps = 7/46 (15%)

Query: 335 LPCGHILHLSCLKSWM-------ERSQTCPICRLPVFDERGNVTRM 373
           +PC H  H  CLK W         R   CP+CR+ +   +    R+
Sbjct: 183 IPCQHYFHAGCLKEWFSPQRRGKRRPLVCPLCRMDIVKCKAFCMRL 228

>AAL030C Chr1 complement(284758..289377) [4620 bp, 1539 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR247C
          Length = 1539

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 35/159 (22%), Positives = 58/159 (36%), Gaps = 30/159 (18%)

Query: 279  TATSLWKTWKNAKKLDEKLPDVTEEELNQGNNM---CIVCMDDMLPNSETRNANLKPKKL 335
            T  S  K  +N  KL++ L D          NM   C +C+ D+   +           +
Sbjct: 1193 TLQSRLKYLQNLTKLEQALKD----------NMRFNCTICLCDICDGA----------II 1232

Query: 336  PCGHILHLSCLKSWMERSQTCPICRLPVFDERGNVTRMDSSSQEQQLPHNLQRQEAEGEV 395
              GH     C+ SW+E  Q+CP+C+     +   +       +E +L H L       + 
Sbjct: 1233 GRGHFYCQECISSWLETKQSCPLCKTQT--KSSELYSFKFREEETELKHVLV-----ADA 1285

Query: 396  VQMTTSPFHTTSASVGPTSTTPTQANRSVIMPQVPRVPQ 434
                T      S +V      P   N+  + P + R+ Q
Sbjct: 1286 DSRPTPSQEVISQAVQSIENDPIYLNKYEVCPYLDRIRQ 1324

>KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28
           YOL133W
          Length = 114

 Score = 33.9 bits (76), Expect = 0.23,   Method: Composition-based stats.
 Identities = 10/26 (38%), Positives = 14/26 (53%)

Query: 337 CGHILHLSCLKSWMERSQTCPICRLP 362
           CGH  HL C+  W++    CP+   P
Sbjct: 81  CGHAFHLHCINKWIKTRDACPLDNQP 106

>Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON}
           complement(21450..23126) [1677 nt, 559 aa]
          Length = 558

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 335 LPCGHILHLSCLKSWMERSQTCPICR 360
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 252 IPCQHTFHCQCLDKW--KNSKCPVCR 275

>TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.542
           YHL010C
          Length = 567

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 8/49 (16%)

Query: 312 CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICR 360
           C VC++ M  +S+T         +PC H  H  CL  W  ++  CP+CR
Sbjct: 234 CPVCLERM--DSDTTGL----ITIPCQHTFHCQCLDKW--KNSRCPVCR 274

>ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519
           bp, 172 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 172

 Score = 34.7 bits (78), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 334 KLP-CGHILHLSCLKSWMERSQTCPICRLPVFDERGNV 370
           +LP C H   L C+  W+ +S +CP+CR  V   +  +
Sbjct: 120 ELPHCNHKFDLECISVWLSKSTSCPLCRDDVMSHKPGI 157

>TPHA0A03340 Chr1 (734754..735908) [1155 bp, 384 aa] {ON} Anc_3.405
           YPR093C
          Length = 384

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 10/53 (18%)

Query: 311 MCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQ--TCPICRL 361
           +C +C+D +    +   A L+P    C H  H+ C+++W   S    CP CR+
Sbjct: 18  ICAICLDAI----DKSIAKLEP----CNHKYHIDCIRTWHNYSNDLNCPTCRI 62

>Kwal_14.1287 s14 (263082..267638) [4557 bp, 1518 aa] {ON} YLR247C -
            Hypothetical ORF [contig 244] FULL
          Length = 1518

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 12/50 (24%), Positives = 24/50 (48%), Gaps = 10/50 (20%)

Query: 312  CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICRL 361
            C +C+ ++   S  +          CGH     C+ SW++   +CP+C++
Sbjct: 1189 CTICLGEIYMGSVIK----------CGHFFCQDCICSWLKNHSSCPLCKM 1228

>NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON}
           Anc_2.542
          Length = 572

 Score = 35.4 bits (80), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 335 LPCGHILHLSCLKSWMERSQTCPICR 360
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 255 IPCQHTFHCQCLDKW--KNSRCPVCR 278

>SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 548

 Score = 35.4 bits (80), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 3/39 (7%)

Query: 335 LPCGHILHLSCLKSWMERSQTCPICRLPVFD-ERGNVTR 372
           +PC H  H  CL  W  +   CP+CR       RGN+ +
Sbjct: 254 IPCQHTFHCQCLDKW--KDSRCPVCRYSNLKLTRGNLLK 290

>KNAG0I02090 Chr9 complement(407893..409176) [1284 bp, 427 aa] {ON}
           Anc_2.157 YHR115C
          Length = 427

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 47/93 (50%), Gaps = 23/93 (24%)

Query: 283 LWKTWKN-----AKKLDEKLPDVTEEELNQGNNMCIVCMDDMLPNSETRNANLKPKKL-- 335
           L  +WK+      K L+E++ ++TE+  ++   +C +C+++           L+ +    
Sbjct: 308 LNDSWKHDPVKFGKVLEERMNNLTEDTRHE---LCSICLEE---------CKLQHRLFFA 355

Query: 336 PCGHILHLSCLKSWMERSQ---TCPICRLPVFD 365
           PC H  H +C++ +M +     TCP CR  +FD
Sbjct: 356 PCSHCWHSACIQPYMNKDVPLFTCPNCRC-IFD 387

>KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON} similar
           to uniprot|Q06834 Saccharomyces cerevisiae YPR093C ASR1
           Protein involved in a putative alcohol- responsive
           signaling pathway accumulates in the nucleus under
           alcohol stress contains a Ring/PHD finger domain
          Length = 304

 Score = 35.0 bits (79), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 9/52 (17%)

Query: 311 MCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQ--TCPICR 360
           +C +C++ M   +ET    L    LPC H  H+SC++ W   S    CP CR
Sbjct: 4   ICGICLESM---NETDQGEL----LPCEHRYHVSCIRKWHLYSNDFKCPTCR 48

>TBLA0B02670 Chr2 (615206..616642) [1437 bp, 478 aa] {ON} Anc_8.808
           YOL054W
          Length = 478

 Score = 35.4 bits (80), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 22/57 (38%), Gaps = 14/57 (24%)

Query: 311 MCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQ----TCPICRLPV 363
           +C +C D M            P   PCGH     CL SW   S     +CP CR  +
Sbjct: 29  VCSICQDYMFV----------PMVTPCGHSFCYGCLCSWFSSSNVDGLSCPHCRTSI 75

>Kpol_480.22 s480 (52842..54119) [1278 bp, 425 aa] {ON}
           (52842..54119) [1278 nt, 426 aa]
          Length = 425

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 24/57 (42%), Gaps = 14/57 (24%)

Query: 311 MCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQT----CPICRLPV 363
           +C +C D M            P  + CGH    SCL SW   ++T    CP CR  V
Sbjct: 35  LCSICHDYMYV----------PMMVACGHNYCYSCLSSWFTSNETQELSCPQCRANV 81

>KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 540

 Score = 35.0 bits (79), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 8/49 (16%)

Query: 312 CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICR 360
           C VC++ +  +SE          +PC H  H  CL  W  +   CP+CR
Sbjct: 247 CPVCLERL--DSEVTGL----ATIPCQHTFHCQCLNKW--KDSRCPVCR 287

>KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1466

 Score = 35.0 bits (79), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 15/26 (57%)

Query: 335  LPCGHILHLSCLKSWMERSQTCPICR 360
            + CGH     C+ SW++    CPIC+
Sbjct: 1164 IKCGHFFCKHCIFSWLKNKSVCPICK 1189

>KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]
           {ON} similar to uniprot|P38748 YHL010C Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 517

 Score = 35.0 bits (79), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 8/50 (16%)

Query: 311 MCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICR 360
           MC VC++ +  +SE           PC H  H  CL  W  ++  CP+CR
Sbjct: 214 MCPVCLEKL--DSEVTGL----VTTPCQHTFHCKCLDQW--KNGNCPVCR 255

>Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {ON}
           [contig 295] FULL
          Length = 275

 Score = 34.7 bits (78), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 27/62 (43%), Gaps = 22/62 (35%)

Query: 300 VTEEELNQGNNMCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMER-SQTCPI 358
           + +E+ N+ NN+C+                     L C H+ H  C+  W+ R S  CP+
Sbjct: 122 ICQEDFNKLNNVCL---------------------LGCNHVFHTYCIDQWICRNSACCPL 160

Query: 359 CR 360
           C+
Sbjct: 161 CK 162

>YPR093C Chr16 complement(719558..720424) [867 bp, 288 aa] {ON}
           ASR1Ubiquitin ligase that modifies and regulates RNA Pol
           II; involved in a putative alcohol-responsive signaling
           pathway; accumulates in the nucleus under alcohol
           stress; contains a Ring/PHD finger domain similar to the
           mammalian rA9 protein
          Length = 288

 Score = 34.7 bits (78), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (66%), Gaps = 2/27 (7%)

Query: 337 CGHILHLSCLKSWMERS--QTCPICRL 361
           CGH  HL+C++ W + S    CPICR+
Sbjct: 23  CGHKFHLNCIREWHKYSINLKCPICRV 49

>CAGL0H07315g Chr8 (715930..716766) [837 bp, 278 aa] {ON} similar to
           uniprot|Q06651 Saccharomyces cerevisiae YDR313c PIB1
          Length = 278

 Score = 34.3 bits (77), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 8/60 (13%)

Query: 296 KLPDVTEEELN-QGNNMCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQ 354
           K+P  T  E   QG   C +C ++M+P         K  +L C  + H SC+KSW  + +
Sbjct: 206 KIPTTTAPENEPQGYQECPICFEEMVPGE-------KVGRLECLCVYHYSCIKSWFRKKR 258

>TBLA0C01330 Chr3 (291659..296017) [4359 bp, 1452 aa] {ON} Anc_1.389
            YLR247C
          Length = 1452

 Score = 35.0 bits (79), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 3/56 (5%)

Query: 335  LPCGHILHLSCLKSWMERS--QTCPICRLPVFDERGNVTRMDSSSQEQQ-LPHNLQ 387
            L CGH     C+ +W+E+S  + CPIC++          + DS++ E   L H +Q
Sbjct: 1150 LKCGHYYCQDCIWNWLEKSKKKNCPICKIETNINDTYNFKFDSTNNEATILNHEIQ 1205

>KLLA0E18503g Chr5 complement(1645113..1647065) [1953 bp, 650 aa]
           {ON} conserved hypothetical protein
          Length = 650

 Score = 34.7 bits (78), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 23/48 (47%)

Query: 336 PCGHILHLSCLKSWMERSQTCPICRLPVFDERGNVTRMDSSSQEQQLP 383
           PCGH +H  C   +++ S  CP C + V +       +    Q+ +LP
Sbjct: 390 PCGHAIHQHCFDEYIKHSYKCPNCNVSVINMEREFRILHQEIQDYRLP 437

>TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON}
            Anc_3.22 YOL138C
          Length = 1310

 Score = 34.7 bits (78), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 10/57 (17%)

Query: 303  EELNQGNNMCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSW-MERSQT-CP 357
            E  N+ N +C+VC   M          L    L CGH  H  C++ W +E   T CP
Sbjct: 1255 ESCNKRNKLCVVCEKPM--------KGLTMSVLQCGHGGHFECMRDWFLEEGMTDCP 1303

>Suva_10.344 Chr10 complement(595952..600634) [4683 bp, 1560 aa] {ON}
            YLR247C (REAL)
          Length = 1560

 Score = 34.7 bits (78), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 39/91 (42%), Gaps = 14/91 (15%)

Query: 335  LPCGHILHLSCLKSWMERSQTCPICRLPVFDERGNVTRMDSSSQEQQLPHNLQRQEAEGE 394
            + CGH    SC+ +W+     CPIC+   F     V          +  +  +++E E +
Sbjct: 1256 IKCGHYFCKSCILTWLRSHSKCPICK--SFCRTSEVYNF-------KFKNTNEKKEKETQ 1306

Query: 395  VVQMTTSPFHTTSASVGPTSTTPTQANRSVI 425
              QM  S      +S G TS + T +N S +
Sbjct: 1307 ESQMDGS-----DSSQGATSGSSTISNVSEV 1332

>AER016C Chr5 complement(659572..660015) [444 bp, 147 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL008W
           (APC11)
          Length = 147

 Score = 33.1 bits (74), Expect = 0.79,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 35/82 (42%), Gaps = 13/82 (15%)

Query: 287 WKNAKKLDEKLPDVTEEELNQGNNMCIVCMDDMLPNSETRNANLKPKKLP-----CGHIL 341
           W   K+L    P V E+E  +  ++C +C      N    N  L  +  P     C H  
Sbjct: 16  WDVPKELKRDSP-VYEDEDEE--DVCGICRGSY--NGTCPNCKLPGETCPLIVGSCHHNF 70

Query: 342 HLSCLKSWMERSQT---CPICR 360
           H+ C+  W+  S +   CP+CR
Sbjct: 71  HVHCIYQWLNTSTSKGLCPMCR 92

>KLTH0F07062g Chr6 (616169..617032) [864 bp, 287 aa] {ON} similar to
           uniprot|Q6Q5S5 Saccharomyces cerevisiae YDR313C PIB1
           RING-type ubiquitin ligase of the endosomal and vacuolar
           membranes binds phosphatidylinositol(3)- phosphate
           contains a FYVE finger domain
          Length = 287

 Score = 33.9 bits (76), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 11/59 (18%)

Query: 294 DEKLPDVTEEELNQGNNMCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMER 352
           D+  PD T    +QG+  C +C ++M P         K  +L C  + H  C+KSW  +
Sbjct: 215 DQDTPDPT----SQGDPECPICFEEMKPGD-------KVGRLECLCVFHYDCIKSWFRK 262

>YLR247C Chr12 complement(628684..633354) [4671 bp, 1556 aa] {ON}
            IRC20Putative helicase; localizes to the mitochondrion
            and the nucleus; YLR247C is not an essential gene; null
            mutant displays increased levels of spontaneous Rad52p
            foci
          Length = 1556

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 15/26 (57%)

Query: 335  LPCGHILHLSCLKSWMERSQTCPICR 360
            + CGH    SC+ +W+     CPIC+
Sbjct: 1252 IKCGHYFCKSCILTWLRAHSKCPICK 1277

>TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1576

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 17/26 (65%)

Query: 335  LPCGHILHLSCLKSWMERSQTCPICR 360
            + CGH    +C+ SW++ +  CP+C+
Sbjct: 1284 ISCGHFFCNNCIFSWLKLNSNCPLCK 1309

>CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highly
            similar to uniprot|Q03897 Saccharomyces cerevisiae
            YDR128w
          Length = 1120

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 4/33 (12%)

Query: 337  CGHILHLSCLKSWMERSQTCPI---CRLP-VFD 365
            C H+LHL C K W   S+ CP    C  P +FD
Sbjct: 1086 CQHVLHLKCSKEWWNVSKECPTGCGCNCPNMFD 1118

>KNAG0J01560 Chr10 (287736..288665) [930 bp, 309 aa] {ON} Anc_5.628
           YDR265W
          Length = 309

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 13/29 (44%)

Query: 332 PKKLPCGHILHLSCLKSWMERSQTCPICR 360
           P   PCGH     CL  W      CP+CR
Sbjct: 268 PSCAPCGHTYCWDCLFKWCNERPECPLCR 296

>Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {ON}
           YHL010C - Hypothetical ORF [contig 55] FULL
          Length = 520

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 8/49 (16%)

Query: 312 CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICR 360
           C VC++ +  +SE          +PC H  H  CL  W +    CP+CR
Sbjct: 227 CPVCLERL--DSEVTGL----ATIPCQHTFHCVCLNKWGD--NRCPVCR 267

>TBLA0B08710 Chr2 complement(2075746..2076114) [369 bp, 122 aa] {ON}
           Anc_3.28 YOL133W
          Length = 122

 Score = 32.0 bits (71), Expect = 1.3,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 23/51 (45%), Gaps = 3/51 (5%)

Query: 312 CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICRLP 362
           CI C    + +++T   +       C H  HL C+  W++  + CP+   P
Sbjct: 67  CIECQPKAMTDTDT---DCVAAWGTCNHAFHLHCINKWIKTREACPLDNQP 114

>NDAI0D02810 Chr4 complement(650919..651677) [759 bp, 252 aa] {ON} 
          Length = 252

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 47/112 (41%), Gaps = 36/112 (32%)

Query: 286 TWKNAKKLDEKLPD------VTEEELNQGNNMCIVCMD--DMLP---------NSETRNA 328
           T K +  +D+K+P        T+++    N  CI+C++   ++P         N   +  
Sbjct: 117 TRKVSIDMDKKIPIDRFVEMSTKDDRIPINECCIICLERVKVVPSTNDLEKQQNGTEQTT 176

Query: 329 NLKPKK---LPCGHILHLSCLKSWME------RSQT----------CPICRL 361
           ++ P K   LPC H  H  C+K W        +S T          CP+CRL
Sbjct: 177 DMIPSKVVKLPCEHYFHKCCIKDWFSTIRKGMKSSTHSFAIGPTYFCPLCRL 228

>KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON}
           conserved hypothetical protein
          Length = 267

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 12/57 (21%)

Query: 312 CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMER-SQTCPICR----LPV 363
           C++C +     +E  N  +    L C HI H  C+  W+ R S  CP+C+    LPV
Sbjct: 110 CVICQEQF---NELNNIRV----LGCSHIFHSHCIDRWICRNSACCPLCKRSYSLPV 159

>KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar to
           uniprot|Q08273 Saccharomyces cerevisiae YOL133W HRT1
           RING finger containing subunit of Skp1-Cullin- F-box
           ubiquitin protein ligases (SCF) required for Gic2p Far1p
           Sic1p and Cln2p degradation may tether Cdc34p (a
           ubiquitin conjugating enzyme or E2) and Cdc53p (a
           cullin) subunits of SCF
          Length = 110

 Score = 31.6 bits (70), Expect = 1.5,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 21/51 (41%), Gaps = 3/51 (5%)

Query: 312 CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICRLP 362
           C+ C  +   NSE        +   C H  HL C+  W++    CP+   P
Sbjct: 55  CVNCQQEATFNSEHECVAAWGE---CNHAFHLHCITQWIKSRNVCPLDNKP 102

>Smik_14.15 Chr14 complement(26568..27572) [1005 bp, 334 aa] {ON}
           YNL316C (REAL)
          Length = 334

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 31/83 (37%), Gaps = 12/83 (14%)

Query: 291 KKLDEKLPDVTEEELNQGNNMCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWM 350
           K L EK P +T                D    SE+ N  ++ +   C  ILHL+      
Sbjct: 149 KSLAEKFPQLT------------FSRSDCSSTSESVNHCMRSQTASCNKILHLAIASEMA 196

Query: 351 ERSQTCPICRLPVFDERGNVTRM 373
            R     I   P+ D+ GN TR 
Sbjct: 197 ARLHNAYIVEHPINDKLGNTTRF 219

>SAKL0B08976g Chr2 complement(766719..767687) [969 bp, 322 aa] {ON}
           weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093C ASR1 Protein involved in a putative
           alcohol-responsive signaling pathway accumulates in the
           nucleus under alcohol stress contains a Ring/PHD finger
           domain
          Length = 322

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 30/69 (43%), Gaps = 13/69 (18%)

Query: 308 GNNMCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQ--TCPICRL---P 362
           G   C +C++ +  N          + + C H  HL C++ W   SQ   CP CR+    
Sbjct: 2   GLATCSICLEALGQNI--------GRLVTCQHEYHLECIREWHNHSQDFKCPTCRVESNK 53

Query: 363 VFDERGNVT 371
           + D   NVT
Sbjct: 54  LLDVENNVT 62

>Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa]
           {ON} YOL133W (HRT1) - subunit of Skp1-Cullin-F-box
           ubiquitin protein ligase (SCF) [contig 124] FULL
          Length = 111

 Score = 31.2 bits (69), Expect = 1.8,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 337 CGHILHLSCLKSWMERSQTCPICRLP 362
           C H  HL C+  W++    CP+   P
Sbjct: 78  CNHAFHLHCINKWLQTRNACPLDNQP 103

>Kwal_56.23543 s56 complement(591514..594411) [2898 bp, 965 aa] {ON}
           YDR103W (STE5) - scaffold protein for MAP kinase cascade
           [contig 176] FULL
          Length = 965

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 41/92 (44%), Gaps = 13/92 (14%)

Query: 312 CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICRL-PVFDERGNV 370
           C +C++ +      R    K   L CGH++H  CL ++ E   +C I  L P   +  N 
Sbjct: 162 CCLCLEYI----SCRTVGEKVVSLECGHLVHEECLMTYFENPTSCHIDELFPFCRQCDNA 217

Query: 371 TRMDSSSQEQQLPHNLQRQEAEGEVVQMTTSP 402
           TR         LP ++Q ++    +  + +SP
Sbjct: 218 TRC--------LPSDIQLRDNCISLALIKSSP 241

>KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa]
           {ON} similar to uniprot|Q12157 Saccharomyces cerevisiae
           YDL008W APC11 Catalytic core subunit of the Anaphase-
           Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin- protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 162

 Score = 32.0 bits (71), Expect = 1.8,   Method: Composition-based stats.
 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 4/37 (10%)

Query: 337 CGHILHLSCLKSWMERSQT---CPICRLPVFDERGNV 370
           C H  H+ C+K W+    +   CP+CR   F  R NV
Sbjct: 87  CNHNFHVHCIKQWLSTETSKGLCPLCRQG-FQLRPNV 122

>YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}
            RTC1Subunit of the SEA (Seh1-associated) complex, a
            coatomer-related complex that associates dynamically with
            the vacuole; null mutation suppresses cdc13-1 temperature
            sensitivity; has N-terminal WD-40 repeats and a
            C-terminal RING motif
          Length = 1341

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 2/25 (8%)

Query: 335  LPCGHILHLSCLKSWM--ERSQTCP 357
            LPCGH  H  C++ W   E  Q CP
Sbjct: 1308 LPCGHEGHFQCIQEWFLDENEQECP 1332

>SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 138

 Score = 31.6 bits (70), Expect = 2.0,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 337 CGHILHLSCLKSWMERSQTCPICRLP 362
           C H  HL C+  W++    CP+   P
Sbjct: 105 CNHAFHLHCINKWLQTRNACPLDNQP 130

>KAFR0C01780 Chr3 complement(363161..363517) [357 bp, 118 aa] {ON}
           Anc_3.28 YOL133W
          Length = 118

 Score = 31.2 bits (69), Expect = 2.0,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 337 CGHILHLSCLKSWMERSQTCPICRLP 362
           C H  HL C+  W++    CP+   P
Sbjct: 85  CNHAFHLHCINKWIKTRDACPLDNQP 110

>Kpol_1014.16 s1014 complement(29615..29938) [324 bp, 107 aa] {ON}
           complement(29615..29938) [324 nt, 108 aa]
          Length = 107

 Score = 31.2 bits (69), Expect = 2.0,   Method: Composition-based stats.
 Identities = 16/52 (30%), Positives = 21/52 (40%), Gaps = 5/52 (9%)

Query: 312 CIVCMDDMLPNSETRNANLKPKKL-PCGHILHLSCLKSWMERSQTCPICRLP 362
           CI C     PN+ T   N        C H  HL C+  W++    CP+   P
Sbjct: 52  CIECQ----PNAMTETDNECVAAWGTCNHAFHLHCINKWIKTRDACPLDNQP 99

>CAGL0E01567g Chr5 (148425..148733) [309 bp, 102 aa] {ON} similar to
           uniprot|Q08273 Saccharomyces cerevisiae YOL133w HRT1
           RING-box protein
          Length = 102

 Score = 30.8 bits (68), Expect = 2.0,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 337 CGHILHLSCLKSWMERSQTCPICRLP 362
           C H  HL C+  W++    CP+   P
Sbjct: 69  CNHAFHLHCINKWIKTRDACPLDNQP 94

>KAFR0F02840 Chr6 complement(564020..565357) [1338 bp, 445 aa] {ON}
           Anc_6.332 YCR066W
          Length = 445

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 9/24 (37%), Positives = 14/24 (58%)

Query: 336 PCGHILHLSCLKSWMERSQTCPIC 359
           PCGH     C++ ++ R   CP+C
Sbjct: 42  PCGHTFCSICIREYINRQSKCPLC 65

>KLTH0F19228g Chr6 complement(1556655..1556987) [333 bp, 110 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 110

 Score = 31.2 bits (69), Expect = 2.2,   Method: Composition-based stats.
 Identities = 8/22 (36%), Positives = 12/22 (54%)

Query: 337 CGHILHLSCLKSWMERSQTCPI 358
           C H  HL C+  W++    CP+
Sbjct: 77  CNHAFHLHCINKWLQTRNACPL 98

>Skud_12.328 Chr12 complement(575254..579927) [4674 bp, 1557 aa] {ON}
            YLR247C (REAL)
          Length = 1557

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 15/26 (57%)

Query: 335  LPCGHILHLSCLKSWMERSQTCPICR 360
            + CGH    +C+ +W+     CPIC+
Sbjct: 1253 IKCGHYFCKNCILTWLRAHNKCPICK 1278

>Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON}
            YOL138C (REAL)
          Length = 1336

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 2/25 (8%)

Query: 335  LPCGHILHLSCLKSWM--ERSQTCP 357
            LPCGH  H  C++ W   E+ + CP
Sbjct: 1303 LPCGHEGHFQCIQEWFLNEKERECP 1327

>SAKL0A06072g Chr1 (551181..552518) [1338 bp, 445 aa] {ON} similar
           to uniprot|P38141 Saccharomyces cerevisiae YBR240C THI2
           Zinc finger protein of the Zn(II)2Cys6 type probable
           transcriptional activator of thiamine biosynthetic genes
          Length = 445

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 35/93 (37%), Gaps = 22/93 (23%)

Query: 360 RLPVFDERGNV------TRMDSSSQEQQLPHNLQRQEAEGEVVQMTTSPF---------- 403
           RL ++D   N        R D    E QL H+L R E + E+    + PF          
Sbjct: 114 RLKIYDNALNCIHGKKCKRYDQKYIEAQLEHHLNRLEGKCELESEKSGPFGYFKVSKPER 173

Query: 404 ------HTTSASVGPTSTTPTQANRSVIMPQVP 430
                  T  +S+   ++  TQ N  V +P  P
Sbjct: 174 KNSGPYETPRSSICEQASVSTQENLHVSLPDTP 206

>KAFR0D04640 Chr4 complement(911653..912561) [909 bp, 302 aa] {ON}
           Anc_5.339 YDR313C
          Length = 302

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 31/72 (43%), Gaps = 19/72 (26%)

Query: 283 LWKTWKNAKKLDEKLPDVTEEELNQGNNMCIVCMDDMLPNSETRNANLKPKKLPCGHILH 342
           ++K  K+  K  E+ P+            C +C ++M+P         K  +L C  + H
Sbjct: 227 VYKVAKDNTKTTEEYPE------------CPICFEEMIPGD-------KVGRLECLCVFH 267

Query: 343 LSCLKSWMERSQ 354
             C+KSW  + Q
Sbjct: 268 YKCIKSWFNKRQ 279

>NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {ON}
            Anc_3.22 YOL138C
          Length = 1393

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 22/51 (43%), Gaps = 10/51 (19%)

Query: 309  NNMCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWM--ERSQTCP 357
            N++C++C        E     L    L CGH  H  C K+W   E   TCP
Sbjct: 1343 NSLCVIC--------ECPMKKLTLTALRCGHEAHFQCFKNWFLDEGMNTCP 1385

>NDAI0I00400 Chr9 complement(80973..82418) [1446 bp, 481 aa] {ON}
           Anc_6.332 YCR066W
          Length = 481

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 16/26 (61%)

Query: 336 PCGHILHLSCLKSWMERSQTCPICRL 361
           PCGH     C++ +++ +  CP+C L
Sbjct: 42  PCGHTFCSVCIREYLQSNSKCPLCLL 67

>Smik_12.320 Chr12 complement(573526..578187) [4662 bp, 1553 aa] {ON}
            YLR247C (REAL)
          Length = 1553

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 15/26 (57%)

Query: 335  LPCGHILHLSCLKSWMERSQTCPICR 360
            + CGH    +C+ +W+     CPIC+
Sbjct: 1249 IKCGHYFCKNCILTWLRAHSKCPICK 1274

>Smik_4.58 Chr4 (112121..112375) [255 bp, 85 aa] {ON} YDL181W (REAL)
          Length = 85

 Score = 30.4 bits (67), Expect = 2.5,   Method: Composition-based stats.
 Identities = 11/23 (47%), Positives = 19/23 (82%)

Query: 497 KEEIESLKRKISEMENKLDALTK 519
           KE++E  ++KI  +ENK+D++TK
Sbjct: 63  KEQLEKQRKKIDSLENKIDSMTK 85

>YDL181W Chr4 (135179..135436) [258 bp, 85 aa] {ON}  INH1Protein
           that inhibits ATP hydrolysis by the F1F0-ATP synthase;
           inhibitory function is enhanced by stabilizing proteins
           Stf1p and Stf2p; has similarity to Stf1p; has a
           calmodulin-binding motif and binds calmodulin in vitro
          Length = 85

 Score = 30.4 bits (67), Expect = 2.5,   Method: Composition-based stats.
 Identities = 11/23 (47%), Positives = 19/23 (82%)

Query: 497 KEEIESLKRKISEMENKLDALTK 519
           KE++E  ++KI  +ENK+D++TK
Sbjct: 63  KEQLEKQRKKIDSLENKIDSMTK 85

>Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON}
            YOL138C (REAL)
          Length = 1332

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 14/25 (56%), Gaps = 2/25 (8%)

Query: 335  LPCGHILHLSCLKSWM--ERSQTCP 357
            LPCGH  H  C++ W   E+   CP
Sbjct: 1299 LPCGHEGHFQCIQEWFLDEKEHECP 1323

>KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3.22
            YOL138C
          Length = 1365

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 25/58 (43%), Gaps = 11/58 (18%)

Query: 309  NNMCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWM--ERSQTCP-ICRLPV 363
            N++C++C + M          +    L CGH  H  C K W   E   +CP  C  P+
Sbjct: 1314 NSLCVLCEEPM--------KKMTISLLACGHEGHFDCFKKWFIQEAMDSCPGGCTHPI 1363

>Skud_15.20 Chr15 (35550..35915) [366 bp, 121 aa] {ON} YOL133W
           (REAL)
          Length = 121

 Score = 31.2 bits (69), Expect = 2.6,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 337 CGHILHLSCLKSWMERSQTCPICRLP 362
           C H  HL C+  W++    CP+   P
Sbjct: 88  CNHAFHLHCINKWIKTRDACPLDNQP 113

>TPHA0P01470 Chr16 complement(301305..301640) [336 bp, 111 aa] {ON}
           Anc_3.28 YOL133W
          Length = 111

 Score = 30.8 bits (68), Expect = 2.7,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 337 CGHILHLSCLKSWMERSQTCPICRLP 362
           C H  HL C+  W++    CP+   P
Sbjct: 78  CNHAFHLHCINKWIKTRDACPLDNQP 103

>Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W
            (REAL)
          Length = 1151

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 4/33 (12%)

Query: 337  CGHILHLSCLKSWMERSQTCPI---CRLP-VFD 365
            C H+LH SC ++W E    CP    C  P +FD
Sbjct: 1118 CQHVLHSSCARTWWEIGDECPSGCGCNCPDMFD 1150

>KAFR0H00710 Chr8 (132097..132783) [687 bp, 228 aa] {ON} Anc_3.405
           YPR093C
          Length = 228

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 8/51 (15%)

Query: 312 CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQ--TCPICR 360
           C +C++D+  N      ++  +  PC H  HL C++ W   S    CP C+
Sbjct: 3   CPICLEDLAAN------DIISELKPCNHKYHLVCIRKWQLDSNQLKCPYCQ 47

>TDEL0A00410 Chr1 complement(70940..74728) [3789 bp, 1262 aa] {ON}
            Anc_3.22 YOL138C
          Length = 1262

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 19/41 (46%), Gaps = 8/41 (19%)

Query: 309  NNMCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSW 349
            N++C++C   M         NL    L CGH  H  CLK W
Sbjct: 1211 NSLCVMCEQPM--------KNLTMTLLECGHEGHFECLKGW 1243

>NCAS0B00990 Chr2 complement(154925..156103) [1179 bp, 392 aa] {ON}
           Anc_8.808 YOL054W
          Length = 392

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 4/38 (10%)

Query: 332 PKKLPCGHILHLSCLKSWM----ERSQTCPICRLPVFD 365
           P    CGH     CLKSW+    ++   CP CR  + D
Sbjct: 40  PMMTSCGHNYCYGCLKSWISTNSKKELACPQCRSDITD 77

>ZYRO0C03058g Chr3 complement(236925..237275) [351 bp, 116 aa] {ON}
           highly similar to uniprot|Q08273 Saccharomyces
           cerevisiae YOL133W HRT1 RING finger containing subunit
           of Skp1-Cullin-F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 116

 Score = 30.8 bits (68), Expect = 3.0,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 337 CGHILHLSCLKSWMERSQTCPICRLP 362
           C H  HL C+  W++    CP+   P
Sbjct: 83  CNHAFHLHCINKWIKTRDACPLDNQP 108

>NCAS0C04480 Chr3 (919123..919452) [330 bp, 109 aa] {ON} Anc_3.28
          Length = 109

 Score = 30.4 bits (67), Expect = 3.1,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 337 CGHILHLSCLKSWMERSQTCPICRLP 362
           C H  HL C+  W++    CP+   P
Sbjct: 76  CNHAFHLHCINKWIKTRDACPLDNQP 101

>TDEL0A00470 Chr1 (82852..83208) [357 bp, 118 aa] {ON} Anc_3.28
           YOL133W
          Length = 118

 Score = 30.8 bits (68), Expect = 3.2,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 337 CGHILHLSCLKSWMERSQTCPICRLP 362
           C H  HL C+  W++    CP+   P
Sbjct: 85  CNHAFHLHCINKWIKTRDACPLDNQP 110

>NDAI0G03860 Chr7 (925672..926043) [372 bp, 123 aa] {ON} Anc_3.28
           YOL133W
          Length = 123

 Score = 30.8 bits (68), Expect = 3.2,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 337 CGHILHLSCLKSWMERSQTCPICRLP 362
           C H  HL C+  W++    CP+   P
Sbjct: 90  CNHAFHLHCINKWIQTRDACPLDNQP 115

>NDAI0E00440 Chr5 (80965..82215) [1251 bp, 416 aa] {ON} Anc_8.808
           YOL054W
          Length = 416

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 20/52 (38%), Gaps = 13/52 (25%)

Query: 312 CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWM---ERSQTCPICR 360
           C +C D M            P   PCGH     CL +W+    +   CP CR
Sbjct: 30  CSICHDYMFV----------PMMTPCGHNFCYGCLNNWITGGSKDLNCPQCR 71

>YOL054W Chr15 (228614..229834) [1221 bp, 406 aa] {ON}  PSH1E3
           ubiquitin ligase that mediates poyubiquitination and
           degradation of centromere-binding protein Cse4p and
           prevents Cse4p from mislocalizing to euchromatin;
           ubiquitylation of Cse4p may be antagonized by Scm3p
          Length = 406

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 22/57 (38%), Gaps = 14/57 (24%)

Query: 311 MCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWM----ERSQTCPICRLPV 363
           +C +C D M            P   PCGH     CL +W     ++   CP CR  +
Sbjct: 29  VCSICHDYMFV----------PMMTPCGHNYCYGCLNTWFASNTQKELACPQCRSDI 75

>TDEL0E02870 Chr5 (548115..548981) [867 bp, 288 aa] {ON} Anc_5.339
           YDR313C
          Length = 288

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 7/41 (17%)

Query: 312 CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMER 352
           C +C +DM+P+        K  +L C  I H  C+KSW  +
Sbjct: 230 CPICFEDMMPSE-------KVGRLECLCIFHYKCIKSWFNK 263

>Kpol_538.5 s538 (7029..8036) [1008 bp, 335 aa] {ON} (7029..8036)
           [1008 nt, 336 aa]
          Length = 335

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 14/27 (51%), Gaps = 2/27 (7%)

Query: 336 PCGHILHLSCLKSWMERSQ--TCPICR 360
           PC H  HL C++ W   +    CP CR
Sbjct: 22  PCHHTFHLECIRIWHSYADDLKCPTCR 48

>Smik_15.113 Chr15 (194228..195448) [1221 bp, 406 aa] {ON} YOL054W
           (REAL)
          Length = 406

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 22/57 (38%), Gaps = 14/57 (24%)

Query: 311 MCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWM----ERSQTCPICRLPV 363
           +C +C D M            P   PCGH     CL +W     ++   CP CR  +
Sbjct: 29  VCSICHDYMFV----------PMMTPCGHNYCYGCLNTWFASNTQKELACPQCRSDI 75

>YOL133W Chr15 (70325..70690) [366 bp, 121 aa] {ON}  HRT1RING finger
           containing subunit of Skp1-Cullin-F-box ubiquitin
           protein ligases (SCF); required for Gic2p, Far1p, Sic1p
           and Cln2p degradation; may tether Cdc34p (a ubiquitin
           conjugating enzyme or E2) and Cdc53p (a cullin) subunits
           of SCF
          Length = 121

 Score = 30.4 bits (67), Expect = 3.7,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 337 CGHILHLSCLKSWMERSQTCPICRLP 362
           C H  HL C+  W++    CP+   P
Sbjct: 88  CNHAFHLHCINKWIKTRDACPLDNQP 113

>Smik_15.20 Chr15 (38383..38748) [366 bp, 121 aa] {ON} YOL133W
           (REAL)
          Length = 121

 Score = 30.4 bits (67), Expect = 3.9,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 337 CGHILHLSCLKSWMERSQTCPICRLP 362
           C H  HL C+  W++    CP+   P
Sbjct: 88  CNHAFHLHCINKWIKTRDACPLDNQP 113

>CAGL0I09988g Chr9 complement(951638..952801) [1164 bp, 387 aa] {ON}
           similar to uniprot|Q12161 Saccharomyces cerevisiae
           YOL054w
          Length = 387

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 32/86 (37%), Gaps = 24/86 (27%)

Query: 283 LWKTWKNAKKLDEKLPDVTEEELNQGNNMCIVCMDDMLPNSETRNANLKPKKLPCGHILH 342
           L ++ K   K+  KL D T         +C +C D M            P    CGH   
Sbjct: 10  LHRSEKTKNKILSKLLDTT---------ICSICHDYMFV----------PMTTECGHSYC 50

Query: 343 LSCLKSWMERSQ-----TCPICRLPV 363
            +CLK+W          +CP CR  V
Sbjct: 51  YTCLKTWFSSDTNRGGLSCPECRAIV 76

>Suva_15.26 Chr15 (48168..48536) [369 bp, 122 aa] {ON} YOL133W
           (REAL)
          Length = 122

 Score = 30.4 bits (67), Expect = 4.0,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 337 CGHILHLSCLKSWMERSQTCPICRLP 362
           C H  HL C+  W++    CP+   P
Sbjct: 89  CNHAFHLHCINKWIKTRDACPLDNQP 114

>SAKL0A01474g Chr1 complement(140890..142296) [1407 bp, 468 aa] {ON}
           similar to gnl|GLV|CAGL0J03586g Candida glabrata
           CAGL0J03586g and weakly similar to YCR066W
           uniprot|P10862 Saccharomyces cerevisiae YCR066W RAD18
           Protein involved in postreplication repair binds
           single-stranded DNA and has single-stranded DNA
           dependent ATPase activity forms heterodimer with Rad6p
           contains RING-finger motif
          Length = 468

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 9/24 (37%), Positives = 14/24 (58%)

Query: 336 PCGHILHLSCLKSWMERSQTCPIC 359
           PCGH     C++ ++ R   CP+C
Sbjct: 58  PCGHTFCSLCIREYLNRELKCPLC 81

>Suva_15.115 Chr15 (200851..202086) [1236 bp, 411 aa] {ON} YOL054W
           (REAL)
          Length = 411

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 22/57 (38%), Gaps = 14/57 (24%)

Query: 311 MCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWM----ERSQTCPICRLPV 363
           +C +C D M            P   PCGH     CL +W     ++   CP CR  +
Sbjct: 29  ICSICHDYMF----------VPMMTPCGHNYCYGCLNTWFSSNTQKELACPQCRSDI 75

>Skud_15.102 Chr15 (187319..188539) [1221 bp, 406 aa] {ON} YOL054W
           (REAL)
          Length = 406

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 22/57 (38%), Gaps = 14/57 (24%)

Query: 311 MCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWM----ERSQTCPICRLPV 363
           +C +C D M            P   PCGH     CL +W     ++   CP CR  +
Sbjct: 29  VCSICHDYMFV----------PMMTPCGHNYCYGCLNTWFASNTQKELACPQCRSDI 75

>Kpol_339.6 s339 complement(10896..11825) [930 bp, 309 aa] {ON}
           complement(10896..11825) [930 nt, 310 aa]
          Length = 309

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 20/39 (51%), Gaps = 7/39 (17%)

Query: 312 CIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWM 350
           C +C +DM+P         K  +L C  + H +C+KSW 
Sbjct: 251 CPICFEDMVPGD-------KVGRLECLCVFHYNCIKSWF 282

>Kpol_1028.46 s1028 complement(110464..110775,110777..111811) [1347
           bp, 448 aa] {ON}
           complement(110464..110775,110777..111811) [1347 nt, 449
           aa]
          Length = 448

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 9/24 (37%), Positives = 14/24 (58%)

Query: 336 PCGHILHLSCLKSWMERSQTCPIC 359
           PCGH     C++S++     CP+C
Sbjct: 43  PCGHTFCSICIRSYVNSESKCPLC 66

>KLTH0A06556g Chr1 (545636..547018) [1383 bp, 460 aa] {ON} similar
           to uniprot|P10862 Saccharomyces cerevisiae YCR066W RAD18
           Protein involved in postreplication repair binds
           single-stranded DNA and has single-stranded DNA
           dependent ATPase activity forms heterodimer with Rad6p
           contains RING-finger motif
          Length = 460

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 9/24 (37%), Positives = 14/24 (58%)

Query: 336 PCGHILHLSCLKSWMERSQTCPIC 359
           PCGH     C++ ++ R   CP+C
Sbjct: 51  PCGHTFCSLCIREYLNRELKCPLC 74

>KLTH0F11044g Chr6 (937668..938543) [876 bp, 291 aa] {ON} weakly
           similar to uniprot|Q06834 Saccharomyces cerevisiae
           YPR093C ASR1 Protein involved in a putative
           alcohol-responsive signaling pathway accumulates in the
           nucleus under alcohol stress contains a Ring/PHD finger
           domain
          Length = 291

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 2/29 (6%)

Query: 335 LPCGHILHLSCLKSWMERSQT--CPICRL 361
           + CGH  H +C++ W   S+   CP CR+
Sbjct: 19  VECGHKYHFNCIRRWHYHSKNLQCPTCRI 47

>Smik_16.333 Chr16 complement(596750..597622) [873 bp, 290 aa] {ON}
           YPR093C (REAL)
          Length = 290

 Score = 31.2 bits (69), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 2/27 (7%)

Query: 337 CGHILHLSCLKSWMERS--QTCPICRL 361
           C H  HL+C++ W + S    CPICR+
Sbjct: 23  CRHQFHLNCIREWHKYSIDLKCPICRI 49

>Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON}
            YOL138C (REAL)
          Length = 1326

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 13/25 (52%), Gaps = 2/25 (8%)

Query: 335  LPCGHILHLSCLKSWM--ERSQTCP 357
            LPCGH  H  C++ W   E    CP
Sbjct: 1293 LPCGHEGHFQCIQEWFLNENEHECP 1317

>KLLA0C08756g Chr3 complement(765847..767130) [1284 bp, 427 aa] {ON}
           similar to uniprot|Q75EN0 Ashbya gossypii AAR049C RAD18
           Postreplication repair ubiquitin-protein ligase E3 RAD18
           and weakly similar to YCR066W uniprot|P10862
           Saccharomyces cerevisiae YCR066W RAD18 Protein involved
           in postreplication repair binds single-stranded DNA and
           has single-stranded DNA dependent ATPase activity forms
           heterodimer with Rad6p contains RING-finger motif
          Length = 427

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 8/24 (33%), Positives = 15/24 (62%)

Query: 336 PCGHILHLSCLKSWMERSQTCPIC 359
           PCGH     C++ ++++   CP+C
Sbjct: 46  PCGHSFCSICIRKYLQKESKCPLC 69

>CAGL0L06336g Chr12 (715056..716858) [1803 bp, 600 aa] {ON} some
           similarities with uniprot|P32917 Saccharomyces
           cerevisiae YDR103w STE5 pheromone signal transduction
           pathway protein
          Length = 600

 Score = 31.2 bits (69), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 5/52 (9%)

Query: 309 NNMCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICR 360
           N++C +C + +      ++   K  +L CGH+ H+ CL  ++  S   PIC+
Sbjct: 37  NHICTLCDEPI----AYKSGGEKVIELECGHMCHMDCLMLFV-NSTALPICK 83

>ZYRO0G13376g Chr7 complement(1066321..1067658) [1338 bp, 445 aa]
           {ON} some similarities with uniprot|Q12161 Saccharomyces
           cerevisiae YOL054W PSH1 Nuclear protein putative RNA
           polymerase II elongation factor isolated as
           Pob3p/Spt16p- binding protein
          Length = 445

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 23/58 (39%), Gaps = 13/58 (22%)

Query: 311 MCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQ---TCPICRLPVFD 365
           +C +C D M            P    CGH     CL SW + +    +CP CR  + D
Sbjct: 29  ICSICHDLMF----------VPVMTQCGHNYCYDCLSSWFDSNSNELSCPQCRASISD 76

>Skud_16.379 Chr16 complement(683736..684602) [867 bp, 288 aa] {ON}
           YPR093C (REAL)
          Length = 288

 Score = 30.8 bits (68), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 2/27 (7%)

Query: 337 CGHILHLSCLKSWMERS--QTCPICRL 361
           C H  HL+C++ W + S    CPICR+
Sbjct: 23  CKHKFHLNCIREWHKYSIDLKCPICRI 49

>KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} similar
            to uniprot|Q92271 Saccharomyces cerevisiae YOL138C
            Hypothetical ORF
          Length = 1321

 Score = 31.2 bits (69), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 20/52 (38%), Gaps = 10/52 (19%)

Query: 309  NNMCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWM--ERSQTCPI 358
            N +C  C   M         +L    L CGH  H  CLK W   E    CP+
Sbjct: 1271 NTLCCFCNKPM--------KSLAISMLNCGHEGHFECLKKWFFDENMDVCPL 1314

>KAFR0B04600 Chr2 complement(956458..957684) [1227 bp, 408 aa] {ON}
           Anc_2.157 YHR115C
          Length = 408

 Score = 30.8 bits (68), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 34/78 (43%), Gaps = 10/78 (12%)

Query: 286 TWKNAKKLDEKLPDVTEEELNQGNNMCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSC 345
           +WK   K  E + +    E +Q   +C +C++ M P      +       PC H+ H +C
Sbjct: 320 SWKLKTKPLEGIINTISLENSQDKELCSICLEKMSPYQGVFVS-------PCCHLWHYNC 372

Query: 346 LKSWMERSQ---TCPICR 360
           ++  + +      CP CR
Sbjct: 373 IRRVITQHYPQFVCPNCR 390

>AGL191W Chr7 (339295..341043) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR143C (SAN1)
          Length = 582

 Score = 30.8 bits (68), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 9/28 (32%), Positives = 14/28 (50%)

Query: 332 PKKLPCGHILHLSCLKSWMERSQTCPIC 359
           P +LPCGH+    C+  W +   +   C
Sbjct: 221 PTELPCGHVFGRDCIFRWTQEHNSLSYC 248

>TBLA0F03280 Chr6 complement(805882..807549) [1668 bp, 555 aa] {ON}
           Anc_3.405 YPR093C
          Length = 555

 Score = 30.8 bits (68), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 337 CGHILHLSCLKSW--MERSQTCPICR 360
           C H  H +C++ W    +S  CP+CR
Sbjct: 22  CQHNFHFNCIRQWHLTSKSLECPVCR 47

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.133    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,539,392
Number of extensions: 2049556
Number of successful extensions: 9452
Number of sequences better than 10.0: 267
Number of HSP's gapped: 9654
Number of HSP's successfully gapped: 278
Length of query: 524
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 410
Effective length of database: 40,409,475
Effective search space: 16567884750
Effective search space used: 16567884750
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)