Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E01562g6.30ON1221226437e-88
Kwal_56.224726.30ON1221225752e-77
TDEL0G043906.30ON1221225724e-77
KLTH0C10934g6.30ON1221225716e-77
ACL005C6.30ON1221225664e-76
KLLA0C06160g6.30ON1211225603e-75
NCAS0D021206.30ON1221225561e-74
Kpol_1037.216.30ON1201205552e-74
ZYRO0C07502g6.30ON1221225543e-74
KAFR0A051106.30ON1221225482e-73
NDAI0C026706.30ON1221225422e-72
Suva_15.1696.30ON1221225413e-72
Skud_15.1576.30ON1221225413e-72
Smik_15.1656.30ON1201205361e-71
YOL005C (RPB11)6.30ON1201205361e-71
CAGL0E02453g6.30ON1201205342e-71
KNAG0F029106.30ON1221205256e-70
TBLA0E031506.30ON1181185231e-69
TPHA0J004106.30ON1201205125e-68
TPHA0B029202.163ON130921183e-08
CAGL0L03872g2.163ON137921141e-07
TDEL0F011802.163ON1291041132e-07
NCAS0G025502.163ON150741114e-07
Kpol_165.22.163ON128921088e-07
YNL113W (RPC19)2.163ON1421021081e-06
KAFR0B045702.163ON131911071e-06
KNAG0I020602.163ON134801062e-06
Smik_14.2142.163ON1421021072e-06
TBLA0B012902.163ON102851033e-06
Suva_14.2252.163ON1421041053e-06
SAKL0E10692g2.163ON1311021044e-06
ZYRO0B09878g2.163ON1301061034e-06
Skud_14.2182.163ON1561041021e-05
Ecym_54232.163ON127901001e-05
AFL220C2.163ON1351011002e-05
KLTH0D09350g2.163ON14671941e-04
KLLA0F23760g2.163ON12788922e-04
NDAI0F027502.163ON14941913e-04
Kwal_26.84732.163ON15071905e-04
Ecym_14394.135ON74145652.0
TDEL0D034003.286ON16198642.0
Smik_6.288.2ON44443642.7
ZYRO0E04246g1.423ON60645633.5
Kpol_1037.32singletonON30370633.6
Kpol_1035.3singletonON113070617.1
TBLA0H00730singletonON28533607.9
NDAI0A031507.264ON93832609.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E01562g
         (122 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E01562g Chr5 (120177..120545) [369 bp, 122 aa] {ON} highly ...   252   7e-88
Kwal_56.22472 s56 (144443..144811) [369 bp, 122 aa] {ON} YOL005C...   226   2e-77
TDEL0G04390 Chr7 complement(794577..794945) [369 bp, 122 aa] {ON...   224   4e-77
KLTH0C10934g Chr3 complement(900683..901051) [369 bp, 122 aa] {O...   224   6e-77
ACL005C Chr3 complement(346569..346937) [369 bp, 122 aa] {ON} Sy...   222   4e-76
KLLA0C06160g Chr3 complement(543239..543604) [366 bp, 121 aa] {O...   220   3e-75
NCAS0D02120 Chr4 complement(393640..394008) [369 bp, 122 aa] {ON...   218   1e-74
Kpol_1037.21 s1037 complement(44216..44578) [363 bp, 120 aa] {ON...   218   2e-74
ZYRO0C07502g Chr3 complement(567967..568335) [369 bp, 122 aa] {O...   218   3e-74
KAFR0A05110 Chr1 complement(1014087..1014455) [369 bp, 122 aa] {...   215   2e-73
NDAI0C02670 Chr3 (621282..621650) [369 bp, 122 aa] {ON} Anc_6.30...   213   2e-72
Suva_15.169 Chr15 complement(289702..290070) [369 bp, 122 aa] {O...   213   3e-72
Skud_15.157 Chr15 complement(275429..275797) [369 bp, 122 aa] {O...   213   3e-72
Smik_15.165 Chr15 complement(283099..283461) [363 bp, 120 aa] {O...   211   1e-71
YOL005C Chr15 complement(315813..316175) [363 bp, 120 aa] {ON}  ...   211   1e-71
CAGL0E02453g Chr5 complement(233352..233714) [363 bp, 120 aa] {O...   210   2e-71
KNAG0F02910 Chr6 complement(551617..551985) [369 bp, 122 aa] {ON...   206   6e-70
TBLA0E03150 Chr5 complement(788457..788813) [357 bp, 118 aa] {ON...   206   1e-69
TPHA0J00410 Chr10 (95837..96199) [363 bp, 120 aa] {ON} Anc_6.30 ...   201   5e-68
TPHA0B02920 Chr2 (666060..666452) [393 bp, 130 aa] {ON} Anc_2.16...    50   3e-08
CAGL0L03872g Chr12 complement(447274..447687) [414 bp, 137 aa] {...    49   1e-07
TDEL0F01180 Chr6 (211106..211495) [390 bp, 129 aa] {ON} Anc_2.16...    48   2e-07
NCAS0G02550 Chr7 (456827..457279) [453 bp, 150 aa] {ON} Anc_2.16...    47   4e-07
Kpol_165.2 s165 complement(2511..2897) [387 bp, 128 aa] {ON} com...    46   8e-07
YNL113W Chr14 (412771..413199) [429 bp, 142 aa] {ON}  RPC19RNA p...    46   1e-06
KAFR0B04570 Chr2 complement(949880..950275) [396 bp, 131 aa] {ON...    46   1e-06
KNAG0I02060 Chr9 complement(401412..401816) [405 bp, 134 aa] {ON...    45   2e-06
Smik_14.214 Chr14 (392413..392841) [429 bp, 142 aa] {ON} YNL113W...    46   2e-06
TBLA0B01290 Chr2 (274238..274546) [309 bp, 102 aa] {ON} Anc_2.16...    44   3e-06
Suva_14.225 Chr14 (409562..409990) [429 bp, 142 aa] {ON} YNL113W...    45   3e-06
SAKL0E10692g Chr5 complement(891637..892032) [396 bp, 131 aa] {O...    45   4e-06
ZYRO0B09878g Chr2 complement(771644..772036) [393 bp, 130 aa] {O...    44   4e-06
Skud_14.218 Chr14 (402879..403349) [471 bp, 156 aa] {ON} YNL113W...    44   1e-05
Ecym_5423 Chr5 complement(871715..872098) [384 bp, 127 aa] {ON} ...    43   1e-05
AFL220C Chr6 complement(25281..25688) [408 bp, 135 aa] {ON} Synt...    43   2e-05
KLTH0D09350g Chr4 complement(776115..776555) [441 bp, 146 aa] {O...    41   1e-04
KLLA0F23760g Chr6 complement(2218555..2218938) [384 bp, 127 aa] ...    40   2e-04
NDAI0F02750 Chr6 complement(673843..674292) [450 bp, 149 aa] {ON...    40   3e-04
Kwal_26.8473 s26 complement(800017..800469) [453 bp, 150 aa] {ON...    39   5e-04
Ecym_1439 Chr1 complement(910930..913155) [2226 bp, 741 aa] {ON}...    30   2.0  
TDEL0D03400 Chr4 (632541..633026) [486 bp, 161 aa] {ON} Anc_3.286      29   2.0  
Smik_6.28 Chr6 complement(54289..55623) [1335 bp, 444 aa] {ON} Y...    29   2.7  
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    29   3.5  
Kpol_1037.32 s1037 (77327..78238) [912 bp, 303 aa] {ON} (77327.....    29   3.6  
Kpol_1035.3 s1035 complement(5707..9099) [3393 bp, 1130 aa] {ON}...    28   7.1  
TBLA0H00730 Chr8 complement(163394..164251) [858 bp, 285 aa] {ON}      28   7.9  
NDAI0A03150 Chr1 (709990..712806) [2817 bp, 938 aa] {ON} Anc_7.264     28   9.2  

>SAKL0E01562g Chr5 (120177..120545) [369 bp, 122 aa] {ON} highly
           similar to uniprot|P38902 Saccharomyces cerevisiae
           YOL005C
          Length = 122

 Score =  252 bits (643), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 122/122 (100%), Positives = 122/122 (100%)

Query: 1   MNAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAA 60
           MNAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNFETEWSLQTLASEENY 120
           YKVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNFETEWSLQTLASEENY
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNFETEWSLQTLASEENY 120

Query: 121 GL 122
           GL
Sbjct: 121 GL 122

>Kwal_56.22472 s56 (144443..144811) [369 bp, 122 aa] {ON} YOL005C
           (RPB11) - RNA polymerase II subunit, homologous to S.
           pombe Rpb11p subunit [contig 185] FULL
          Length = 122

 Score =  226 bits (575), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 106/122 (86%), Positives = 115/122 (94%)

Query: 1   MNAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAA 60
           MNAPDRFELFLLPEGE+KL I+PDTKAPNAVI+TFEKEDHTL NLIRAELLED+ VLFAA
Sbjct: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNFETEWSLQTLASEENY 120
           YKVEHPLFA+FKMRIQT EGYDPKDALKNACN II+KL QLQSNFETEW+LQTLASE+NY
Sbjct: 61  YKVEHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120

Query: 121 GL 122
            +
Sbjct: 121 AM 122

>TDEL0G04390 Chr7 complement(794577..794945) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  224 bits (572), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 106/122 (86%), Positives = 115/122 (94%)

Query: 1   MNAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAA 60
           MNAPDRFELFLL EGESKL IEPDTKAPNAV+ITFEKEDHTLGNLIR+ELL D +VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNFETEWSLQTLASEENY 120
           YKVEHPLFARFKMRIQTVEGYDPKDALKNACN II KLA L++NFETEW+LQTLAS++NY
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNFETEWNLQTLASDDNY 120

Query: 121 GL 122
           G+
Sbjct: 121 GI 122

>KLTH0C10934g Chr3 complement(900683..901051) [369 bp, 122 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 122

 Score =  224 bits (571), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 115/122 (94%)

Query: 1   MNAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAA 60
           MNAPDRFELFLLPEGE+KL I+PDTKAPNAVI+TFEKEDHTL NLIR ELLED+ VLFAA
Sbjct: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRGELLEDKGVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNFETEWSLQTLASEENY 120
           YKVEHPLFA+FK+RIQTVEGYDPKDALKNACN II+KL QLQSNFETEW+LQTLASE+NY
Sbjct: 61  YKVEHPLFAQFKLRIQTVEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120

Query: 121 GL 122
            +
Sbjct: 121 AM 122

>ACL005C Chr3 complement(346569..346937) [369 bp, 122 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL005C
           (RPB11)
          Length = 122

 Score =  222 bits (566), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 106/122 (86%), Positives = 115/122 (94%)

Query: 1   MNAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAA 60
           MNAPDRFELFLLPEGESKL IEPDTKA NAVIITFEKEDHTLGN+IRAELLED+RVLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNFETEWSLQTLASEENY 120
           YKVEHPLFARF+MRIQT EGYDPK+ALKNACN+II KLA L+SNFETEW+LQTLASE+ +
Sbjct: 61  YKVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNFETEWNLQTLASEDQF 120

Query: 121 GL 122
            L
Sbjct: 121 RL 122

>KLLA0C06160g Chr3 complement(543239..543604) [366 bp, 121 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 121

 Score =  220 bits (560), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 116/122 (95%), Gaps = 1/122 (0%)

Query: 1   MNAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAA 60
           MNAPDRFELFLLPEGESKL +E DTKA +A+I+TFEKEDHTLGNLIRAELLED+ VLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNFETEWSLQTLASEENY 120
           YKVEHPLFA+FKMRIQTVEGYDPKDALKNACN+II KLAQLQSNFETEW+LQTLA+ E+Y
Sbjct: 61  YKVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNFETEWNLQTLAT-EDY 119

Query: 121 GL 122
           G+
Sbjct: 120 GM 121

>NCAS0D02120 Chr4 complement(393640..394008) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  218 bits (556), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 102/122 (83%), Positives = 113/122 (92%)

Query: 1   MNAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAA 60
           MNAPDRFELFLL EGESKL I+PDTKAPNAV+ITFEKEDHTLGNLIR+ELL D RVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNFETEWSLQTLASEENY 120
           YKVEHP FARFK+RIQTVEGYDPKDALKNACN+II+KL  L+ NFETEW+LQTLA++EN 
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNFETEWNLQTLAADENM 120

Query: 121 GL 122
           G+
Sbjct: 121 GI 122

>Kpol_1037.21 s1037 complement(44216..44578) [363 bp, 120 aa] {ON}
           complement(44216..44578) [363 nt, 121 aa]
          Length = 120

 Score =  218 bits (555), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 103/120 (85%), Positives = 113/120 (94%)

Query: 1   MNAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAA 60
           MNAPD+FELFLL EGESKLNIEPDTKAPNAV+ITFEKEDHTLGNLIR+ELL D +VLFAA
Sbjct: 1   MNAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNFETEWSLQTLASEENY 120
           YKVEHPLFARFK+RIQTVE YDPKDALKNACNNII KL  L++NFETEW+LQTLAS+EN+
Sbjct: 61  YKVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120

>ZYRO0C07502g Chr3 complement(567967..568335) [369 bp, 122 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 122

 Score =  218 bits (554), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 100/122 (81%), Positives = 114/122 (93%)

Query: 1   MNAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAA 60
           MNAPDRFELFLL EGESKL ++PDTKAPNA+++TFEKEDHTLGNLIRAELL D +VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNFETEWSLQTLASEENY 120
           YKVEHPLFARFKMRIQT+EGYDPKDALKNACN II KL  L++NFETEW+LQTLAS++N+
Sbjct: 61  YKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNFETEWNLQTLASDDNF 120

Query: 121 GL 122
           G+
Sbjct: 121 GI 122

>KAFR0A05110 Chr1 complement(1014087..1014455) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  215 bits (548), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 114/122 (93%)

Query: 1   MNAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAA 60
           MNAPDRFELFLL EGESKL I+PDTK+PNAV+ITFEKEDHTLGNLIRAELL D +VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNFETEWSLQTLASEENY 120
           YKVEHP FARFK+R+QT+EGYDPK+ALKNACN+II KL  L++NFETEW+LQTLAS+EN+
Sbjct: 61  YKVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNFETEWNLQTLASDENF 120

Query: 121 GL 122
           G+
Sbjct: 121 GI 122

>NDAI0C02670 Chr3 (621282..621650) [369 bp, 122 aa] {ON} Anc_6.30
           YOL005C
          Length = 122

 Score =  213 bits (542), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 100/122 (81%), Positives = 112/122 (91%)

Query: 1   MNAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAA 60
           MNAPDRFELFLL EGESKL I+PDTKAPNAV+ITF+KEDHTLGNLIR+ELL D +VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNFETEWSLQTLASEENY 120
           YKVEHP FA FK+RIQTVEGYDPK ALKNACNNII KL  L++NFETEW+LQTLAS+EN+
Sbjct: 61  YKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120

Query: 121 GL 122
           G+
Sbjct: 121 GI 122

>Suva_15.169 Chr15 complement(289702..290070) [369 bp, 122 aa] {ON}
           YOL005C (REAL)
          Length = 122

 Score =  213 bits (541), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 112/122 (91%)

Query: 1   MNAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAA 60
           MNAPDRFELFLL EGESKL IEPDTKAPNAV+ITFEKEDHTLGNLIRAELL D++VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNFETEWSLQTLASEENY 120
           YKVEHP FARFK+RIQT EGYDPKDALKNACN+II KL  L++NFETEW+LQTLA+++ +
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120

Query: 121 GL 122
            +
Sbjct: 121 NM 122

>Skud_15.157 Chr15 complement(275429..275797) [369 bp, 122 aa] {ON}
           YOL005C (REAL)
          Length = 122

 Score =  213 bits (541), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 112/122 (91%)

Query: 1   MNAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAA 60
           MNAPDRFELFLL EGESKL IEPDTKAPNAV+ITFEKEDHTLGNLIRAELL D++VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNFETEWSLQTLASEENY 120
           YKVEHP FARFK+RIQT EGYDPKDALKNACN+II KL  L++NFETEW+LQTLA+++ +
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120

Query: 121 GL 122
            +
Sbjct: 121 NM 122

>Smik_15.165 Chr15 complement(283099..283461) [363 bp, 120 aa] {ON}
           YOL005C (REAL)
          Length = 120

 Score =  211 bits (536), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 98/120 (81%), Positives = 111/120 (92%)

Query: 1   MNAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAA 60
           MNAPDRFELFLL EGESKL I+PDTKAPNAV+ITFEKEDHTLGNLIRAELL D++VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNFETEWSLQTLASEENY 120
           YKVEHP FARFK+RIQT EGYDPKDALKNACN+II KL  L++NFETEW+LQTLA+++ +
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLATDDAF 120

>YOL005C Chr15 complement(315813..316175) [363 bp, 120 aa] {ON}
           RPB11RNA polymerase II subunit B12.5; part of central
           core; similar to Rpc19p and bacterial alpha subunit
          Length = 120

 Score =  211 bits (536), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 98/120 (81%), Positives = 111/120 (92%)

Query: 1   MNAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAA 60
           MNAPDRFELFLL EGESKL I+PDTKAPNAV+ITFEKEDHTLGNLIRAELL D++VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNFETEWSLQTLASEENY 120
           YKVEHP FARFK+RIQT EGYDPKDALKNACN+II KL  L++NFETEW+LQTLA+++ +
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120

>CAGL0E02453g Chr5 complement(233352..233714) [363 bp, 120 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005c RPB11 DNA-directed RNA polymerase II
          Length = 120

 Score =  210 bits (534), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 98/120 (81%), Positives = 111/120 (92%)

Query: 1   MNAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAA 60
           MNAPDRFELFLL EGESKL I+PDTKAPNAV+ITFEKEDHTLGNLIRAELL D +VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDNKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNFETEWSLQTLASEENY 120
           YKVEHP FARFK+RIQTVEGYDPKDAL+NAC++II KL  L+SNFETEW+LQTLA+++ +
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALRNACSSIINKLGALKSNFETEWNLQTLAADDAF 120

>KNAG0F02910 Chr6 complement(551617..551985) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  206 bits (525), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 109/120 (90%)

Query: 1   MNAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAA 60
           MNAPDRFELFLL +GESKL I+PDTK+PNA++ITF KEDHTLGNLIRAELL D +VLFAA
Sbjct: 1   MNAPDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNFETEWSLQTLASEENY 120
           YKVEHP FARFK+RIQTVEGYDPKDALKNACN II KL  L++NFETEW+LQTLA+++ +
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNFETEWNLQTLATDDTF 120

>TBLA0E03150 Chr5 complement(788457..788813) [357 bp, 118 aa] {ON}
           Anc_6.30 YOL005C
          Length = 118

 Score =  206 bits (523), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 108/118 (91%)

Query: 1   MNAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAA 60
           MNAPDRFE FLL EGESKL IEPDTKAPN V+ITFEKEDHTLGNLI++ELL D +VLFAA
Sbjct: 1   MNAPDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNFETEWSLQTLASEE 118
           YKVEHPLFARFKMRIQTVEGYDPKDAL+ ACN+II KL  L++NFETEW+LQTLAS++
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNFETEWNLQTLASDD 118

>TPHA0J00410 Chr10 (95837..96199) [363 bp, 120 aa] {ON} Anc_6.30
           YOL005C
          Length = 120

 Score =  201 bits (512), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 108/120 (90%)

Query: 1   MNAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAA 60
           MNAPDRFELFLL EG+SKL IE DTKA NAV+ITFEKEDHTLGNLIR ELL D++VLFAA
Sbjct: 1   MNAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAA 60

Query: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNFETEWSLQTLASEENY 120
           YKVEHPLFARFK+RIQT E YDPKDALK ACNNII KL  L++NF+TEW+LQTLAS++N+
Sbjct: 61  YKVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNFDTEWNLQTLASDDNF 120

>TPHA0B02920 Chr2 (666060..666452) [393 bp, 130 aa] {ON} Anc_2.163
           YNL113W
          Length = 130

 Score = 50.1 bits (118), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 47/92 (51%), Gaps = 2/92 (2%)

Query: 16  ESKLNIEPDTKAPNAVIITFE--KEDHTLGNLIRAELLEDQRVLFAAYKVEHPLFARFKM 73
           E K+ I P+  +P+    +F+  +EDHTLGN +R  ++++  V F  Y + HP      +
Sbjct: 32  EDKIKILPNATSPDGTSASFQISEEDHTLGNALRHIIMKNPEVEFCGYSIPHPSETLLNL 91

Query: 74  RIQTVEGYDPKDALKNACNNIITKLAQLQSNF 105
           RIQT       +AL+    +++     ++  F
Sbjct: 92  RIQTYGNTTAVEALQKGLKDLMDMCDVVEEKF 123

>CAGL0L03872g Chr12 complement(447274..447687) [414 bp, 137 aa] {ON}
           similar to uniprot|P28000 Saccharomyces cerevisiae
           YNL113w RPC19 DNA-directed RNA polymerase I III
          Length = 137

 Score = 48.5 bits (114), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 47/92 (51%), Gaps = 2/92 (2%)

Query: 16  ESKLNIEPDTKAPNAVIITFE--KEDHTLGNLIRAELLEDQRVLFAAYKVEHPLFARFKM 73
           ++K+ + P   + +    +F+  +EDHTLGN +R  ++++  V F  Y + HP      +
Sbjct: 40  KTKIKLLPQATSEDGTCASFQIAQEDHTLGNALRYIIMKNPEVEFCGYSIPHPSEELLNL 99

Query: 74  RIQTVEGYDPKDALKNACNNIITKLAQLQSNF 105
           RIQT       DAL+   +++I     ++  F
Sbjct: 100 RIQTYGNITAVDALQKGLDDLIDLCDAVKDKF 131

>TDEL0F01180 Chr6 (211106..211495) [390 bp, 129 aa] {ON} Anc_2.163
           YNL113W
          Length = 129

 Score = 48.1 bits (113), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 50/104 (48%), Gaps = 12/104 (11%)

Query: 4   PDRFELFLLPEGESKLNIEPDTKAPNAVIITFE--KEDHTLGNLIRAELLEDQRVLFAAY 61
           PDR ++ LLP+  S+          +    +F+  +EDHTLGN +R  +++++ V F  Y
Sbjct: 29  PDREKIKLLPQASSE----------DGTCASFQIAEEDHTLGNALRYVIMKNKDVEFCGY 78

Query: 62  KVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNF 105
            + HP      +RIQT       D L+    +++     ++  F
Sbjct: 79  SIPHPSENLLNLRIQTYGATTAVDVLQKGLTDLMDLCDAVEDRF 122

>NCAS0G02550 Chr7 (456827..457279) [453 bp, 150 aa] {ON} Anc_2.163
           YNL113W
          Length = 150

 Score = 47.4 bits (111), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 40/74 (54%), Gaps = 8/74 (10%)

Query: 4   PDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAAYKV 63
           PDR ++ +LPEG S    E  T A   ++     EDHTLGN +R  ++++  V F  Y +
Sbjct: 50  PDREKVKILPEGAS----EDGTCASFQIV----DEDHTLGNALRYIIMKNPNVEFCGYSI 101

Query: 64  EHPLFARFKMRIQT 77
            HP      +RIQT
Sbjct: 102 PHPSENFLNVRIQT 115

>Kpol_165.2 s165 complement(2511..2897) [387 bp, 128 aa] {ON}
           complement(2511..2897) [387 nt, 129 aa]
          Length = 128

 Score = 46.2 bits (108), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 44/92 (47%), Gaps = 2/92 (2%)

Query: 16  ESKLNIEPDTKAPNAVIITFE--KEDHTLGNLIRAELLEDQRVLFAAYKVEHPLFARFKM 73
           E K+ I P   + +    +F+   EDHTLGN +R  ++++  V F  Y + HP      +
Sbjct: 30  EDKIKILPQATSEDGTCASFQIMDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSENLLNL 89

Query: 74  RIQTVEGYDPKDALKNACNNIITKLAQLQSNF 105
           RIQT       +AL+    +++     ++  F
Sbjct: 90  RIQTYGSTTAVEALQKGLGDLMDMCDVVEEKF 121

>YNL113W Chr14 (412771..413199) [429 bp, 142 aa] {ON}  RPC19RNA
           polymerase subunit AC19, common to RNA polymerases I and
           III
          Length = 142

 Score = 46.2 bits (108), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 50/102 (49%), Gaps = 8/102 (7%)

Query: 4   PDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAAYKV 63
           PDR ++ LL +  S    E  T A   ++    +EDHTLGN +R  ++++  V F  Y +
Sbjct: 42  PDREKIKLLTQATS----EDGTSASFQIV----EEDHTLGNALRYVIMKNPDVEFCGYSI 93

Query: 64  EHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNF 105
            HP      +RIQT       DAL+    +++     ++S F
Sbjct: 94  PHPSENLLNIRIQTYGETTAVDALQKGLKDLMDLCDVVESKF 135

>KAFR0B04570 Chr2 complement(949880..950275) [396 bp, 131 aa] {ON}
           Anc_2.163 YNL113W
          Length = 131

 Score = 45.8 bits (107), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 46/91 (50%), Gaps = 2/91 (2%)

Query: 17  SKLNIEPDTKAPNAVIITFE--KEDHTLGNLIRAELLEDQRVLFAAYKVEHPLFARFKMR 74
           +K+ I P   + +    +F+  +EDHTLGN +R  ++++ +V F  Y + HP      +R
Sbjct: 34  NKIKILPQATSEDGTSASFQIVEEDHTLGNALRYIIMKNPQVEFCGYSIPHPSENLLNIR 93

Query: 75  IQTVEGYDPKDALKNACNNIITKLAQLQSNF 105
           IQT       DALK    +++     ++  F
Sbjct: 94  IQTYGEITAVDALKKGLADLMDLCDVVEETF 124

>KNAG0I02060 Chr9 complement(401412..401816) [405 bp, 134 aa] {ON}
           Anc_2.163 YNL113W
          Length = 134

 Score = 45.4 bits (106), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 39/80 (48%), Gaps = 2/80 (2%)

Query: 18  KLNIEPDTKAPNAVIITFE--KEDHTLGNLIRAELLEDQRVLFAAYKVEHPLFARFKMRI 75
           K+ I P+    +    +F+   EDHTLGN +R  ++++  V F  Y + HP      +RI
Sbjct: 38  KVKILPEATTEDGTCASFQILNEDHTLGNALRYVIMKNPEVEFCGYSIPHPSENWLNVRI 97

Query: 76  QTVEGYDPKDALKNACNNII 95
           QT       DA K    +++
Sbjct: 98  QTYGKITAVDAFKKGLGDLM 117

>Smik_14.214 Chr14 (392413..392841) [429 bp, 142 aa] {ON} YNL113W
           (REAL)
          Length = 142

 Score = 45.8 bits (107), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 50/102 (49%), Gaps = 8/102 (7%)

Query: 4   PDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAAYKV 63
           PDR ++ LL +  S    E  T A   ++    +EDHTLGN +R  ++++  V F  Y +
Sbjct: 42  PDREKIKLLTQATS----EDGTSASFQIV----EEDHTLGNALRYIIMKNPDVEFCGYSI 93

Query: 64  EHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNF 105
            HP      +RIQT       DAL+    +++     ++S F
Sbjct: 94  PHPSENLLNIRIQTYGESTAVDALQKGLKDLMDLCDVVESKF 135

>TBLA0B01290 Chr2 (274238..274546) [309 bp, 102 aa] {ON} Anc_2.163
           YNL113W
          Length = 102

 Score = 44.3 bits (103), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 37/85 (43%)

Query: 21  IEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAAYKVEHPLFARFKMRIQTVEG 80
           + P T   +A       EDHTLGN +R  L+ +  V F  Y + HP      +R+QT   
Sbjct: 11  LPPVTPDGSAASFQIRDEDHTLGNALRYLLMRNPAVEFCGYSIPHPSEPFLNLRVQTYGD 70

Query: 81  YDPKDALKNACNNIITKLAQLQSNF 105
               DAL     +++     ++  F
Sbjct: 71  ITASDALAQGLQDLMDLCDVVEDTF 95

>Suva_14.225 Chr14 (409562..409990) [429 bp, 142 aa] {ON} YNL113W
           (REAL)
          Length = 142

 Score = 45.1 bits (105), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 51/104 (49%), Gaps = 8/104 (7%)

Query: 2   NAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAAY 61
           + PDR ++ LL +  S    E  T A   ++    +EDHTLGN +R  ++++  V F  Y
Sbjct: 40  DEPDREKIKLLTQATS----EDGTSASFQIV----EEDHTLGNALRYIIMKNPEVEFCGY 91

Query: 62  KVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNF 105
            + HP      +RIQT       +AL+    +++     ++S F
Sbjct: 92  SIPHPSENLLNVRIQTYGAITAVEALQKGLKDLMDLCDVVESKF 135

>SAKL0E10692g Chr5 complement(891637..892032) [396 bp, 131 aa] {ON}
           highly similar to uniprot|P28000 Saccharomyces
           cerevisiae YNL113W RPC19 RNA polymerase subunit common
           to RNA polymerases I and III
          Length = 131

 Score = 44.7 bits (104), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 48/102 (47%), Gaps = 8/102 (7%)

Query: 4   PDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAAYKV 63
           PDR ++ LLP+  S    +  T A         +EDHTLGN +R  ++++  V F  Y +
Sbjct: 31  PDREKIKLLPQATS----DDGTSAS----FQISEEDHTLGNALRYIIMKNPEVEFCGYSI 82

Query: 64  EHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNF 105
            HP      +RIQT       +AL+    +++     ++  F
Sbjct: 83  PHPSENLLNVRIQTYGKITAVEALQKGLQDLMDMCDAVEDKF 124

>ZYRO0B09878g Chr2 complement(771644..772036) [393 bp, 130 aa] {ON}
           highly similar to uniprot|Q755Q7 Ashbya gossypii AFL220C
           AFL220Cp and similar to YNL113W uniprot|P28000
           Saccharomyces cerevisiae YNL113W RPC19 RNA polymerase
           subunit common to RNA polymerases I and III
          Length = 130

 Score = 44.3 bits (103), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 49/106 (46%), Gaps = 12/106 (11%)

Query: 2   NAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFE--KEDHTLGNLIRAELLEDQRVLFA 59
           + PDR ++ +LP+  S+          +    +F+  +EDHTLGN +R  ++++  V F 
Sbjct: 28  DEPDREKIKILPQATSE----------DGTCASFQIAEEDHTLGNALRYMIMKNPDVEFC 77

Query: 60  AYKVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNF 105
            Y + HP      +R+QT       D L     +++     ++  F
Sbjct: 78  GYSIPHPSENLLNIRVQTYGNVTAVDVLHKGLQDLMDLCDAVEDKF 123

>Skud_14.218 Chr14 (402879..403349) [471 bp, 156 aa] {ON} YNL113W
           (REAL)
          Length = 156

 Score = 43.9 bits (102), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 51/104 (49%), Gaps = 8/104 (7%)

Query: 2   NAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAAY 61
           + PDR ++ LL +  S    E  T A   ++    +EDHTLGN +R  ++++  V F  Y
Sbjct: 54  DEPDREKIKLLTQATS----EDGTNASFQIV----EEDHTLGNALRYIIMKNPDVEFCGY 105

Query: 62  KVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNF 105
            + HP      +RIQT       DAL+    +++     +++ F
Sbjct: 106 SIPHPSENLLNIRIQTYGEITAVDALQKGLKDLMDLCDVVEAKF 149

>Ecym_5423 Chr5 complement(871715..872098) [384 bp, 127 aa] {ON}
           similar to Ashbya gossypii AFL220C
          Length = 127

 Score = 43.1 bits (100), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 43/90 (47%), Gaps = 2/90 (2%)

Query: 18  KLNIEPDTKAPNAVIITFE--KEDHTLGNLIRAELLEDQRVLFAAYKVEHPLFARFKMRI 75
           K+ + P+  + +    +F+   EDHTLGN +R  ++++  V F  Y + HP      +RI
Sbjct: 31  KIRLLPEAASEDGTCASFQISDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSETVLNLRI 90

Query: 76  QTVEGYDPKDALKNACNNIITKLAQLQSNF 105
           QT       +AL     +++     ++  F
Sbjct: 91  QTYGKMTAVEALHKGLKDLMDLCDVVEDKF 120

>AFL220C Chr6 complement(25281..25688) [408 bp, 135 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL113W
           (RPC19)
          Length = 135

 Score = 43.1 bits (100), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 43/101 (42%), Gaps = 8/101 (7%)

Query: 5   DRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAAYKVE 64
           DR ++ LLP+  S+                   EDHTLGN +R  ++++  V F  Y + 
Sbjct: 36  DRDKIRLLPQATSEDG--------TCAFFQITDEDHTLGNALRYIIMKNPEVEFCGYSIP 87

Query: 65  HPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNF 105
           HP      +RIQT       DAL     +++     ++  F
Sbjct: 88  HPSENFLNIRIQTYGKVTAVDALHKGLQDLMDMCDVVEDKF 128

>KLTH0D09350g Chr4 complement(776115..776555) [441 bp, 146 aa] {ON}
           some similarities with uniprot|P28000 Saccharomyces
           cerevisiae YNL113W RPC19 RNA polymerase subunit common
           to RNA polymerases I and III
          Length = 146

 Score = 40.8 bits (94), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 35/71 (49%)

Query: 35  FEKEDHTLGNLIRAELLEDQRVLFAAYKVEHPLFARFKMRIQTVEGYDPKDALKNACNNI 94
             +EDHTLGN +R  ++++  V F  Y + HP      +RIQT   +   + L+    ++
Sbjct: 69  ISEEDHTLGNALRYIIMKNPDVEFCGYSIPHPSETLLNLRIQTYGKFTAVEVLQKGLQDL 128

Query: 95  ITKLAQLQSNF 105
           +     ++  F
Sbjct: 129 MDLCDAVEDKF 139

>KLLA0F23760g Chr6 complement(2218555..2218938) [384 bp, 127 aa]
           {ON} similar to uniprot|P28000 Saccharomyces cerevisiae
           YNL113W RPC19 RNA polymerase subunit common to RNA
           polymerases I and III
          Length = 127

 Score = 40.0 bits (92), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 39/88 (44%)

Query: 18  KLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAAYKVEHPLFARFKMRIQT 77
           KL  E  ++   +       EDHTLGN +R  ++++  V F  Y + HP      +RIQT
Sbjct: 33  KLLTEATSEDGTSASFRITDEDHTLGNTLRYMIMKNPEVEFCGYSIPHPSENFLHIRIQT 92

Query: 78  VEGYDPKDALKNACNNIITKLAQLQSNF 105
                  +AL     +++     ++  F
Sbjct: 93  YGKITAVEALHKGLGDLMDMCDAVEDRF 120

>NDAI0F02750 Chr6 complement(673843..674292) [450 bp, 149 aa] {ON}
           Anc_2.163 YNL113W
          Length = 149

 Score = 39.7 bits (91), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 26/41 (63%)

Query: 37  KEDHTLGNLIRAELLEDQRVLFAAYKVEHPLFARFKMRIQT 77
           +EDHTLGN +R  ++++ +V F  Y + HP      +RIQT
Sbjct: 74  QEDHTLGNALRYIIMKNPQVEFCGYSIPHPSEEFLNIRIQT 114

>Kwal_26.8473 s26 complement(800017..800469) [453 bp, 150 aa] {ON}
           YNL113W (RPC19) - subunit common to RNA polymerases I
           (A) and III (C) [contig 61] FULL
          Length = 150

 Score = 39.3 bits (90), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 35/71 (49%)

Query: 35  FEKEDHTLGNLIRAELLEDQRVLFAAYKVEHPLFARFKMRIQTVEGYDPKDALKNACNNI 94
             +EDHTLGN +R  ++++  V F  Y + HP      +RIQT   +   + L+    ++
Sbjct: 73  ISEEDHTLGNSLRYIIMKNPDVEFCGYSIPHPSENLLNLRIQTYGKHTALEVLQKGLQDL 132

Query: 95  ITKLAQLQSNF 105
           +     ++  F
Sbjct: 133 MDLCDAVEDKF 143

>Ecym_1439 Chr1 complement(910930..913155) [2226 bp, 741 aa] {ON}
           similar to Ashbya gossypii AFR495C
          Length = 741

 Score = 29.6 bits (65), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 8/45 (17%)

Query: 18  KLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAAYK 62
           +LNIEP T     ++  FEK        +R E+LE QRV  + +K
Sbjct: 395 QLNIEPSTTQSVDLVEKFEK--------LRKEILESQRVALSEFK 431

>TDEL0D03400 Chr4 (632541..633026) [486 bp, 161 aa] {ON} Anc_3.286
          Length = 161

 Score = 29.3 bits (64), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 37/98 (37%), Gaps = 22/98 (22%)

Query: 16  ESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAAYKVEHPLFARFKMRI 75
            S L   P+T+ PN + ++   E+     LI +               + PL   F MR 
Sbjct: 29  SSGLGKGPETREPNQMFLSIRNENEMTDTLIASS--------------KTPLIMNFTMRN 74

Query: 76  QTVEGYDPKDALKNACNNIITKLAQLQSN---FETEWS 110
                  P D L  A N I+T     + N    ET+WS
Sbjct: 75  NA-----PCDKLTGALNRIVTLETDKKVNVVDVETDWS 107

>Smik_6.28 Chr6 complement(54289..55623) [1335 bp, 444 aa] {ON}
           YFL048C (REAL)
          Length = 444

 Score = 29.3 bits (64), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 25/43 (58%), Gaps = 5/43 (11%)

Query: 24  DTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAAYKVEHP 66
           D+  P+ + +T++ ED+   NL++ ++  D RV F   KV  P
Sbjct: 184 DSSVPSTIRVTYDMEDN---NLLKVQV--DNRVCFQTRKVRFP 221

>ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {ON}
           similar to uniprot|P25333 Saccharomyces cerevisiae
           YCR008W
          Length = 606

 Score = 28.9 bits (63), Expect = 3.5,   Method: Composition-based stats.
 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 1/45 (2%)

Query: 55  RVLFAAYKVEHPLFARFKMRIQTVEGYDPKDALKNA-CNNIITKL 98
           R L+   + E P FA++  + +   G++P + LK A C N+I  +
Sbjct: 529 RQLWKVAQKEDPFFAKYLRKRKEKGGFEPIENLKRARCRNVIYSM 573

>Kpol_1037.32 s1037 (77327..78238) [912 bp, 303 aa] {ON}
           (77327..78238) [912 nt, 304 aa]
          Length = 303

 Score = 28.9 bits (63), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 5/70 (7%)

Query: 14  EGESKLNIEPDTKAPNAVIITFEKEDHTLGN---LIRAELLEDQRVLFAAYKVEHPLFAR 70
           E  S  N EP T+APN+   T    D+ + N   L  ++LLE Q++L        P+F++
Sbjct: 179 ETSSTTNPEPSTEAPNSDNTT--DPDYVIDNVNSLTLSQLLEIQKLLADKISSIPPIFSK 236

Query: 71  FKMRIQTVEG 80
              R     G
Sbjct: 237 IIDRFYYTSG 246

>Kpol_1035.3 s1035 complement(5707..9099) [3393 bp, 1130 aa] {ON}
           complement(5707..9099) [3393 nt, 1131 aa]
          Length = 1130

 Score = 28.1 bits (61), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 5/70 (7%)

Query: 14  EGESKLNIEPDTKAPNAVIITFEKEDHTLGN---LIRAELLEDQRVLFAAYKVEHPLFAR 70
           E  S  N EP T+APN+   T    D+ + N   L  ++LLE Q++L        P+F++
Sbjct: 672 ETSSTTNPEPSTEAPNSDNTT--DPDYVIDNVNSLTLSQLLEIQKLLADKISSIPPIFSK 729

Query: 71  FKMRIQTVEG 80
              R     G
Sbjct: 730 IIDRFYYTSG 739

>TBLA0H00730 Chr8 complement(163394..164251) [858 bp, 285 aa] {ON} 
          Length = 285

 Score = 27.7 bits (60), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 19/33 (57%)

Query: 11  LLPEGESKLNIEPDTKAPNAVIITFEKEDHTLG 43
           L P+G+ +L  +    A  AV+   + +DHTLG
Sbjct: 187 LKPDGQYRLTTDASKSAVGAVLEEIDDKDHTLG 219

>NDAI0A03150 Chr1 (709990..712806) [2817 bp, 938 aa] {ON} Anc_7.264
          Length = 938

 Score = 27.7 bits (60), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 19/32 (59%)

Query: 85  DALKNACNNIITKLAQLQSNFETEWSLQTLAS 116
           D++  ACN II KL+  Q     ++++  LAS
Sbjct: 193 DSISTACNGIIIKLSNYQEANNIKYNISILAS 224

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,741,915
Number of extensions: 463353
Number of successful extensions: 1304
Number of sequences better than 10.0: 53
Number of HSP's gapped: 1302
Number of HSP's successfully gapped: 53
Length of query: 122
Length of database: 53,481,399
Length adjustment: 91
Effective length of query: 31
Effective length of database: 43,046,793
Effective search space: 1334450583
Effective search space used: 1334450583
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)