Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E01540g6.29ON1415141562190.0
ACL004W6.29ON1377103934680.0
Ecym_30336.29ON147491632510.0
Kwal_56.224626.29ON154190631160.0
ZYRO0C07524g6.29ON1670100031090.0
TDEL0G044006.29ON149099330940.0
KLTH0C10956g6.29ON143397130720.0
KLLA0C06182g6.29ON151989630340.0
Kpol_1037.226.29ON1496100730150.0
NCAS0D021306.29ON1434106830150.0
TPHA0J004006.29ON151286529230.0
KAFR0A051206.29ON147994128320.0
YOL004W (SIN3)6.29ON153691428210.0
Smik_15.1666.29ON156691828160.0
Suva_15.1716.29ON156191828030.0
Skud_15.1586.29ON155589127980.0
TBLA0E031606.29ON173992227440.0
CAGL0E02475g6.29ON149391627260.0
KNAG0F029206.29ON149283326940.0
NDAI0C026606.29ON165784926870.0
CAGL0J11594g6.29ON9373676324e-67
KAFR0D033402.504ON9757712.1
KNAG0E004607.57ON1365141764.0
Suva_12.1221.466ON77689746.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E01540g
         (1415 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] ...  2400   0.0  
ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic h...  1340   0.0  
Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON} ...  1256   0.0  
Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] ...  1204   0.0  
ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} simil...  1202   0.0  
TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6....  1196   0.0  
KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} simil...  1187   0.0  
KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} simil...  1173   0.0  
Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON} (46639...  1165   0.0  
NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6....  1165   0.0  
TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {O...  1130   0.0  
KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_...  1095   0.0  
YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Comp...  1091   0.0  
Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL00...  1089   0.0  
Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL00...  1084   0.0  
Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL00...  1082   0.0  
TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6....  1061   0.0  
CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} simil...  1054   0.0  
KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6....  1042   0.0  
NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {...  1039   0.0  
CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa...   248   4e-67
KAFR0D03340 Chr4 (656834..656869,656954..657211) [294 bp, 97 aa]...    32   2.1  
KNAG0E00460 Chr5 complement(77112..81209) [4098 bp, 1365 aa] {ON...    34   4.0  
Suva_12.122 Chr12 (181865..184195) [2331 bp, 776 aa] {ON} YJR040...    33   6.4  

>SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] {ON}
            similar to uniprot|Q75CF0 Ashbya gossypii ACL004W
            ACL004Wp and some similarites with YOL004W uniprot|P22579
            Saccharomyces cerevisiae YOL004W SIN3 DNA binding protein
            involved in transcriptional regulation
          Length = 1415

 Score = 2400 bits (6219), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1197/1415 (84%), Positives = 1197/1415 (84%)

Query: 1    MSQGWNHPSVQSTGNSTDSTHFXXXXXXXXXXXXXXXXXTSSLDHKIGGSTGDAIKNSIE 60
            MSQGWNHPSVQSTGNSTDSTHF                 TSSLDHKIGGSTGDAIKNSIE
Sbjct: 1    MSQGWNHPSVQSTGNSTDSTHFLDQQPQQLQQSQTVLPPTSSLDHKIGGSTGDAIKNSIE 60

Query: 61   QTQPQVQVPYTLPSISGLNSTHSDSGIGXXXXXXXXXXXXXXXXXXXXXTHRHTPSGTGF 120
            QTQPQVQVPYTLPSISGLNSTHSDSGIG                     THRHTPSGTGF
Sbjct: 61   QTQPQVQVPYTLPSISGLNSTHSDSGIGQQMLPSVQSSLPPPPPPALQPTHRHTPSGTGF 120

Query: 121  SVASLNNPLPEXXXXXXXXXXXXXXXXXXXXXPQDPSYRPLNVKDALSYLEQVKFQFNNR 180
            SVASLNNPLPE                     PQDPSYRPLNVKDALSYLEQVKFQFNNR
Sbjct: 121  SVASLNNPLPEQQQQQQQQQQQQQQQQQQQQQPQDPSYRPLNVKDALSYLEQVKFQFNNR 180

Query: 181  PDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYPNLIQGFNTFLPQGYKIECSSNPND 240
            PDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYPNLIQGFNTFLPQGYKIECSSNPND
Sbjct: 181  PDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYPNLIQGFNTFLPQGYKIECSSNPND 240

Query: 241  PHPIKVTTPFGTTGSVTLNTAPLEQRYPSNENVLLSPXXXXXXXXXXXXXXXXXXXXXXX 300
            PHPIKVTTPFGTTGSVTLNTAPLEQRYPSNENVLLSP                       
Sbjct: 241  PHPIKVTTPFGTTGSVTLNTAPLEQRYPSNENVLLSPDHLQLQQHHSVLQQEQQQPQPQP 300

Query: 301  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYLAKKGGDVEFSHAISYVNKIKTRFAEQPD 360
                                          YLAKKGGDVEFSHAISYVNKIKTRFAEQPD
Sbjct: 301  QQQPQPQTQTQTQTQTQTQQQHYPDQQDQHYLAKKGGDVEFSHAISYVNKIKTRFAEQPD 360

Query: 361  IYKHFLEILQTYQREQKPINEVYAQVTVLFQNXXXXXXXXXXXXXXXSAPQSTTTPAPVN 420
            IYKHFLEILQTYQREQKPINEVYAQVTVLFQN               SAPQSTTTPAPVN
Sbjct: 361  IYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLPDASAPQSTTTPAPVN 420

Query: 421  GGTFYXXXXXXXXXXXXXXXXXXXXXXAREGEHVGLPAVQPPSMDISGQPQQHIITQGMS 480
            GGTFY                      AREGEHVGLPAVQPPSMDISGQPQQHIITQGMS
Sbjct: 421  GGTFYPQAAPQQNLPPLGSFSPPSSGSAREGEHVGLPAVQPPSMDISGQPQQHIITQGMS 480

Query: 481  NDDIPISEVRNTADGAYRSDLRNSGEVQYMEPVARPEIDLDPSLXXXXXXXXXXMENEVS 540
            NDDIPISEVRNTADGAYRSDLRNSGEVQYMEPVARPEIDLDPSL          MENEVS
Sbjct: 481  NDDIPISEVRNTADGAYRSDLRNSGEVQYMEPVARPEIDLDPSLVPVIPEPIEPMENEVS 540

Query: 541  LVEETSFFDKAKKFIGNKQIYTEFLKILNLYSQDLLDRDELVEKVEYYLGGNKELFDWFK 600
            LVEETSFFDKAKKFIGNKQIYTEFLKILNLYSQDLLDRDELVEKVEYYLGGNKELFDWFK
Sbjct: 541  LVEETSFFDKAKKFIGNKQIYTEFLKILNLYSQDLLDRDELVEKVEYYLGGNKELFDWFK 600

Query: 601  NFVGYEKKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKADTFMPCSGRDEMCWEVLNDE 660
            NFVGYEKKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKADTFMPCSGRDEMCWEVLNDE
Sbjct: 601  NFVGYEKKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKADTFMPCSGRDEMCWEVLNDE 660

Query: 661  WVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIEANLRTIQTLETIANKIANM 720
            WVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIEANLRTIQTLETIANKIANM
Sbjct: 661  WVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIEANLRTIQTLETIANKIANM 720

Query: 721  TPEEKATFKLSPGLGHTSVTIYKKVIRKVYDKDRGFEIIDALHETPSIAVPIVLKRLKQK 780
            TPEEKATFKLSPGLGHTSVTIYKKVIRKVYDKDRGFEIIDALHETPSIAVPIVLKRLKQK
Sbjct: 721  TPEEKATFKLSPGLGHTSVTIYKKVIRKVYDKDRGFEIIDALHETPSIAVPIVLKRLKQK 780

Query: 781  DEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLVSEISTIKVDQAN 840
            DEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLVSEISTIKVDQAN
Sbjct: 781  DEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLVSEISTIKVDQAN 840

Query: 841  KRIHPLTPKPKSQLDYHFKDREVLYDILNLAKVFIDCNTTYSNPDKEKMFDFLKSFLVLF 900
            KRIHPLTPKPKSQLDYHFKDREVLYDILNLAKVFIDCNTTYSNPDKEKMFDFLKSFLVLF
Sbjct: 841  KRIHPLTPKPKSQLDYHFKDREVLYDILNLAKVFIDCNTTYSNPDKEKMFDFLKSFLVLF 900

Query: 901  FSYPMYEVETAFARRRGDIGVQDGEENSGQENSDLSRKRTREEENLLKDVLRRNKYQKGR 960
            FSYPMYEVETAFARRRGDIGVQDGEENSGQENSDLSRKRTREEENLLKDVLRRNKYQKGR
Sbjct: 901  FSYPMYEVETAFARRRGDIGVQDGEENSGQENSDLSRKRTREEENLLKDVLRRNKYQKGR 960

Query: 961  NXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPWLLGSIVDEANEHGFVENRKTFNMF 1020
            N                                 PWLLGSIVDEANEHGFVENRKTFNMF
Sbjct: 961  NFAEEEPIPEESEFAEKTVEEKEEEEIIRQEAKKPWLLGSIVDEANEHGFVENRKTFNMF 1020

Query: 1021 ANTNIYVFFRHLATLYTRLSEVKDINEAVTEEIKNRKVVQFAKDLNLISTQLSDMGLDFE 1080
            ANTNIYVFFRHLATLYTRLSEVKDINEAVTEEIKNRKVVQFAKDLNLISTQLSDMGLDFE
Sbjct: 1021 ANTNIYVFFRHLATLYTRLSEVKDINEAVTEEIKNRKVVQFAKDLNLISTQLSDMGLDFE 1080

Query: 1081 GADAYGQVLTLSKRLIEGDIEHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHTIITD 1140
            GADAYGQVLTLSKRLIEGDIEHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHTIITD
Sbjct: 1081 GADAYGQVLTLSKRLIEGDIEHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHTIITD 1140

Query: 1141 PKTVEIMILFEKDRTCLNTSAKEQILYRLQVRSHMTTAENMFRIEYNRQSTHASIQFVAV 1200
            PKTVEIMILFEKDRTCLNTSAKEQILYRLQVRSHMTTAENMFRIEYNRQSTHASIQFVAV
Sbjct: 1141 PKTVEIMILFEKDRTCLNTSAKEQILYRLQVRSHMTTAENMFRIEYNRQSTHASIQFVAV 1200

Query: 1201 DDLTLEEPKSLEDRWKYYVTSYSLSHPTEGISHEELQXXXXXXXXXXXXXXQCENGEYSP 1260
            DDLTLEEPKSLEDRWKYYVTSYSLSHPTEGISHEELQ              QCENGEYSP
Sbjct: 1201 DDLTLEEPKSLEDRWKYYVTSYSLSHPTEGISHEELQPPFLEKILEKEEEFQCENGEYSP 1260

Query: 1261 EGVSSSNLKVKINPETYSLDVQPGSYDFFSRKSINKFPIEINNDTYKSKRGEKAKCLTSY 1320
            EGVSSSNLKVKINPETYSLDVQPGSYDFFSRKSINKFPIEINNDTYKSKRGEKAKCLTSY
Sbjct: 1261 EGVSSSNLKVKINPETYSLDVQPGSYDFFSRKSINKFPIEINNDTYKSKRGEKAKCLTSY 1320

Query: 1321 LNGAKGWKRGLVASKVLKAQTEIEYVKTKGTLVGLESXXXXXXXXXXXXGENKSYTFSTG 1380
            LNGAKGWKRGLVASKVLKAQTEIEYVKTKGTLVGLES            GENKSYTFSTG
Sbjct: 1321 LNGAKGWKRGLVASKVLKAQTEIEYVKTKGTLVGLESKDKNDIVKNDIDGENKSYTFSTG 1380

Query: 1381 QLHDHEEDKPISHQEEPESKGNDTTTEEFEGEIGH 1415
            QLHDHEEDKPISHQEEPESKGNDTTTEEFEGEIGH
Sbjct: 1381 QLHDHEEDKPISHQEEPESKGNDTTTEEFEGEIGH 1415

>ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YOL004W (SIN3)
          Length = 1377

 Score = 1340 bits (3468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 670/1039 (64%), Positives = 780/1039 (75%), Gaps = 26/1039 (2%)

Query: 334  KKGGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNX 393
            KK GDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 
Sbjct: 279  KKAGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNA 338

Query: 394  XXXXXXXXXXXXXXSAPQ---------STTTPAPVNGGTFYXXXXXXXXXXXXXXXXXXX 444
                          SAPQ         +   P   +  +                     
Sbjct: 339  PDLLDDFKKFLPDSSAPQLQSHQQINGAMVAPGFGHAQSGLQQALPGTQPLMHQQNLPPL 398

Query: 445  XXXAREGEH--VGLPAVQPPSMDISGQPQQHIITQGMSNDDIPISEVRNTADGAYR-SDL 501
               +  G+H  + LP+VQ P++ +S     HI+TQG+SN  IP+S++R   D ++R S+ 
Sbjct: 399  GNFSTPGDHHPMSLPSVQGPNVGLSQGQSGHIVTQGVSNQHIPVSDLRGAPDASFRASEY 458

Query: 502  RNSGEVQYMEPVARPEIDLDPSLXXXXXXXXXXMENEVSLVEETSFFDKAKKFIGNKQIY 561
                +VQYMEP  RPEIDLDPSL          +E+E++LVEE +FFDKAKKFIGNKQIY
Sbjct: 459  NQVQDVQYMEPTVRPEIDLDPSLVPVIPEPIKPLEDELNLVEEATFFDKAKKFIGNKQIY 518

Query: 562  TEFLKILNLYSQDLLDRDELVEKVEYYLGGNKELFDWFKNFVGYEKKPKHIENIVHEKHR 621
            TEFLKILNLYSQDLL++++LVE V +YL G+ ELFDWFK+FVGY+++PKHIEN++HEKHR
Sbjct: 519  TEFLKILNLYSQDLLEKEKLVEDVSHYLSGSPELFDWFKSFVGYQERPKHIENVIHEKHR 578

Query: 622  LDLDLCEACGPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQ 681
            LDLDLCEACGPSYK+LPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQ
Sbjct: 579  LDLDLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQ 638

Query: 682  YEETLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLSPGLGHTSVTI 741
            YE+TLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKA FKL PGLGHTSVTI
Sbjct: 639  YEDTLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKAAFKLPPGLGHTSVTI 698

Query: 742  YKKVIRKVYDKDRGFEIIDALHETPSIAVPIVLKRLKQKDEEWRRAQREWNKVWRELEQK 801
            YKKVIRKVYDKDRGFEIIDALHE P+I VP+VLKRLKQKDEEWRRAQREWNKVWRELEQK
Sbjct: 699  YKKVIRKVYDKDRGFEIIDALHEHPAITVPLVLKRLKQKDEEWRRAQREWNKVWRELEQK 758

Query: 802  VYYKSLDHLGLTFKQADKKLLTTKQLVSEISTIKVDQANKRIHPLTPKPKSQLDYHFKDR 861
            V+YKSLDHLGLTFKQADKKLLT KQL+SEIS+IKVDQ+NKRIHPLTPK KSQL Y FK+ 
Sbjct: 759  VFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQSNKRIHPLTPKAKSQLSYDFKEP 818

Query: 862  EVLYDILNLAKVFIDCNTTYSNPDKEKMFDFLKSFLVLFFSYPMYEVETAFARRRGDIGV 921
            EV  DIL+L  VF+  N TYS  D E++ DF K F+ LFFSYP++E+E    +R    G 
Sbjct: 819  EVFQDILSLVMVFLANNNTYSPSDNERLKDFFKGFISLFFSYPLHEIEEGLLKRSSQNGT 878

Query: 922  QDGEENSGQENSD------LSRKRTREE-ENLLKDVLRRNKYQKGRNXXXXXXXXXXXXX 974
                +++ +   D       +RKR R++ E+LL+D+L RNK QK                
Sbjct: 879  ISHGDDTRKSKEDPKTEKHSARKRVRDDTEHLLRDILYRNKQQK----VNKGPQNDQSSE 934

Query: 975  XXXXXXXXXXXXXXXXXXXXPWLLGSIVDEANEHGFVENRKTFNMFANTNIYVFFRHLAT 1034
                                PWLLGSIVDEA+ HG V +R TFNMFANTNIYVFFRHL T
Sbjct: 935  EFEKESDIEEKEIVRQEAKKPWLLGSIVDEADNHGHVSDRVTFNMFANTNIYVFFRHLTT 994

Query: 1035 LYTRLSEVKDINEAVTEEIKNRKVVQFAKDLNLISTQLSDMGLDFEGADAYGQVLTLSKR 1094
            +Y RL EVK IN  VT+EI NRKVVQFAKDLNLISTQL+DMGLDF+GADAY ++L LS+ 
Sbjct: 995  MYERLVEVKKINGEVTKEISNRKVVQFAKDLNLISTQLTDMGLDFKGADAYEELLRLSRS 1054

Query: 1095 LIEGDIEHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHTIITDPKTVEIMILFEKDR 1154
            LI G++EHQWFEESLRQAYKNKAFK+YTIDKV+Q+LVKHAHTI+ D KTVEIM+LF+ DR
Sbjct: 1055 LISGELEHQWFEESLRQAYKNKAFKLYTIDKVIQALVKHAHTILMDHKTVEIMLLFDNDR 1114

Query: 1155 TCLNTSAKEQILYRLQVRSHMTTAENMFRIEYNRQSTHASIQFVAVDDLTLEEPKSLEDR 1214
            T  +TS K+QILYRLQVRS+M+  ENMFRIEYN  ++HASIQFVAV+DLTL+EPKSL D+
Sbjct: 1115 TSTSTSTKDQILYRLQVRSNMSNIENMFRIEYNTTTSHASIQFVAVEDLTLDEPKSLRDK 1174

Query: 1215 WKYYVTSYSLSHPTEGISHEELQXXXXXXXXXXXXXXQCENGE-YSPEGVSSSNLKVKIN 1273
            W+YY+TSYSLSHPTEGISH+ L+                +  E YSPEGV+SSN+KVKI+
Sbjct: 1175 WQYYLTSYSLSHPTEGISHDNLRTPFLEKIIERDEGYIDDGDERYSPEGVASSNMKVKID 1234

Query: 1274 PETYSLDVQPGSYDFFSRKSINKFPIEINNDTYKSKRGEKAKCLTSYLNGAKGWKRGLVA 1333
            P TYS++V+PG +D FSRKS+NKFP  +  D  K K  E    L  +LNG +GWKRGL  
Sbjct: 1235 PLTYSMEVEPGCHDIFSRKSVNKFPTRV--DVKKKKSAELKLVLEGFLNGERGWKRGLTT 1292

Query: 1334 SKVLKAQTEIEYVKTKGTL 1352
             +  +A+  +EYVK  GTL
Sbjct: 1293 KRTAEAERRLEYVKNNGTL 1311

 Score =  186 bits (471), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 86/105 (81%), Positives = 92/105 (87%), Gaps = 2/105 (1%)

Query: 157 SYRPLNVKDALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYP 216
           +YRPLNVKDALSYLEQVKFQF++RPDVYNHFLDIMKDFKSQAIDTPGVIERVS LF GYP
Sbjct: 128 AYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGYP 187

Query: 217 NLIQGFNTFLPQGYKIECSSNPNDPHPIKVTTPFGTTGSVTLNTA 261
            LIQGFNTFLP GY IEC S+PND  PIKVTTPFGT G + +  A
Sbjct: 188 ALIQGFNTFLPHGYNIECPSDPND--PIKVTTPFGTIGEIPITGA 230

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 40/62 (64%)

Query: 166 ALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYPNLIQGFNTF 225
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+ LFQ  P+L+  F  F
Sbjct: 289 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 348

Query: 226 LP 227
           LP
Sbjct: 349 LP 350

 Score = 42.0 bits (97), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 32/48 (66%)

Query: 344 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 391
           A+SY+ ++K +F+ +PD+Y HFL+I++ ++ +      V  +V+ LF 
Sbjct: 137 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFH 184

>Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON}
            similar to Ashbya gossypii ACL004W
          Length = 1474

 Score = 1256 bits (3251), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 630/916 (68%), Positives = 723/916 (78%), Gaps = 21/916 (2%)

Query: 451  GEH--VGLPAVQPPSMDISGQPQQHIITQGMSNDDIPISEVRNTADGAYRSDLRNSGE-V 507
            G+H  + LP VQ P+M+++     HIITQGMSN  IPIS++R TAD +YR    + G+  
Sbjct: 499  GDHHPMNLPLVQAPNMNLNQGHPAHIITQGMSNQKIPISDLRTTADTSYRPAEYSQGQDT 558

Query: 508  QYMEPVARPEIDLDPSLXXXXXXXXXXMENEVSLVEETSFFDKAKKFIGNKQIYTEFLKI 567
            QYME  ARPEIDLDPSL          +E+E++LVEE SFFDKAKK+IGNKQIYTEFLKI
Sbjct: 559  QYMETNARPEIDLDPSLVPVIPEPIKPLEDELNLVEEASFFDKAKKYIGNKQIYTEFLKI 618

Query: 568  LNLYSQDLLDRDELVEKVEYYLGGNKELFDWFKNFVGYEKKPKHIENIVHEKHRLDLDLC 627
            LNLYSQDLLD++ LVEKV +YL G  ELFDWFK+FVGY++KPKHIENIVHEKHRLDLDLC
Sbjct: 619  LNLYSQDLLDKERLVEKVGHYLSGCPELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLC 678

Query: 628  EACGPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLF 687
            EACGPSYK+LPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLF
Sbjct: 679  EACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLF 738

Query: 688  KIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLSPGLGHTSVTIYKKVIR 747
            KIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKL PGLGHTSVTIYKKVIR
Sbjct: 739  KIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLPPGLGHTSVTIYKKVIR 798

Query: 748  KVYDKDRGFEIIDALHETPSIAVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSL 807
            KVYDKDRG+EIIDALHE P+I VPIVLKRLKQKDEEWRRAQREWNKVWRELEQKV++KSL
Sbjct: 799  KVYDKDRGYEIIDALHEYPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSL 858

Query: 808  DHLGLTFKQADKKLLTTKQLVSEISTIKVDQANKRIHPLTPKPKSQLDYHFKDREVLYDI 867
            DHLGLTFKQADKKLLT KQL+SEIS+IKVDQ NKRIHPLTPK KSQLD+ F D EV YDI
Sbjct: 859  DHLGLTFKQADKKLLTAKQLISEISSIKVDQNNKRIHPLTPKAKSQLDHDFTDPEVFYDI 918

Query: 868  LNLAKVFIDCNTTYSNPDKEKMFDFLKSFLVLFFSYPMYEVETAFARRRGDIGVQDGEEN 927
            LNLA VF++ N TYS PDKE++ DF K F+ LF SYP+ ++E A A+R      Q    N
Sbjct: 919  LNLAIVFLENNNTYSAPDKERLKDFFKGFISLFCSYPVPQIEKALAKRDAASSSQSSNSN 978

Query: 928  S------GQENSD--LSRKRTREE-ENLLKDVLRRNKYQK-GRNXXXXXXXXXXXXXXXX 977
            +       QE+ D  L +KR RE+ + LL+DVL RNK QK GRN                
Sbjct: 979  TETYSEKQQEDGDMKLPKKRNREDSDRLLRDVLFRNKQQKGGRN-----SPRGDSSISAE 1033

Query: 978  XXXXXXXXXXXXXXXXXPWLLGSIVDEANEHGFVENRKTFNMFANTNIYVFFRHLATLYT 1037
                             PWLLGSIVDEA+ HG VENRKTFN+FANTNIYVFFRHLAT+Y 
Sbjct: 1034 KESDMEEEEIIRQEAKNPWLLGSIVDEADNHGHVENRKTFNLFANTNIYVFFRHLATIYE 1093

Query: 1038 RLSEVKDINEAVTEEIKNRKVVQFAKDLNLISTQLSDMGLDFEGADAYGQVLTLSKRLIE 1097
            RL EVK +N+ VT+EI NRKVVQFAKDLNLISTQL+DMGLDF+G DAY ++L LS+ LI 
Sbjct: 1094 RLVEVKKMNDEVTKEIANRKVVQFAKDLNLISTQLTDMGLDFKGEDAYEKLLQLSRSLIA 1153

Query: 1098 GDIEHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHTIITDPKTVEIMILFEKDRTCL 1157
            GD+EHQWFEESLRQAYKNKAFKIYT+DKV+Q+LVKHAH IITD KTVEIM+LFEKDRT L
Sbjct: 1154 GDLEHQWFEESLRQAYKNKAFKIYTVDKVIQALVKHAHAIITDNKTVEIMMLFEKDRTSL 1213

Query: 1158 NTSAKEQILYRLQVRSHMTTAENMFRIEYNRQSTHASIQFVAVDDLTLEEPKSLEDRWKY 1217
            +TS K+QILYRLQVRS+M+  ENMFRIEYNR + H  IQFVAVDDLTLEEPKSL+D+W+Y
Sbjct: 1214 STSTKDQILYRLQVRSNMSNIENMFRIEYNRLTAHVCIQFVAVDDLTLEEPKSLKDKWQY 1273

Query: 1218 YVTSYSLSHPTEGISHEELQXXXXXXXXXXXXXXQCENGE-YSPEGVSSSNLKVKINPET 1276
            Y+TSYSLSHPTEGISH+ L+                +  E YSPEGV++SNLKVKI+P T
Sbjct: 1274 YLTSYSLSHPTEGISHDNLRSPFLEKIIESEEDIIEDKDEKYSPEGVATSNLKVKIDPIT 1333

Query: 1277 YSLDVQPGSYDFFSRKSINKFPIEINNDTYKSKRGEKAKCLTSYLNGAKGWKRGLVASKV 1336
            YS++V+ GS+D FSRK++NKFP+ +  D  K K  E    L  +LN   GWK+ L A ++
Sbjct: 1334 YSMEVEFGSHDIFSRKAVNKFPVRV--DIRKKKSSELKLELERFLNSNSGWKKDLSAKQI 1391

Query: 1337 LKAQTEIEYVKTKGTL 1352
             + +  +E+VK  G L
Sbjct: 1392 AEVEKRLEFVKLNGNL 1407

 Score =  204 bits (519), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 103/146 (70%), Positives = 110/146 (75%), Gaps = 8/146 (5%)

Query: 119 GFSVASLNNPLPEXXXXXXXXXXXXXXXXXXXXXPQDP------SYRPLNVKDALSYLEQ 172
           GFS++SL+NPLP+                      Q P      SYRPLNVKDALSYLEQ
Sbjct: 115 GFSMSSLDNPLPQQEFQEQSQHQQQQHHHHQLDQLQSPAHQDGSSYRPLNVKDALSYLEQ 174

Query: 173 VKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYPNLIQGFNTFLPQGYKI 232
           VKFQFN+RPDVYNHFLDIMKDFKSQAIDTPGVIERVS LFQGYP LIQGFNTFLPQGY I
Sbjct: 175 VKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPTLIQGFNTFLPQGYNI 234

Query: 233 ECSSNPNDPHPIKVTTPFGTTGSVTL 258
           ECSS+PND  PIKVTTPFGTTG V +
Sbjct: 235 ECSSDPND--PIKVTTPFGTTGEVAI 258

 Score =  122 bits (307), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 63/80 (78%)

Query: 333 AKKGGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 392
            KK GDVEFSHAISYVNKIKTRFA+QPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN
Sbjct: 346 GKKTGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 405

Query: 393 XXXXXXXXXXXXXXXSAPQS 412
                          SAPQ+
Sbjct: 406 APDLLDDFKKFLPDASAPQA 425

 Score = 55.5 bits (132), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 41/64 (64%)

Query: 166 ALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYPNLIQGFNTF 225
           A+SY+ ++K +F ++PD+Y HFL+I++ ++ +      V  +V+ LFQ  P+L+  F  F
Sbjct: 357 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 416

Query: 226 LPQG 229
           LP  
Sbjct: 417 LPDA 420

 Score = 42.4 bits (98), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 32/48 (66%)

Query: 344 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 391
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+ LFQ
Sbjct: 168 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQ 215

 Score = 36.6 bits (83), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 3/79 (3%)

Query: 153 PQDPSYRPLNVKDALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLF 212
           P  P    LN+ +  S+ ++ K    N+  +Y  FL I+  +    +D   ++E+V +  
Sbjct: 582 PIKPLEDELNLVEEASFFDKAKKYIGNK-QIYTEFLKILNLYSQDLLDKERLVEKVGHYL 640

Query: 213 QGYPNLIQGFNTFLPQGYK 231
            G P L   F +F+  GY+
Sbjct: 641 SGCPELFDWFKSFV--GYQ 657

>Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] {ON}
            YOL004W (SIN3) - DNA binding protein involved in
            transcriptional regulation [contig 185] FULL
          Length = 1541

 Score = 1204 bits (3116), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 583/906 (64%), Positives = 690/906 (76%), Gaps = 20/906 (2%)

Query: 453  HVGLPAVQPPSMDISGQPQ----QHIITQGMSNDDIPISEVRNTADGAYRSDLRNSGEVQ 508
             V LPAVQPP++D   Q Q    +H++ QGM+N+ +P+S++R   DG +      S +VQ
Sbjct: 598  QVNLPAVQPPALDFPPQQQSQSHRHVVAQGMTNNSLPVSDMRGPVDGGFAPQPLYSQDVQ 657

Query: 509  YMEPVARPEIDLDPSLXXXXXXXXXXMENEVSLVEETSFFDKAKKFIGNKQIYTEFLKIL 568
            YMEP +RPEIDLDPSL          +EN+ +L+EETSFFDKAKK++GNKQ+YTEFLKIL
Sbjct: 658  YMEPTSRPEIDLDPSLVPVIPEPIRPLENDSTLIEETSFFDKAKKYMGNKQVYTEFLKIL 717

Query: 569  NLYSQDLLDRDELVEKVEYYLGGNKELFDWFKNFVGYEKKPKHIENIVHEKHRLDLDLCE 628
            NL+SQDL+D DELV+KVE+YLGGN ELFDWFK+FV Y ++PKHIEN+VHEKHRLDLDLCE
Sbjct: 718  NLFSQDLIDTDELVDKVEHYLGGNSELFDWFKSFVNYVERPKHIENVVHEKHRLDLDLCE 777

Query: 629  ACGPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK 688
            AC PSYKKLPKADTFMPC GRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK
Sbjct: 778  ACCPSYKKLPKADTFMPCCGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK 837

Query: 689  IEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLSPGLGHTSVTIYKKVIRK 748
            IEEERHEYD+YIEANLRTIQ LETIANKI+NMT EEK TFKL PGLGHTS TIYKKVIRK
Sbjct: 838  IEEERHEYDYYIEANLRTIQLLETIANKISNMTVEEKKTFKLPPGLGHTSTTIYKKVIRK 897

Query: 749  VYDKDRGFEIIDALHETPSIAVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLD 808
            VYDKDRGFEIIDALHE P+++VPIVL+RLKQKDEEWRRAQREWNKVWRELEQKV+YKSLD
Sbjct: 898  VYDKDRGFEIIDALHENPAVSVPIVLRRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLD 957

Query: 809  HLGLTFKQADKKLLTTKQLVSEISTIKVDQANKRIHPLTPKPKSQLDYHFKDREVLYDIL 868
            HLGLTFKQADKKLLT KQL+SEIS+IK+DQANKRI+P T KPKSQLD+   D+ VL+DIL
Sbjct: 958  HLGLTFKQADKKLLTAKQLISEISSIKIDQANKRIYPFTSKPKSQLDFDISDKGVLFDIL 1017

Query: 869  NLAKVFIDCNTTYSNPDKEKMFDFLKSFLVLFFSYPMYEVETAFARRRGDIGVQDGEENS 928
            NL   FID +TTYSNPDKEK+  F + FL +FFS P+ +++             +  E  
Sbjct: 1018 NLVDTFIDHSTTYSNPDKEKLSAFFRGFLSIFFSIPLTDLD-------------NPSEEH 1064

Query: 929  GQENSDLSRKRTREEENLLKDVLRRNKYQKGRNXXXXXXXXXXXXXXXXXXXX--XXXXX 986
              EN D +RKR+R+++   +D+L+    Q  +                            
Sbjct: 1065 KVENGDSTRKRSRDDDQFFRDLLKSKHKQAKKKTSQQEDESTSDDQDTAAKTSPDLEYEE 1124

Query: 987  XXXXXXXXPWLLGSIVDEANEHGFVENRKTFNMFANTNIYVFFRHLATLYTRLSEVKDIN 1046
                    PWLLG+I+DEAN HGFV NRKT+NMFANTNIYVFFRHL T+Y RLSE K+IN
Sbjct: 1125 AVRLDAKKPWLLGNILDEANNHGFVSNRKTYNMFANTNIYVFFRHLTTMYQRLSEAKNIN 1184

Query: 1047 EAVTEEIKNRKVVQFAKDLNLISTQLSDMGLDFEGADAYGQVLTLSKRLIEGDIEHQWFE 1106
            E VT+EI +RKVVQFAKDLNL STQLSDMGLDF+GADAY Q+L L KRLI+ DIEHQWFE
Sbjct: 1185 EEVTKEINSRKVVQFAKDLNLASTQLSDMGLDFKGADAYEQLLALCKRLIQSDIEHQWFE 1244

Query: 1107 ESLRQAYKNKAFKIYTIDKVVQSLVKHAHTIITDPKTVEIMILFEKDRTCLNTSAKEQIL 1166
            ESLRQAYKNKAFKIYT+DKV+QSLVKHAH+IITD KT EIMILFEKDR    TS +EQIL
Sbjct: 1245 ESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAKTAEIMILFEKDRKAPTTSTREQIL 1304

Query: 1167 YRLQVRSHMTTAENMFRIEYNRQSTHASIQFVAVDDLTLEEPKSLEDRWKYYVTSYSLSH 1226
            YRLQVRS M   ENMFRIE N  S H SIQFVAVDDLTL +P SL+D+W+YY+TSYSLSH
Sbjct: 1305 YRLQVRSCMGLTENMFRIELNSTSAHVSIQFVAVDDLTLNQPNSLKDQWQYYLTSYSLSH 1364

Query: 1227 PTEGISHEELQXXXXXXXXXXXXXXQCENGEYSPEGVSSSNLKVKINPETYSLDVQPGSY 1286
            PTEG+ HEE++                ++  YSP G S S L+++INPE+Y+L ++P S 
Sbjct: 1365 PTEGVPHEEIKAPFLEKTLRDDGDSDEDSEWYSPGGQSVSQLRIQINPESYALQIEPNSK 1424

Query: 1287 DFFSRKSINKFPIEINNDTYKSKRGEKAKCLTSYLNGAKGWKRGLVASKVLKAQTEIEYV 1346
            D F+R ++NK P +I   + +  +  + K L   +N   GWK+GL    + KA++ I +V
Sbjct: 1425 DLFTRSTVNKHPTKIGEASGRDAKTMQ-KSLADMVNSEHGWKKGLQNESIGKAESIINFV 1483

Query: 1347 KTKGTL 1352
            K +G L
Sbjct: 1484 KARGFL 1489

 Score =  200 bits (509), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 110/146 (75%), Gaps = 5/146 (3%)

Query: 119 GFSVASLNNPLP-EXXXXXXXXXXXXXXXXXXXXXP----QDPSYRPLNVKDALSYLEQV 173
           GFSVASLNNPLP +                     P    QD SYRPLN KDALSYLEQV
Sbjct: 205 GFSVASLNNPLPMQQQQQQQQQQQQQQQLLQQGVLPLEHVQDASYRPLNFKDALSYLEQV 264

Query: 174 KFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYPNLIQGFNTFLPQGYKIE 233
           KFQFNNRPDVYNHFLDIMKD+KSQAIDT GVIER+S LF+GYP LIQG NTFLPQGYKIE
Sbjct: 265 KFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPVLIQGLNTFLPQGYKIE 324

Query: 234 CSSNPNDPHPIKVTTPFGTTGSVTLN 259
           C+SNP+DPH IKVTTPF TT  ++L+
Sbjct: 325 CTSNPHDPHSIKVTTPFDTTRELSLD 350

 Score =  112 bits (279), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 55/59 (93%)

Query: 334 KKGGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 392
           +  GDVEFSHAISYVNKIKTRFA+QPDIYKHFLEILQTYQREQKPI+EVY QVT LFQN
Sbjct: 435 RPNGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVYTQVTSLFQN 493

 Score = 56.2 bits (134), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 42/64 (65%)

Query: 166 ALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYPNLIQGFNTF 225
           A+SY+ ++K +F ++PD+Y HFL+I++ ++ +      V  +V++LFQ  P+L+  F  F
Sbjct: 445 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVYTQVTSLFQNAPDLLDDFKKF 504

Query: 226 LPQG 229
           LP  
Sbjct: 505 LPDA 508

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 34/53 (64%)

Query: 339 VEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 391
           + F  A+SY+ ++K +F  +PD+Y HFL+I++ Y+ +      V  +++ LF+
Sbjct: 252 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFK 304

>ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1670

 Score = 1202 bits (3109), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 609/1000 (60%), Positives = 716/1000 (71%), Gaps = 59/1000 (5%)

Query: 470  PQQHIITQGMSNDDIPISEVRNTADGA--------------------------------- 496
            P  +++TQGMSND IP+S +R+   GA                                 
Sbjct: 672  PSHYVMTQGMSNDAIPLSNMRSPTVGAPGAQTPVETAPQHPQQYSPQQAPQPQLPQQQLP 731

Query: 497  ----------------YRSDLRNSGEVQYMEPVARPEIDLDPSLXXXXXXXXXXMENEVS 540
                              S L    EVQY++   RPEIDLDPS+          +E+ +S
Sbjct: 732  PQQQEQSLPPQTIPLTQPSQLGPQQEVQYVDIAVRPEIDLDPSIVPVVPEPTEPIEDSLS 791

Query: 541  LVEETSFFDKAKKFIGNKQIYTEFLKILNLYSQDLLDRDELVEKVEYYLGGNKELFDWFK 600
            LVEETSFFDKAKKFIGNKQ+YTEFLKILNLYSQDLLD D LVEKVE+YLGG+KELF WFK
Sbjct: 792  LVEETSFFDKAKKFIGNKQLYTEFLKILNLYSQDLLDIDGLVEKVEHYLGGSKELFTWFK 851

Query: 601  NFVGYEKKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKADTFMPCSGRDEMCWEVLNDE 660
            NFVGY+ +PK+IEN++HEKHRLDLD+CEA GPSYKKLPK+DTFMPCSGRDEMCWEVLNDE
Sbjct: 852  NFVGYQDRPKNIENVIHEKHRLDLDMCEASGPSYKKLPKSDTFMPCSGRDEMCWEVLNDE 911

Query: 661  WVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIEANLRTIQTLETIANKIANM 720
            W+GHPVWASEDSGFIAHRKNQYEETLFK+EEERHEYDFYIE+NLRTIQTLETIA+KIANM
Sbjct: 912  WIGHPVWASEDSGFIAHRKNQYEETLFKVEEERHEYDFYIESNLRTIQTLETIASKIANM 971

Query: 721  TPEEKATFKLSPGLGHTSVTIYKKVIRKVYDKDRGFEIIDALHETPSIAVPIVLKRLKQK 780
            T EEKA FKL PGLGHTS+TIYKKVIRKVYDK+RGFEIIDALHE P++AVP+VLKRLKQK
Sbjct: 972  TEEEKANFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAVAVPVVLKRLKQK 1031

Query: 781  DEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLVSEISTIKVDQAN 840
            DEEWRRAQREWNKVWRELEQKVY+KSLDHLGLTFKQADKKLLTTKQL+SEIS+IKVDQ N
Sbjct: 1032 DEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTN 1091

Query: 841  KRIHPLTPKPKSQLDYHFKDREVLYDILNLAKVFIDCNTTYSNPDKEKMFDFLKSFLVLF 900
            KRIH LTPKPKSQLDY F DRE+  DIL+L +VF++    YSN DKE++ DFLKSFL LF
Sbjct: 1092 KRIHWLTPKPKSQLDYDFPDREIFCDILSLTEVFLNHTGNYSNSDKERLKDFLKSFLSLF 1151

Query: 901  FSYPMYEVETAFARRRGDIGVQDGEENSGQENSDLSR-KRTREEENLLKDVLRRNKYQ-- 957
            FS P+ EV     RRR     ++ E N  +  + L+  KR RE E  L+D+L RNKYQ  
Sbjct: 1152 FSIPVSEVNDGL-RRRSPSNKEEHEANKKENGTALAHGKRPREIELPLRDILHRNKYQKL 1210

Query: 958  KGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPWLLGSIVDEANEHGFVENRKTF 1017
            K R+                                 PWLLG+IV+EAN  G + NRK+F
Sbjct: 1211 KLRSDGEEGSIGQSEEGLDEQEEVDEEEEIIKQEAKKPWLLGNIVEEANAQGIISNRKSF 1270

Query: 1018 NMFANTNIYVFFRHLATLYTRLSEVKDINEAVTEEIKNRKVVQFAKDLNLISTQLSDMGL 1077
            N+FANT+IYVFFRHL TLY RL EVK I++ VT+EI +RKV QFAKDLNLIS QL +MGL
Sbjct: 1271 NLFANTSIYVFFRHLTTLYERLIEVKSIDQEVTQEINSRKVSQFAKDLNLISEQLKNMGL 1330

Query: 1078 DFEGADAYGQVLTLSKRLIEGDIEHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHTI 1137
            DF G DAY Q+L LSKRLIEGDIEHQWFEESLRQAY N+AFK YT+DKVVQ+LVKHAHTI
Sbjct: 1331 DFAGLDAYEQLLHLSKRLIEGDIEHQWFEESLRQAYNNRAFKFYTVDKVVQALVKHAHTI 1390

Query: 1138 ITDPKTVEIMILFEKDRTCLNTSAKEQILYRLQVRSHMTTAENMFRIEYNRQSTHASIQF 1197
            +TD K  EIM+LFEKDRT   TSAK+QILYR+Q RSHM+  ENMFRIE+NR S H  IQ+
Sbjct: 1391 LTDIKCSEIMVLFEKDRTLATTSAKDQILYRMQARSHMSNTENMFRIEFNRISKHVCIQY 1450

Query: 1198 VAVDDLTLEEPKSLEDRWKYYVTSYSLSHPTEGISHEELQXXXXXXXXXXXXXXQCENG- 1256
            +A+DDLTL E KSLED+WKYYVTSYSLSHPTEGISHE+LQ                +NG 
Sbjct: 1451 IAIDDLTLAEAKSLEDKWKYYVTSYSLSHPTEGISHEDLQVPFLEKIIESEQEYDEDNGG 1510

Query: 1257 --EYSPEGVSSSNLKVKINPETYSLDVQPGSYDFFSRKSINKFPIEINNDTYKSKRGEKA 1314
              ++SPEGVS S+L++KI+PETY L+V+PGS D FSRK++NKFP+E N++++K+K  +K 
Sbjct: 1511 DPKFSPEGVSKSSLRIKIDPETYFLEVEPGSCDVFSRKAVNKFPLEKNSESHKTKVDKKN 1570

Query: 1315 KCLTSYLNGAKGWKRGLVASKVLKAQTEIEYVKTKGTLVGL---ESXXXXXXXXXXXXGE 1371
            + +  YL+  KGWK+ L A  +   + ++ +VK  GTL G    E+              
Sbjct: 1571 ELIRGYLDSEKGWKKNLDAKSIQSVEEKLNFVKNYGTLQGYRAQENGLESTTKEAPFSDA 1630

Query: 1372 NKSYTFSTGQLHDHEEDKPISHQEEPESKGNDTTTEEFEG 1411
             +    S  Q        P +     E  GNDTT E+ E 
Sbjct: 1631 VERKADSAAQADGAANGGPSNTAGVEERGGNDTTAEDVEA 1670

 Score =  185 bits (469), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 98/114 (85%), Gaps = 5/114 (4%)

Query: 155 DPSYRPLNVKDALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQG 214
           D  YRPLNVKDALSYLEQVKFQFN+RPDVYNHFLDIMKDFKSQAIDTPGVIERVS LF+G
Sbjct: 274 DQYYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRG 333

Query: 215 YPNLIQGFNTFLPQGYKIECSSNPNDPHPIKVTTPFGTT---GSVTLNTAPLEQ 265
           YPNLIQGFNTFLPQGY+I+CS NP++  PIKVTTP G++   G   +N A L Q
Sbjct: 334 YPNLIQGFNTFLPQGYRIDCSQNPDE--PIKVTTPMGSSTVAGVAEMNQAALFQ 385

 Score =  113 bits (283), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 53/59 (89%), Positives = 55/59 (93%)

Query: 334 KKGGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 392
           KK  DVEFS AISYVNKIK RF++QPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN
Sbjct: 515 KKAADVEFSQAISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 573

 Score = 55.5 bits (132), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 42/62 (67%)

Query: 166 ALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYPNLIQGFNTF 225
           A+SY+ ++K +F+++PD+Y HFL+I++ ++ +      V  +V+ LFQ  P+L+  F  F
Sbjct: 525 AISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 584

Query: 226 LP 227
           LP
Sbjct: 585 LP 586

 Score = 40.8 bits (94), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 32/48 (66%)

Query: 344 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 391
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+ LF+
Sbjct: 285 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFR 332

>TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6.29
            YOL004W
          Length = 1490

 Score = 1196 bits (3094), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 606/993 (61%), Positives = 725/993 (73%), Gaps = 42/993 (4%)

Query: 449  REGEHVGLPAVQPPSMDISGQPQQHIITQGMSNDDIPISEVRNTADGAYRSDLR------ 502
            ++ + +GLP V      I  +   HI TQG++ + +P+S +R+       S+L       
Sbjct: 509  QQPQTLGLPPVAQVENHIDQRSPPHIATQGIAGEPMPVSNLRSQITAQSPSELAQLHQQQ 568

Query: 503  --------NSGEVQYMEPVARPEIDLDPSLXXXXXXXXXXMENEVSLVEETSFFDKAKKF 554
                    N  + QY++   RPEIDLDPS+          +E+ ++LVEETSFFD+AKKF
Sbjct: 569  QIPSQPTANIPDGQYLDIAVRPEIDLDPSIVPVVPEPTAPIEDSLTLVEETSFFDRAKKF 628

Query: 555  IGNKQIYTEFLKILNLYSQDLLDRDELVEKVEYYLGGNKELFDWFKNFVGYEKKPKHIEN 614
            IGNKQIYTEFLKILNL+SQDLLD DELV +VE+YLGGNKELF WFKNFVG++ KPKHIEN
Sbjct: 629  IGNKQIYTEFLKILNLFSQDLLDVDELVGRVEHYLGGNKELFVWFKNFVGFQDKPKHIEN 688

Query: 615  IVHEKHRLDLDLCEACGPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGF 674
            IVHEKHRLDLDLCEACGPSYKKLPK+DTFMPCSGRDEMCW VLNDEWVGHPVWASEDSGF
Sbjct: 689  IVHEKHRLDLDLCEACGPSYKKLPKSDTFMPCSGRDEMCWAVLNDEWVGHPVWASEDSGF 748

Query: 675  IAHRKNQYEETLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLSPGL 734
            IAHRKNQYEETLFKIEEERHEYDFYIE+NLRTIQTLETIA+KIANM+ EEKATFKL PGL
Sbjct: 749  IAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMSEEEKATFKLPPGL 808

Query: 735  GHTSVTIYKKVIRKVYDKDRGFEIIDALHETPSIAVPIVLKRLKQKDEEWRRAQREWNKV 794
            GHTS+TIYKKVIRKVYDK+RGFEIIDALHE P+IAVP+VLKRLKQKDEEWRRAQREWNKV
Sbjct: 809  GHTSLTIYKKVIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKV 868

Query: 795  WRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLVSEISTIKVDQANKRIHPLTPKPKSQL 854
            WRELEQKVYYKSLDHLGLTFKQADKKLLTTKQL+SEI +IK DQ NKR+H LTPKPK QL
Sbjct: 869  WRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISEIGSIKTDQTNKRMHWLTPKPKDQL 928

Query: 855  DYHFKDREVLYDILNLAKVFIDCNTTYSNPDKEKMFDFLKSFLVLFFSYPMYEVETAFAR 914
            DY+  D+ V +DIL+L   FI+ N++YSNPDK ++ D  K F+ LFFS PMYEV  A +R
Sbjct: 929  DYYVPDKSVFFDILSLTDTFINHNSSYSNPDKIRLKDLFKIFVSLFFSIPMYEVNEAVSR 988

Query: 915  RRGDIGVQDGEENSGQ--ENSDLSR-KRTREEENLLKDVLRRNKYQKGRNXXXXXXXXXX 971
            R     + D +E+S Q  E+ +L+  KR RE+E  L +VL R K Q+ ++          
Sbjct: 989  RG---NLDDDKEDSTQKMESDNLNNSKRPREDEISLSEVLHRAKNQRFKS--RAADETSE 1043

Query: 972  XXXXXXXXXXXXXXXXXXXXXXXPWLLGSIVDEANEHGFVENRKTFNMFANTNIYVFFRH 1031
                                   PWLLG++V+E N  G + NRKTFNMFANTNIYVFFRH
Sbjct: 1044 ESAAEPEPELNEEEETIRQEAKKPWLLGNLVEEVNAQGLINNRKTFNMFANTNIYVFFRH 1103

Query: 1032 LATLYTRLSEVKDINEAVTEEIKNRKVVQFAKDLNLISTQLSDMGLDFEGADAYGQVLTL 1091
            L TLY RL EVK +N+AVT+EI +RKVVQFAKDLNLIS QL +MGLDFEGADAY Q+  L
Sbjct: 1104 LTTLYERLEEVKKMNDAVTKEINSRKVVQFAKDLNLISQQLKEMGLDFEGADAYEQLRHL 1163

Query: 1092 SKRLIEGDIEHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHTIITDPKTVEIMILFE 1151
             KRLIEGDIEHQWFEESLRQAY NKAFK+YT+DKV+QSLVKHAHTI+TD KT EIM  FE
Sbjct: 1164 CKRLIEGDIEHQWFEESLRQAYNNKAFKLYTVDKVIQSLVKHAHTILTDSKTSEIMTSFE 1223

Query: 1152 KDRTCLNTSAKEQILYRLQVRSHMTTAENMFRIEYNRQSTHASIQFVAVDDLTLEEPKSL 1211
            KDRT +NTSAK+QILYRLQVRS+M++ ENMFRIEYN+QS +  IQF+AVDDLTL EP+SL
Sbjct: 1224 KDRTQINTSAKDQILYRLQVRSYMSSTENMFRIEYNKQSKNVRIQFIAVDDLTLAEPRSL 1283

Query: 1212 EDRWKYYVTSYSLSHPTEGISHEELQX--XXXXXXXXXXXXXQCEN---GEYSPEGVSSS 1266
            E++W+YYVTSYSLSHPTEGIS EELQ                  +N    ++SPEGVS S
Sbjct: 1284 EEKWRYYVTSYSLSHPTEGISQEELQLPFLEKVLETEEDYGSDVDNFSIDKFSPEGVSKS 1343

Query: 1267 NLKVKINPETYSLDVQPGSYDFFSRKSINKFPIEINNDTYKSKRGEKAKCLTSYLNGAKG 1326
             LK+KI+PETY LD++ GSYD FSRKS+N+FP+ ++++ Y +K+ +K   +  +L   KG
Sbjct: 1344 TLKIKIDPETYLLDIEAGSYDVFSRKSVNRFPVIVDSNDYTTKKEKKKNMVIQFLESKKG 1403

Query: 1327 WKRGLVASKVLKAQTEIEYVKTKGTLVGLESXXXXXXXXXXXXGENKSYTFSTGQLHDHE 1386
            WK+ L   +V   Q ++  VK  G+L                  +  S   +  ++   +
Sbjct: 1404 WKKNLDDDQVKAIQEKLARVKENGSLDDFNEASQT---------QQASEIIAPSKVEQSK 1454

Query: 1387 EDKPISHQEEP------ESKGNDTTTEEFEGEI 1413
            E         P      E +GNDTT +E + E+
Sbjct: 1455 ESTVADVNSLPKELVEAEDRGNDTTADEVDPEV 1487

 Score =  180 bits (457), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 89/149 (59%), Positives = 102/149 (68%), Gaps = 12/149 (8%)

Query: 116 SGTGFSVASLNNPLPEXXXXXXXXX----------XXXXXXXXXXXXPQDPSYRPLNVKD 165
           +  G S AS +NPLP                                  D  YRPLNVKD
Sbjct: 139 NSVGLSFASFDNPLPPQQQTILSSSHFQVLPPHQQQQEQQQQMQQQMQHDAYYRPLNVKD 198

Query: 166 ALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYPNLIQGFNTF 225
           ALSYLEQVK+QFN+RPDVYNHFLDIMKDFKSQAIDTPGVI+RVS LF+GYP LIQGFNTF
Sbjct: 199 ALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPGLIQGFNTF 258

Query: 226 LPQGYKIECSSNPNDPHPIKVTTPFGTTG 254
           LPQGY+IECS+NP++  PI+VTTP G++ 
Sbjct: 259 LPQGYRIECSANPDE--PIRVTTPMGSSS 285

 Score =  114 bits (284), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 55/60 (91%)

Query: 333 AKKGGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 392
            KK  DVEFS AI+YVNKIK RFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN
Sbjct: 374 GKKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 433

 Score = 52.8 bits (125), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 40/62 (64%)

Query: 166 ALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYPNLIQGFNTF 225
           A++Y+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+ LFQ  P+L+  F  F
Sbjct: 385 AINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 444

Query: 226 LP 227
           LP
Sbjct: 445 LP 446

 Score = 40.4 bits (93), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 32/48 (66%)

Query: 344 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 391
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+ LF+
Sbjct: 199 ALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFK 246

>KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1433

 Score = 1187 bits (3072), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 590/971 (60%), Positives = 709/971 (73%), Gaps = 28/971 (2%)

Query: 448  AREGE-HVGLPAVQPPSMDISGQ--PQQ--HIITQGMSNDDIPISEVRNTADGAYRSDLR 502
             RE +  + LPAVQPP+M+ + Q  P    H++ Q +    +P+S++R   DG +     
Sbjct: 482  GRENDPQLNLPAVQPPAMEFASQQVPHHPSHVVPQVIPGGTLPLSDLRGAMDGNFAPQPL 541

Query: 503  NSGEVQYMEPVARPEIDLDPSLXXXXXXXXXXMENEVSLVEETSFFDKAKKFIGNKQIYT 562
             S +VQ++EP +RPEIDLDPSL          +EN+++L+EETSFFD+AKK++GNKQ+YT
Sbjct: 542  QSQDVQFIEPTSRPEIDLDPSLVPVIPEPIKPLENDLTLIEETSFFDRAKKYMGNKQVYT 601

Query: 563  EFLKILNLYSQDLLDRDELVEKVEYYLGGNKELFDWFKNFVGYEKKPKHIENIVHEKHRL 622
            EFLKILNL+SQDL+  +ELV+KVE+YLGG+ ELFDWFK+FV Y +KPKHIEN++HEKHRL
Sbjct: 602  EFLKILNLFSQDLIGTEELVDKVEHYLGGSPELFDWFKSFVNYVEKPKHIENVIHEKHRL 661

Query: 623  DLDLCEACGPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQY 682
            DLDLCEAC PSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQY
Sbjct: 662  DLDLCEACFPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQY 721

Query: 683  EETLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLSPGLGHTSVTIY 742
            EETLFKIEEERHEYD+YIEANLRTIQ LETIANKI+NMTPEEK  FKL PGLGHTS+TIY
Sbjct: 722  EETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTPEEKQAFKLPPGLGHTSMTIY 781

Query: 743  KKVIRKVYDKDRGFEIIDALHETPSIAVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKV 802
            KKVIRKVYDKDRGFEIIDALHE P+++VPI+LKRLKQKDEEWRRAQREWNKVWRELEQKV
Sbjct: 782  KKVIRKVYDKDRGFEIIDALHENPAVSVPIILKRLKQKDEEWRRAQREWNKVWRELEQKV 841

Query: 803  YYKSLDHLGLTFKQADKKLLTTKQLVSEISTIKVDQANKRIHPLTPKPKSQLDYHFKDRE 862
            +YKSLDHLGLTFKQADKKLLT KQL+SEIS+IKVDQ NKRI+P TPKPKSQLDY  KD+ 
Sbjct: 842  FYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQTNKRIYPFTPKPKSQLDYDLKDKG 901

Query: 863  VLYDILNLAKVFIDCNTTYSNPDKEKMFDFLKSFLVLFFSYPMYEVETAFARRRGDIGVQ 922
            VL+DIL L   FID ++TYSNPDKEK+  F K FL +FFS    E+E +           
Sbjct: 902  VLFDILCLVNNFIDHSSTYSNPDKEKLAAFFKGFLSVFFSISYQEIENSTP------ADS 955

Query: 923  DGEENSGQENSDLSRKRTREEENLLKDVLR-RNKYQKGRNXXXXXXXXXXXXXX-XXXXX 980
            D   NS        RKR  E E  LK++LR ++K+ K R+                    
Sbjct: 956  DAVSNSN------PRKRLWESEQPLKELLRSKHKHHKKRDTSAEDDSISDDQNSPEKSPQ 1009

Query: 981  XXXXXXXXXXXXXXPWLLGSIVDEANEHGFVENRKTFNMFANTNIYVFFRHLATLYTRLS 1040
                          PWLLG+I+DEAN+HG+V NRK FN+FANTN+YVFFRHL T+Y RLS
Sbjct: 1010 EIEDEEVIRQEAKKPWLLGNILDEANDHGYVSNRKIFNLFANTNVYVFFRHLTTMYQRLS 1069

Query: 1041 EVKDINEAVTEEIKNRKVVQFAKDLNLISTQLSDMGLDFEGADAYGQVLTLSKRLIEGDI 1100
            EVK++NE VT EI +R VVQFAKDLNL+STQLSDMGLDF+G DAY Q+LTL KRLI  D+
Sbjct: 1070 EVKNMNEEVTREINSRNVVQFAKDLNLVSTQLSDMGLDFKGKDAYDQLLTLCKRLIRNDM 1129

Query: 1101 EHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHTIITDPKTVEIMILFEKDRTCLNTS 1160
            +HQWFEESLRQAYKNKAFKIYT+DKV+QSLVKHAH+IITD K+ EIMILFEKDR C  TS
Sbjct: 1130 DHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAKSAEIMILFEKDRRCTATS 1189

Query: 1161 AKEQILYRLQVRSHMTTAENMFRIEYNRQSTHASIQFVAVDDLTLEEPKSLEDRWKYYVT 1220
             KEQILYRLQVRS+M   ENMFR+E N+ S H  IQ+VA+DDLTL+EP+SL+DRW YY+T
Sbjct: 1190 TKEQILYRLQVRSYMGLTENMFRVEINKDSCHVCIQYVAIDDLTLKEPESLKDRWHYYLT 1249

Query: 1221 SYSLSHPTEGISHEELQXXXXXXXXXXXXXXQCENGEYSPEGVSSSNLKVKINPETYSLD 1280
            SY+LSHPTEGI HEE++                 + E SP G S SNL++++NPE+Y L 
Sbjct: 1250 SYALSHPTEGIPHEEIKVPFLEKTLQDDEEADEGSEERSPSGHSLSNLRIQVNPESYELQ 1309

Query: 1281 VQPGSYDFFSRKSINKFPIEINNDTYKSKRGEKAKCLTSYLNGAKGWKRGLVASKVLKAQ 1340
            ++PGS D F+R ++N+F     N++    + EK K L S L+G++GWK+G+    V K  
Sbjct: 1310 IEPGSKDIFTRFAVNRFLNSSENNSNTDLKEEKRKTLMSQLDGSRGWKKGMSQELVDKTL 1369

Query: 1341 TEIEYVKTKGTLVGLESXXXXXXXXXXXXGENKSYTFSTGQLHDHEEDKPISHQEEPESK 1400
            T + YV+  G    L               E+ S       L  H +D         E K
Sbjct: 1370 TALNYVRLHGKHESLNKNPALVQGTRDPRHES-SVAKEASSLESHADDT--------ELK 1420

Query: 1401 GNDTTTEEFEG 1411
              +TT E+ +G
Sbjct: 1421 AGETTAEDIQG 1431

 Score =  201 bits (511), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 114/224 (50%), Positives = 133/224 (59%), Gaps = 13/224 (5%)

Query: 40  TSSLDHKIGGSTGDAIKNS-IEQTQPQVQVPYTLPSISGLNSTHSDSGIGXXXXXXXXXX 98
           +  +  +   STG++  N+ ++ +Q   Q  + LPS+SGL     D+G            
Sbjct: 31  SGGMQGQAANSTGESKANAPVDASQQPHQ--FVLPSLSGL-----DAGTRAEYGSEPQRL 83

Query: 99  XXXXXXXXXXXTHRHTPSGTGFSVASLNNPLPEXXXXXXXXXXXXXXXXXXXXXP--QDP 156
                      +   +    GFSVASLNNPLP                         QDP
Sbjct: 84  PSLQGAQPQSIS---SGGSKGFSVASLNNPLPAQQQMLHSQQQQQLLQQGVLPLEHVQDP 140

Query: 157 SYRPLNVKDALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYP 216
           SYRPLN KDALSYLEQVKFQFNNRPDVYNHFLDIMKD+KSQAIDT GVIER+S LF+GYP
Sbjct: 141 SYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYP 200

Query: 217 NLIQGFNTFLPQGYKIECSSNPNDPHPIKVTTPFGTTGSVTLNT 260
            LIQG NTFLPQGYKIEC+ NPNDPH IKVTTPF     + L T
Sbjct: 201 ILIQGLNTFLPQGYKIECTLNPNDPHSIKVTTPFDNARELNLAT 244

 Score =  112 bits (279), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 56/59 (94%)

Query: 334 KKGGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 392
           +  GDVEFSHAISYVNKIKTRFA+QP+IYKHFLEILQTYQREQKPI+EVYAQVT LFQN
Sbjct: 329 RPSGDVEFSHAISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQN 387

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 42/64 (65%)

Query: 166 ALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYPNLIQGFNTF 225
           A+SY+ ++K +F ++P++Y HFL+I++ ++ +      V  +V++LFQ  P+L+  F  F
Sbjct: 339 AISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQNAPDLLDDFKKF 398

Query: 226 LPQG 229
           LP  
Sbjct: 399 LPDA 402

 Score = 43.1 bits (100), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 34/53 (64%)

Query: 339 VEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 391
           + F  A+SY+ ++K +F  +PD+Y HFL+I++ Y+ +      V  +++ LF+
Sbjct: 145 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFK 197

 Score = 33.5 bits (75), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 1/74 (1%)

Query: 153 PQDPSYRPLNVKDALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLF 212
           P  P    L + +  S+ ++ K    N+  VY  FL I+  F    I T  ++++V +  
Sbjct: 570 PIKPLENDLTLIEETSFFDRAKKYMGNK-QVYTEFLKILNLFSQDLIGTEELVDKVEHYL 628

Query: 213 QGYPNLIQGFNTFL 226
            G P L   F +F+
Sbjct: 629 GGSPELFDWFKSFV 642

>KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} similar to
            uniprot|Q75CF0 Ashbya gossypii ACL004W ACL004Wp and
            weakly similar to YOL004W uniprot|P22579 Saccharomyces
            cerevisiae YOL004W SIN3 DNA binding protein involved in
            transcriptional regulation
          Length = 1519

 Score = 1173 bits (3034), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 575/896 (64%), Positives = 683/896 (76%), Gaps = 29/896 (3%)

Query: 472  QHIITQGMSNDDIPISEVRNTADGAYRSDLRNSGE---------VQYME-PVARPEIDLD 521
            QH++TQGMSN DIP+SE+R+T +G Y       G          VQYME P+ARPEIDLD
Sbjct: 609  QHVVTQGMSNQDIPVSEMRSTMNGTYNQVEYIQGAPGYPQPLEGVQYMEAPMARPEIDLD 668

Query: 522  PSLXXXXXXXXXXMENEVSLVEETSFFDKAKKFIGNKQIYTEFLKILNLYSQDLLDRDEL 581
            PSL           E+ ++L +E +FF++ K+FIGNKQ+Y EFLKILNLYSQDLL   EL
Sbjct: 669  PSLVPVVPEPIQPPEDAIALGDEVTFFERVKRFIGNKQVYAEFLKILNLYSQDLLTTSEL 728

Query: 582  VEKVEYYLGGNKELFDWFKNFVGYEKKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKAD 641
            V KVE+YL  +KELFDWFK+FVGY++KPKHIENIVHEKHRLDLDLCEACGPSYKKLPK D
Sbjct: 729  VSKVEFYLHSSKELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKDD 788

Query: 642  TFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIE 701
            TFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFK+EEERHEYDFYIE
Sbjct: 789  TFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKVEEERHEYDFYIE 848

Query: 702  ANLRTIQTLETIANKIANMTPEEKATFKLSPGLGHTSVTIYKKVIRKVYDKDRGFEIIDA 761
            +NLRTIQTLETIANKIANMT EEK  FKL PGLGHTS+TIYKKV+RKVYDKDRGFEIIDA
Sbjct: 849  SNLRTIQTLETIANKIANMTNEEKNNFKLPPGLGHTSLTIYKKVVRKVYDKDRGFEIIDA 908

Query: 762  LHETPSIAVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKL 821
            LHE P++ VPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKL
Sbjct: 909  LHEHPAVTVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKL 968

Query: 822  LTTKQLVSEISTIKVDQANKRIHPLTPKPKSQLDYHFKDREVLYDILNLAKVFIDCNTTY 881
            LTTKQL+SEIS+IKVDQ NKRIHPLTPKPKSQLD+   DREVLYDIL+L   F+  N +Y
Sbjct: 969  LTTKQLLSEISSIKVDQTNKRIHPLTPKPKSQLDFEINDREVLYDILDLVFTFVKTNASY 1028

Query: 882  SNPDKEKMFDFLKSFLVLFFSYPMYEVETAFARRRGDIGVQDGEENSGQENSDLSRKRTR 941
            SN DK K+  F K+F+ LFFSYP+ +V  A + R      ++GEE+S + +S+ S KRT 
Sbjct: 1029 SNSDKIKLDHFFKAFISLFFSYPIKDVNEAVSERSSITDQENGEEDSNKSDSEKSNKRTL 1088

Query: 942  EEEN--LLKDVLRRNKYQKGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPWLLG 999
             +E+  L+KD+LRR K  K  N                                 PWLLG
Sbjct: 1089 SDEDSYLMKDILRRTKNAKTSN------SEENQNSSSVKSNEEDETELLAKEAAKPWLLG 1142

Query: 1000 SIVDEANEHGFVENRKTFNMFANTNIYVFFRHLATLYTRLSEVKDINEAVTEEIKNRKVV 1059
            S++DEAN  G V +R  FN+F NT IYVFFRHL TLY RL EVK I+  VT+EIKNRK+V
Sbjct: 1143 SLIDEANNSGIVSDRHIFNLFTNTTIYVFFRHLNTLYERLLEVKKIDAEVTDEIKNRKIV 1202

Query: 1060 QFAKDLNLISTQLSDMGLDFEGADAYGQVLTLSKRLIEGDIEHQWFEESLRQAYKNKAFK 1119
            QFA DLNLISTQL+DMGL F+   AYG++L LSKRLI GD++HQWFEESLRQAYKNKAFK
Sbjct: 1203 QFASDLNLISTQLADMGLAFKDTKAYGELLRLSKRLITGDLDHQWFEESLRQAYKNKAFK 1262

Query: 1120 IYTIDKVVQSLVKHAHTIITDPKTVEIMILFEKDRTCLNTSAKEQILYRLQVRSHMTTAE 1179
            IYTIDKVVQSLVKHAH+IITDPK   +M+LFE+DR   +T+AK+QILYRL+VR+ M  +E
Sbjct: 1263 IYTIDKVVQSLVKHAHSIITDPKNAMVMVLFEQDRLKRDTTAKDQILYRLKVRNTMGESE 1322

Query: 1180 NMFRIEYNRQSTHASIQFVAVDDLTLEEPKSLEDRWKYYVTSYSLSHPTEGISHEELQX- 1238
            NMFRIEYN  S+H SIQ+VAVDDLTL+EP++++++W YYVTSYSLSHPTEGI+ E++   
Sbjct: 1323 NMFRIEYNTDSSHVSIQYVAVDDLTLKEPQNMKEKWDYYVTSYSLSHPTEGITQEDISQP 1382

Query: 1239 --XXXXXXXXXXXXXQCENGEYSPEGVSSSNLKVKINPETYSLDVQPGSYDFFSRKSINK 1296
                           + +N ++SPEGVS S LKV I+PETY L  + GS D F+RKS+NK
Sbjct: 1383 FLGKIIEKEAEYLDDEEQNDKFSPEGVSQSKLKVNIHPETYELTFECGSTDVFTRKSVNK 1442

Query: 1297 FPIEINNDTYKSKRGEKAKCLTSYLNGAKGWKRGLVASKVLKAQTEIEYVKTKGTL 1352
            FP         S+  + A  +  +LN +KGWK+ L    + +A+++++ +K +G L
Sbjct: 1443 FP--------SSQSTQPASKMDKFLNSSKGWKKNLSTEIIGRAESKMKILKEQGKL 1490

 Score =  194 bits (494), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 107/133 (80%), Gaps = 15/133 (11%)

Query: 154 QDP-------SYRPLNVKDALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIE 206
           QDP       SYRPLNVKDALSYLEQVKFQF++RPDVYNHFLDIMKDFKSQAIDTPGVI+
Sbjct: 190 QDPLQQAQYSSYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQ 249

Query: 207 RVSNLFQGYPNLIQGFNTFLPQGYKIECSSNPNDPHPIKVTTPFGTTGSVTLN------T 260
           RV+ LFQG+PNLIQGFNTFLP GYKIECS+NPND  PIKVTTPFGTTG V+         
Sbjct: 250 RVTTLFQGFPNLIQGFNTFLPHGYKIECSTNPND--PIKVTTPFGTTGEVSAGPPTQYQL 307

Query: 261 APLEQRYPSNENV 273
           AP+  +   N+N+
Sbjct: 308 APVAGQNVENQNI 320

 Score =  112 bits (280), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 57/59 (96%)

Query: 334 KKGGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 392
           +K G+VEFSHAISYVNKIKTRFA+QPDIYK FLEILQTYQREQKPI+EVYAQVT+LFQN
Sbjct: 420 QKTGEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQN 478

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 40/62 (64%)

Query: 166 ALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYPNLIQGFNTF 225
           A+SY+ ++K +F ++PD+Y  FL+I++ ++ +      V  +V+ LFQ  P+L+  F  F
Sbjct: 430 AISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNNPDLLDDFKKF 489

Query: 226 LP 227
           LP
Sbjct: 490 LP 491

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 33/48 (68%)

Query: 344 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 391
           A+SY+ ++K +F+ +PD+Y HFL+I++ ++ +      V  +VT LFQ
Sbjct: 209 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQ 256

 Score = 33.9 bits (76), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 1/67 (1%)

Query: 538 EVSLVEETSFFDKAK-KFIGNKQIYTEFLKILNLYSQDLLDRDELVEKVEYYLGGNKELF 596
           EV      S+ +K K +F     IY +FL+IL  Y ++     E+  +V      N +L 
Sbjct: 424 EVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNNPDLL 483

Query: 597 DWFKNFV 603
           D FK F+
Sbjct: 484 DDFKKFL 490

>Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON}
            (46639..51129) [4491 nt, 1497 aa]
          Length = 1496

 Score = 1165 bits (3015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 593/1007 (58%), Positives = 728/1007 (72%), Gaps = 51/1007 (5%)

Query: 448  AREGEH--VGLPA-VQPPSMDISGQPQQHIITQGMSNDDIPISEVRN------------- 491
            + E +H  + LP+ +Q P+       QQHI    M+N+ IPIS++R+             
Sbjct: 495  STEAQHHMMALPSMLQAPTEHAQLHAQQHIAP--MTNEAIPISDLRSQIIDNNHVHNYTP 552

Query: 492  -------------TADGAYRSDLRNSGEVQYM-EPVARPEIDLDPSLXXXXXXXXXXMEN 537
                               +   +   E  Y  E + RPEIDLDPS+          +E 
Sbjct: 553  IELAQLQQQQQQQQQQQQQQQQQQMQLEAAYATEGIVRPEIDLDPSIVPVIPEPTEPIEE 612

Query: 538  EVSLVEETSFFDKAKKFIGNKQIYTEFLKILNLYSQDLLDRDELVEKVEYYLGGNKELFD 597
             +SLVEE +FFDKAKKFIGNKQ+Y EFLKILNLYSQD+L  D+L+EKV+YYLG NKELFD
Sbjct: 613  SLSLVEEANFFDKAKKFIGNKQVYVEFLKILNLYSQDILSLDDLIEKVDYYLGSNKELFD 672

Query: 598  WFKNFVGYEKKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKADTFMPCSGRDEMCWEVL 657
            WFKNFVG++ KPKHIEN+VHEKH+LDLDLCEACGPSYKKLPK DTFMPCSGRDEMCWEVL
Sbjct: 673  WFKNFVGFQDKPKHIENVVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVL 732

Query: 658  NDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIEANLRTIQTLETIANKI 717
            NDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIE+NLRTIQTLETIA+KI
Sbjct: 733  NDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKI 792

Query: 718  ANMTPEEKATFKLSPGLGHTSVTIYKKVIRKVYDKDRGFEIIDALHETPSIAVPIVLKRL 777
            ANMT EEK  FKL  GLGHTS TIY+KVIRKVYDK+RGFEIIDALHE PS+AVP+VLKRL
Sbjct: 793  ANMTEEEKQAFKLPIGLGHTSTTIYQKVIRKVYDKERGFEIIDALHEYPSVAVPVVLKRL 852

Query: 778  KQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLVSEISTIKVD 837
            KQKD+EWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQ+DKKLLTTKQL++EIS+IKVD
Sbjct: 853  KQKDKEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQSDKKLLTTKQLLAEISSIKVD 912

Query: 838  QANKRIHPLTPKPKSQLDYHFKDREVLYDILNLAKVFIDCNTTYSNPDKEKMFDFLKSFL 897
            Q NKRIH LTPKPKSQLDY  KD+ VL+DIL LA VFI+  ++YSNPDKE++ DFL+S++
Sbjct: 913  QTNKRIHWLTPKPKSQLDYEVKDKRVLFDILRLADVFINHTSSYSNPDKERLRDFLQSYI 972

Query: 898  VLFFSYPMYEVETAFARRRGDIGVQ--DGEENSGQENSDLSRKRTREEENLLKDVLRRNK 955
             LFFS P+ E++ A      D G Q  + E+NS ++NS+   KR R+ E  L D+L R++
Sbjct: 973  GLFFSIPIREIKDA-VEAAIDNGKQLDENEQNSSKKNSN---KRPRDVEICLSDILNRSR 1028

Query: 956  YQKGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPWLLGSIVDEANEHGFVENRK 1015
            YQ+ ++                                 PWLLGS+V+EAN  G ++NRK
Sbjct: 1029 YQRLKH-SLDSSEASLGAVSPGQNEQDDMDEMIRQEAKKPWLLGSLVEEANSQGLIQNRK 1087

Query: 1016 TFNMFANTNIYVFFRHLATLYTRLSEVKDINEAVTEEIKNRKVVQFAKDLNLISTQLSDM 1075
             +NMFAN N+YVF R+L T+Y RL EVKDIN+ VT+EI  RKVVQFAKDLNLIS QL +M
Sbjct: 1088 IYNMFANVNMYVFMRNLITIYDRLHEVKDINDVVTKEINGRKVVQFAKDLNLISAQLKNM 1147

Query: 1076 GLDFEGADAYGQVLTLSKRLIEGDIEHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAH 1135
            GLDF G D+Y Q+L LSKRLIEGD+EHQWFEESLRQAY+N+AFK+YTIDKV+QSLVKHAH
Sbjct: 1148 GLDFSGGDSYTQLLLLSKRLIEGDLEHQWFEESLRQAYRNRAFKLYTIDKVIQSLVKHAH 1207

Query: 1136 TIITDPKTVEIMILFEKDRTCLNTSAKEQILYRLQVRSHMTTAENMFRIEYNRQSTHASI 1195
             I+TD K+ ++M LFEKDR   +T++K+QILYRLQ RSHM+T E+MFRIEYN + +  SI
Sbjct: 1208 AIMTDSKSSDVMALFEKDRISSSTTSKDQILYRLQTRSHMSTTEHMFRIEYNTKKSSISI 1267

Query: 1196 QFVAVDDLTLEEPKSLEDRWKYYVTSYSLSHPTEGISHEELQ---XXXXXXXXXXXXXXQ 1252
            Q++A+DDLTLEEPK+LED+WKYY+TSYSLSHPTEGI  EE++                 +
Sbjct: 1268 QYIALDDLTLEEPKTLEDKWKYYITSYSLSHPTEGIPQEEIKIPFLDKVIESEQVHMEDE 1327

Query: 1253 CENGEYSPEGVSSSNLKVKINPETYSLDVQPGSYDFFSRKSINKFPIEINNDTYKSKRGE 1312
             +N +YSPEGVS SNL +KI+PETY L+V+PGS+D FSRKS+NKFP+++ +++YK K+  
Sbjct: 1328 DDNPKYSPEGVSKSNLMIKIDPETYRLEVEPGSFDIFSRKSVNKFPVDVFSESYKVKKQT 1387

Query: 1313 KAKCLTSYLNGAKGWKRGLVASKVLKAQTEIEYVKTKGTL------VGLESXXXXXXXXX 1366
            +     ++LNG  GWKR L +  + K + +   +K  GT          E+         
Sbjct: 1388 RRNRCKNFLNGKHGWKRQLSSDAISKIEQKFNDLKN-GTFQQRSRSATSETTSVPLNASD 1446

Query: 1367 XXXGENKSYTFSTGQLHDHEEDKPISHQE-EPESKGNDTTTEEFEGE 1412
                E +S T ++       +  PI+  E + E +GNDTTTEE E E
Sbjct: 1447 STQKEQES-TGTSETSQPALQKVPINSAEPDQEERGNDTTTEEVESE 1492

 Score =  185 bits (469), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 102/138 (73%), Gaps = 7/138 (5%)

Query: 116 SGTGFSVASLNNPLPEXXXXXXXXXXXXXXXXXXXXXPQDPSY-RPLNVKDALSYLEQVK 174
           + T  SVAS +NPLP                        D SY RPLNVKDAL+YLEQVK
Sbjct: 82  TSTTLSVASFDNPLPPAPAAHLQQQQQQQQQQQQA----DGSYYRPLNVKDALTYLEQVK 137

Query: 175 FQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYPNLIQGFNTFLPQGYKIEC 234
            QFN+RPD+YNHFLDIMKDFKSQ+IDTPGVIERVS LF+GYPNLIQGFNTFLPQGY IEC
Sbjct: 138 LQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFNTFLPQGYTIEC 197

Query: 235 SSNPNDPHPIKVTTPFGT 252
           SSNP+D  PIKVTTP G+
Sbjct: 198 SSNPDD--PIKVTTPLGS 213

 Score =  109 bits (273), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 55/59 (93%)

Query: 334 KKGGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 392
           +K  DVEFS A+SYVNKIK RFA+QPDIYKHFLEILQTYQREQKPI+EVYAQVTVLFQN
Sbjct: 356 EKPADVEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQN 414

 Score = 55.5 bits (132), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 46/71 (64%), Gaps = 2/71 (2%)

Query: 159 RPLNVK--DALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYP 216
           +P +V+   A+SY+ ++K +F ++PD+Y HFL+I++ ++ +      V  +V+ LFQ  P
Sbjct: 357 KPADVEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNAP 416

Query: 217 NLIQGFNTFLP 227
           +L+  F  FLP
Sbjct: 417 DLLDDFKKFLP 427

 Score = 40.8 bits (94), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 32/48 (66%)

Query: 344 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 391
           A++Y+ ++K +F  +PDIY HFL+I++ ++ +      V  +V+ LF+
Sbjct: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFR 176

>NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6.29
            YOL004W
          Length = 1434

 Score = 1165 bits (3015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 608/1068 (56%), Positives = 729/1068 (68%), Gaps = 74/1068 (6%)

Query: 333  AKKGGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 392
            + K  +VEFS AI+YVNKIK RFA+QPDIYK FLEILQTYQREQKPINEVY+QVTVLFQ+
Sbjct: 352  SAKNAEVEFSQAINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVTVLFQH 411

Query: 393  XXXXXXXXXXXXXXXSAPQSTTTPAPVNGGTFYXXXXXXXXXXXXXXXXXXXXXXAREGE 452
                           S   ST+   P N G                            G 
Sbjct: 412  APDLLDDFKKFLPESSGTTSTSE-LPQNAGIQQRAAIPTPNPKHQQYGYPNNYYPNGTGT 470

Query: 453  HVGLPAV---QPPSMDIS-------------GQPQ-----QHI-------ITQGMSNDDI 484
               LP +    PP+   S             G P      Q +       +  G +N+ I
Sbjct: 471  QQNLPPIGSFAPPNGTASREYAPGNQFVGPGGLPSMIPNDQALQQQQQPGLVHGYTNEAI 530

Query: 485  PISEVRN-TADGAY-------------RSDLRNSGEV---QYM-EPVARPEIDLDPSLXX 526
            P+S +R+   D  Y             + D+ N+      QY  E   RPEIDLDPS+  
Sbjct: 531  PVSNLRSPLTDQQYPNLLNMQNQMTPGQMDINNATAPMAQQYTNEAPIRPEIDLDPSIVP 590

Query: 527  XXXXXXXXMENEVSLVEETSFFDKAKKFIGNKQIYTEFLKILNLYSQDLLDRDELVEKVE 586
                    +E  VSLVEET+FF+KAKKFIG KQ+YTEFLKILNLYSQDLL  DEL  KVE
Sbjct: 591  VIPEPTEPLEYNVSLVEETNFFEKAKKFIGTKQVYTEFLKILNLYSQDLLTTDELCVKVE 650

Query: 587  YYLGGNKELFDWFKNFVGYEKKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKADTFMPC 646
            YYLG N+ELF WFKNFVG+++KP  IENIVHEKH+LDLDLCEACGPSYKKLPK DTFMPC
Sbjct: 651  YYLGSNEELFTWFKNFVGFQEKPLIIENIVHEKHKLDLDLCEACGPSYKKLPKTDTFMPC 710

Query: 647  SGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIEANLRT 706
            SGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEE+LFK EEERHEYDF IE+NLRT
Sbjct: 711  SGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEESLFKTEEERHEYDFCIESNLRT 770

Query: 707  IQTLETIANKIANMTPEEKATFKLSPGLGHTSVTIYKKVIRKVYDKDRGFEIIDALHETP 766
            IQTLETIANKI NMT EEK  FKL PGLGHTS TIYKKVIRKVYDKDRGFEIID LHE P
Sbjct: 771  IQTLETIANKIGNMTNEEKKNFKLPPGLGHTSSTIYKKVIRKVYDKDRGFEIIDLLHEEP 830

Query: 767  SIAVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQ 826
            ++ VP+VLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQ
Sbjct: 831  ALTVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQ 890

Query: 827  LVSEISTIKVDQANKRIHPLTPKPKSQLDYHFKDREVLYDILNLAKVFIDCNTTYSNPDK 886
            L+SEIS+IKVDQ NKRIH LTPKPKSQL++ F D ++  DIL L  VFI+ ++TYSNP+K
Sbjct: 891  LLSEISSIKVDQTNKRIHWLTPKPKSQLEFQFDDNDIFVDILGLTSVFINHSSTYSNPEK 950

Query: 887  EKMFDFLKSFLVLFFSYPMYEVETAFARRRGDIGVQDGEENSGQENSD----------LS 936
            E+M DFL+ F+ LFFS P+ +V  A + R   +  ++ +      N D           S
Sbjct: 951  ERMKDFLRVFVSLFFSIPLDKVNEALSDRSHWLQEKEKKTKESSRNIDSTTSSSSSGSNS 1010

Query: 937  RKRTREEENLLKDVLRRNKYQKGRNXXXXXXXXXXXXX--------XXXXXXXXXXXXXX 988
            +KR    +  L D+LR++KYQK R                                    
Sbjct: 1011 KKRPLNIDIPLADILRKHKYQKIRKQAKESNEENAQEEDDENIVGDSNEELNEQDENEII 1070

Query: 989  XXXXXXPWLLGSIVDEANEHGFVENRKTFNMFANTNIYVFFRHLATLYTRLSEVKDINEA 1048
                  PWLLG+I++ A+ HG + NRK FNMFANTNIYVFFR    +Y RL E+K INE 
Sbjct: 1071 LEEIKRPWLLGNIIETASNHGTISNRKVFNMFANTNIYVFFRLWTVIYERLYEMKQINEK 1130

Query: 1049 VTEEIKNRKVVQFAKDLNLISTQLSDMGLDFEGADAYGQVLTLSKRLIEGDIEHQWFEES 1108
            VT+E+ +R++ QFAKDLNLISTQL DMGLDF G ++Y ++L LSKRLI+ DIEHQWFEES
Sbjct: 1131 VTKEVNSRRISQFAKDLNLISTQLKDMGLDFVGVNSYQELLVLSKRLIQNDIEHQWFEES 1190

Query: 1109 LRQAYKNKAFKIYTIDKVVQSLVKHAHTIITDPKTVEIMILFEKDRTCLNTSAKEQILYR 1168
            LRQA+ NKAFK+YT+DKV+QSLVKHAHTI+ D KT EIM+LFEKDR C +TSAKEQILYR
Sbjct: 1191 LRQAFNNKAFKLYTVDKVIQSLVKHAHTILGDVKTSEIMVLFEKDRLCSSTSAKEQILYR 1250

Query: 1169 LQVRSHMTTAENMFRIEYNRQSTHASIQFVAVDDLTLEEPKSLEDRWKYYVTSYSLSHPT 1228
            LQ R+HMT  ENMFRIE+N +  H  IQ++A++DLT+++PKS+E  W+YYVTSYSL HPT
Sbjct: 1251 LQTRAHMTNTENMFRIEFNEEKNHVCIQYIALEDLTIKQPKSMEKNWEYYVTSYSLPHPT 1310

Query: 1229 EGISHEELQXXXXXXXXXXXXXXQCENGEYSPEGVSSSNLKVKINPETYSLDVQPGSYDF 1288
            EG+  +EL+              + +N + SPEGVSSS LK+KI+P++Y+L+++PGS+D 
Sbjct: 1311 EGVPQDELKIPFLEKTLELEVDEEGDN-KSSPEGVSSSKLKIKIDPKSYALEIEPGSFDL 1369

Query: 1289 FSRKSINKFPIEINNDTY--KSKRGEKAKCLTSYLNGAKGWKRGLVAS 1334
            FSRKS+N +P      TY  ++K+ +    +T +L+G  GWK+ L  +
Sbjct: 1370 FSRKSMNVYP------TYSDETKKRKSIDQMTKFLDGKNGWKKNLTTA 1411

 Score =  173 bits (438), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 83/121 (68%), Positives = 101/121 (83%), Gaps = 5/121 (4%)

Query: 154 QDPSYRPLNVKDALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQ 213
           QD +YRPLNVKDALSYLEQVK+QF+ RPD+YN FLDIMKDFKSQ+IDTPGVIERVS LF+
Sbjct: 203 QDLAYRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFR 262

Query: 214 GYPNLIQGFNTFLPQGYKIECSSNPNDPHPIKVTTPFGTTGSVTLNTAPLEQRYPSNENV 273
           GYP L+QGFNTFLPQGY+IEC+++P+   PI+VTTP GT+   TL+  P  +   S+E+ 
Sbjct: 263 GYPMLVQGFNTFLPQGYRIECTTDPDG--PIRVTTPMGTS---TLSGGPAMEAPSSSESN 317

Query: 274 L 274
           L
Sbjct: 318 L 318

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 48/79 (60%), Gaps = 2/79 (2%)

Query: 153 PQDPSYRPLNVK--DALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSN 210
           P+D S +   V+   A++Y+ ++K +F ++PD+Y  FL+I++ ++ +      V  +V+ 
Sbjct: 348 PEDQSAKNAEVEFSQAINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVTV 407

Query: 211 LFQGYPNLIQGFNTFLPQG 229
           LFQ  P+L+  F  FLP+ 
Sbjct: 408 LFQHAPDLLDDFKKFLPES 426

 Score = 40.4 bits (93), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 33/48 (68%)

Query: 344 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 391
           A+SY+ ++K +F+++PDIY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 215 ALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFR 262

>TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1512

 Score = 1130 bits (2923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/865 (63%), Positives = 664/865 (76%), Gaps = 21/865 (2%)

Query: 494  DGAYRSDLRNSGEVQYMEPVARPEIDLDPSLXXXXXXXXXXMENEVSLVEETSFFDKAKK 553
            DG Y  D+             RPEIDLDPS+          +E+ +SLVEET+FFDKAKK
Sbjct: 613  DGGYPQDIS-----------VRPEIDLDPSIVPVIPEPVEPIEDSLSLVEETNFFDKAKK 661

Query: 554  FIGNKQIYTEFLKILNLYSQDLLDRDELVEKVEYYLGGNKELFDWFKNFVGYEKKPKHIE 613
            FI NKQIY EFLKILNLYSQ++L+ +ELVEKV+YYLG NKELFDWFK FVGY+ KPKHIE
Sbjct: 662  FINNKQIYMEFLKILNLYSQNILNVNELVEKVQYYLGSNKELFDWFKGFVGYQDKPKHIE 721

Query: 614  NIVHEKHRLDLDLCEACGPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSG 673
            NIVHEKH+LDLDLCEA GPSYKKLPK DTFMPCSGRDEMCWEVLND+WVGHPVWASEDSG
Sbjct: 722  NIVHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDEMCWEVLNDDWVGHPVWASEDSG 781

Query: 674  FIAHRKNQYEETLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLSPG 733
            FIAHRKNQYEETLFKIEEERHEYDFYIE+NLRTIQTLETIA+KIANMT EE+A FKL  G
Sbjct: 782  FIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEERANFKLPIG 841

Query: 734  LGHTSVTIYKKVIRKVYDKDRGFEIIDALHETPSIAVPIVLKRLKQKDEEWRRAQREWNK 793
            LGHTSVTIY+KVIRKVY K+RGFE+IDALHE P++AVPI+LKRLKQKDEEWRRAQREWNK
Sbjct: 842  LGHTSVTIYQKVIRKVYGKERGFELIDALHEYPAVAVPIILKRLKQKDEEWRRAQREWNK 901

Query: 794  VWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLVSEISTIKVDQANKRIHPLTPKPKSQ 853
            VWREL+QKVYYKSLDHLGLTFKQADKKLLTTKQL+SEIS+IKVDQ NK++H LTPKPKSQ
Sbjct: 902  VWRELQQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKLHWLTPKPKSQ 961

Query: 854  LDYHFKDREVLYDILNLAKVFIDCNTTYSNPDKEKMFDFLKSFLVLFFSYPMYEVETAFA 913
            LDY   DR++LYDIL L  VFI+  + YSNPDKE++ DFL+SF+ LFF  P+ +++ A  
Sbjct: 962  LDYKVADRQILYDILKLTDVFINHTSNYSNPDKERLRDFLQSFISLFFFIPLADIKAAIK 1021

Query: 914  RRRG-DIGVQDGEENSGQENSDLSRKRTREEENL-LKDVLRRNKYQKGRNXXXXXXXXXX 971
             R   D    D EE+SG ++    +KR+ E++++   D+L + KYQK +           
Sbjct: 1022 IRSPLDDTKTDSEESSG-DSDKFPKKRSIEDDDISFHDILDKVKYQKVK---QGLDKNET 1077

Query: 972  XXXXXXXXXXXXXXXXXXXXXXXPWLLGSIVDEANEHGFVENRKTFNMFANTNIYVFFRH 1031
                                   PWLLGSIVD+AN  G ++NR  +N+F NTNIYVF RH
Sbjct: 1078 FSNDISSATSVDDDELIRQEAQKPWLLGSIVDDANSLGIIQNRSKYNIFGNTNIYVFIRH 1137

Query: 1032 LATLYTRLSEVKDINEAVTEEIKNRKVVQFAKDLNLISTQLSDMGLDFEGADAYGQVLTL 1091
            L TLY RL+E K +N  VTEEIKNR +V FAKDLNL+STQL +MGLDFEG D+Y Q+L L
Sbjct: 1138 LITLYERLNEAKQMNAEVTEEIKNRSIVPFAKDLNLVSTQLKNMGLDFEGTDSYKQLLDL 1197

Query: 1092 SKRLIEGDIEHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHTIITDPKTVEIMILFE 1151
            S RLIEG++EH WFEESLRQA++NKAFK+YTIDKV QS+VKHAHTI++D KT EIM+L E
Sbjct: 1198 STRLIEGNLEHHWFEESLRQAFRNKAFKLYTIDKVTQSIVKHAHTIMSDTKTAEIMMLME 1257

Query: 1152 KDRTCLNTSAKEQILYRLQVRSHMTTAENMFRIEYNRQSTHASIQFVAVDDLTLEEPKSL 1211
            KDR+C  TS+K+QILYRLQ RSHM+T +NMFRIE+N+ S + SIQ++ +DDLTL EPK+ 
Sbjct: 1258 KDRSCATTSSKDQILYRLQARSHMSTTDNMFRIEFNKSSDNISIQYIGMDDLTLGEPKTA 1317

Query: 1212 EDRWKYYVTSYSLSHPTEGISHEELQ----XXXXXXXXXXXXXXQCENGEYSPEGVSSSN 1267
            E++WKYY+TSY+LSHPTEG+  EE+Q                  +  N +YSP+GVS S+
Sbjct: 1318 EEKWKYYITSYALSHPTEGVPQEEIQIPFLEKILETEEAYAEEEEVINDKYSPKGVSQSD 1377

Query: 1268 LKVKINPETYSLDVQPGSYDFFSRKSINKFPIEINNDTYKSKRGEKAKCLTSYLNGAKGW 1327
            LK+KI+PE Y+L+++PGS+D FSR S+NK+PI++ +D YK+K+      + ++LNG  GW
Sbjct: 1378 LKIKISPENYALEIEPGSFDTFSRLSMNKYPIDVTSDDYKNKKKLSIDRVNAFLNGKFGW 1437

Query: 1328 KRGLVASKVLKAQTEIEYVKTKGTL 1352
            K+ L   ++     +  ++K  G+L
Sbjct: 1438 KQSLSEDEINNINLKYSHIKKYGSL 1462

 Score =  176 bits (446), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 89/95 (93%), Gaps = 2/95 (2%)

Query: 158 YRPLNVKDALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYPN 217
           YRPLNVKDAL+YLEQVK QF++RPD+YNHFLDIMKDFKSQ+IDTPGVIERVS LF+GYP+
Sbjct: 142 YRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPS 201

Query: 218 LIQGFNTFLPQGYKIECSSNPNDPHPIKVTTPFGT 252
           LIQGFNTFLPQGY IEC++NPND  PIKVTTP G+
Sbjct: 202 LIQGFNTFLPQGYTIECTNNPND--PIKVTTPIGS 234

 Score =  100 bits (249), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 45/61 (73%), Positives = 54/61 (88%)

Query: 332 LAKKGGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 391
           + +K  DVEFS A+SYVNKIK RF ++PDIYK FLEILQTYQ+EQKPI+EVY+QVT+LFQ
Sbjct: 345 ITEKPADVEFSQAVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQ 404

Query: 392 N 392
           N
Sbjct: 405 N 405

 Score = 49.7 bits (117), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 44/71 (61%), Gaps = 2/71 (2%)

Query: 159 RPLNVK--DALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYP 216
           +P +V+   A+SY+ ++K +F + PD+Y  FL+I++ ++ +      V  +V+ LFQ  P
Sbjct: 348 KPADVEFSQAVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQNAP 407

Query: 217 NLIQGFNTFLP 227
           +L+  F  FLP
Sbjct: 408 DLLDDFKKFLP 418

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 33/48 (68%)

Query: 344 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 391
           A++Y+ ++K +F+ +PDIY HFL+I++ ++ +      V  +V+ LF+
Sbjct: 150 ALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFR 197

>KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_6.29
            YOL004W
          Length = 1479

 Score = 1095 bits (2832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/941 (58%), Positives = 670/941 (71%), Gaps = 55/941 (5%)

Query: 464  MDISGQPQQHIITQGMSNDDIPISEVRNT--ADGA------------YRSDLRNSGEVQ- 508
            +D++  P+  + TQG+SND+IP+S+VR     +GA             + DL     +  
Sbjct: 517  IDMNNHPKPAVSTQGISNDEIPVSDVRMAQYPNGAVPDYGQYPTHPQMKPDLATQRHILQ 576

Query: 509  --------------------------YMEPVARPEIDLDPSLXXXXXXXXXXMENEVSLV 542
                                      Y+E   RPEIDLDPS+          +E+  +L+
Sbjct: 577  QQEIQQQQLMLQQQQEQELLEQQQQQYVEAPVRPEIDLDPSIVPVVPEPTEPIESNFTLI 636

Query: 543  EETSFFDKAKKFIGNKQIYTEFLKILNLYSQDLLDRDELVEKVEYYLGGNKELFDWFKNF 602
            EETSFFDKAKKFI NKQIYTEFLK+LNL+SQDL+  D+LV KVEYY+G +KELF+WF+NF
Sbjct: 637  EETSFFDKAKKFINNKQIYTEFLKVLNLFSQDLISVDDLVNKVEYYIGSSKELFEWFRNF 696

Query: 603  VGYEKKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKADTFMPCSGRDEMCWEVLNDEWV 662
            VGY+  PK IENIVHEKHRLDLDLCEACGPSYK+LPK+DTFMPCSGRD+MCWEVLNDEWV
Sbjct: 697  VGYQGNPKIIENIVHEKHRLDLDLCEACGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWV 756

Query: 663  GHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTP 722
            GHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD+YIE+NLRTIQTLE I NKI+NM+ 
Sbjct: 757  GHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLEAIVNKISNMSE 816

Query: 723  EEKATFKLSPGLGHTSVTIYKKVIRKVYDKDRGFEIIDALHETPSIAVPIVLKRLKQKDE 782
            EEK  FKL PGLGHTS+TIYKKVIRKVYDK+RGFEIIDALHE P+IA PIVLKRLKQKDE
Sbjct: 817  EEKKNFKLEPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAIAAPIVLKRLKQKDE 876

Query: 783  EWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLVSEISTIKVDQANKR 842
            EWRRAQREWNKVWRELEQKVY+KSLDHLGLTFKQADKKLLT KQL+SEIS+IKVDQ NKR
Sbjct: 877  EWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTIKQLISEISSIKVDQNNKR 936

Query: 843  IHPLTPKPKSQLDYHFKDREVLYDILNLAKVFIDCNTTYSNPDKEKMFDFLKSFLVLFFS 902
            IH LTPKPKSQL++  KD E+L+DIL+L++ FI+ ++TYS  DKE++ DFLKSF+ LFFS
Sbjct: 937  IHWLTPKPKSQLNFDIKDFEILFDILSLSENFINHSSTYSTSDKERLNDFLKSFISLFFS 996

Query: 903  YPMYEVETAFARRRGDIGVQDGEENSGQENSDLSRKRTREEENL-LKDVLRRNKYQKGR- 960
             P+ E+  A  +R      +   +++  + ++  +KR+  +  L + D+L R KYQK + 
Sbjct: 997  VPLNEINNALDKRNNQKNSEKVTDSALPDGTENQKKRSIHDIELSMSDILHRTKYQKMKL 1056

Query: 961  ----NXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPWLLGSIVDEANEHGFVENRKT 1016
                +                                 PWLLG I+D+ N  G + +RK 
Sbjct: 1057 SNRGSDSQEENNIDTIIDEESDERLAEEADLIRQDAKRPWLLGDIIDKTNTQGIITDRKK 1116

Query: 1017 FNMFANTNIYVFFRHLATLYTRLSEVKDINEAVTEEIKNRKVVQFAKDLNLISTQLSDMG 1076
            FN+FANTNIYVF RH  TLY RL E+K++N  VT+EI NRK V+FA+DL L+STQL +MG
Sbjct: 1117 FNLFANTNIYVFLRHWTTLYERLLELKEMNGEVTKEINNRKSVKFAEDLGLVSTQLKNMG 1176

Query: 1077 LDFEGADAYGQVLTLSKRLIEGDIEHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHT 1136
            LDF   D+Y ++L LSKRLIE DIEHQWFEESLRQAY N+AFK+YT+DKVVQ+LVKH HT
Sbjct: 1177 LDFVDKDSYEELLRLSKRLIENDIEHQWFEESLRQAYNNRAFKLYTVDKVVQALVKHGHT 1236

Query: 1137 IITDPKTVEIMILFEKDRTCLNTSAKEQILYRLQVRSHMTTAENMFRIEYNRQSTHASIQ 1196
            ++TD KT E+M LFEKDR    TSAK+QILYRLQ RSHM+  E MFRIEYN+   +  IQ
Sbjct: 1237 LMTDYKTTEVMKLFEKDRLSSATSAKDQILYRLQARSHMSNTEYMFRIEYNKDDRNICIQ 1296

Query: 1197 FVAVDDLTLEEPKSLEDRWKYYVTSYSLSHPTEGISHEELQXXXXXXXXXXXXXXQC--- 1253
            ++A+DDLTL+E  + E++WKYYVTSYSL HPTEGI HE LQ                   
Sbjct: 1297 YIALDDLTLKEGNTEEEKWKYYVTSYSLPHPTEGIDHESLQIPFLQKILEFDQEELENND 1356

Query: 1254 ----ENGEYSPEGVSSSNLKVKINPETYSLDVQPGSYDFFSRKSINKFPIEINNDTYKSK 1309
                 NG+YSPEGVS+S  K+KI+P  Y+LD+Q GS+D FSRKS+NK+P+++N D    K
Sbjct: 1357 EENKSNGKYSPEGVSNSMYKIKIHPGNYALDIQTGSFDIFSRKSLNKYPVKVNEDHESLK 1416

Query: 1310 RGEKAKCLTSYLNGAKGWKRGLVASKVLKA-QTEIEYVKTK 1349
              +K   L ++L    GWK+ L     LK  ++E E  +T+
Sbjct: 1417 LNKKKNILNTFLESNNGWKKHLKKQLSLKKNESEPESAETR 1457

 Score =  182 bits (461), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 99/175 (56%), Positives = 114/175 (65%), Gaps = 18/175 (10%)

Query: 117 GTGFSVASLNNPLPEXXXXXXXXXXXXXXXXXXXXXPQ----------DPSYRPLNVKDA 166
           GTG SVAS +NPLP                       Q          D SYRPLNVKDA
Sbjct: 159 GTGVSVASFDNPLPPLNQQQSQPSFPAMHMRDQQQQQQMAAAPAAAEDDASYRPLNVKDA 218

Query: 167 LSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYPNLIQGFNTFL 226
           LSYLEQVK QFN+RPD+YN FLDIMKDFKSQ IDTPGVIERVS LF+GYP+LIQGFNTFL
Sbjct: 219 LSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRGYPSLIQGFNTFL 278

Query: 227 PQGYKIECSSNPNDPHPIKVTTPFGT------TGSVTLNTAPLEQRYPSNENVLL 275
           P GY+I+C SNPND  PIKVTTP G+      T SV    + L+Q+   ++N ++
Sbjct: 279 PTGYRIDCPSNPND--PIKVTTPIGSSTLHEMTRSVQRANSNLQQQQALSQNNMM 331

 Score =  109 bits (273), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 55/59 (93%)

Query: 334 KKGGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 392
           KK  DVEFS AI+YVNKIK RFA+QPDIYK+FLEILQTYQREQKPINEVYAQVT+LFQN
Sbjct: 363 KKPADVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQN 421

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 42/66 (63%)

Query: 166 ALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYPNLIQGFNTF 225
           A++Y+ ++K +F ++PD+Y +FL+I++ ++ +      V  +V+ LFQ  P+L+  F  F
Sbjct: 373 AINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQNAPDLLDDFKKF 432

Query: 226 LPQGYK 231
           LP   K
Sbjct: 433 LPDSSK 438

 Score = 39.3 bits (90), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 54/264 (20%), Positives = 100/264 (37%), Gaps = 52/264 (19%)

Query: 344 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNXXXXXXXXXXX 403
           A+SY+ ++K +F  +PDIY  FL+I++ ++ +      V  +V+ LF+            
Sbjct: 218 ALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRGY---------- 267

Query: 404 XXXXSAPQSTTTPAPVNG-GTFYXXXXXXXXXXXXXXXXXXXXXXAREGEHVGLPAVQPP 462
                       P+ + G  TF                            H    +VQ  
Sbjct: 268 ------------PSLIQGFNTFLPTGYRIDCPSNPNDPIKVTTPIGSSTLHEMTRSVQRA 315

Query: 463 SMDISGQPQQHIITQG--MSNDDIPISEVRNTADGAYRSDLRNSGEVQYMEPVARPEIDL 520
           + ++    QQ  ++Q   M    IPI  + N A+         +  VQ ++  A+ + + 
Sbjct: 316 NSNLQ---QQQALSQNNMMQQAQIPIGSISNNANL--------NAAVQSVDDQAK-QANK 363

Query: 521 DPSLXXXXXXXXXXMENEVSLVEETSFFDKAK-KFIGNKQIYTEFLKILNLYSQDLLDRD 579
            P+              +V   +  ++ +K K +F     IY  FL+IL  Y ++    +
Sbjct: 364 KPA--------------DVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPIN 409

Query: 580 ELVEKVEYYLGGNKELFDWFKNFV 603
           E+  +V        +L D FK F+
Sbjct: 410 EVYAQVTILFQNAPDLLDDFKKFL 433

>YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Component
            of the Sin3p-Rpd3p histone deacetylase complex, involved
            in transcriptional repression and activation of diverse
            processes, including mating-type switching and meiosis;
            involved in the maintenance of chromosomal integrity
          Length = 1536

 Score = 1091 bits (2821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/914 (59%), Positives = 668/914 (73%), Gaps = 21/914 (2%)

Query: 449  REGEHVGLPAVQP-PSMDISGQPQQHIITQGMSNDDIPISEVRNTADGAY--RSDLRNSG 505
            ++ +H+  P   P PS+   G    +++ QG++N++ P+S++R +    Y   S      
Sbjct: 561  QDQQHMQPPHFMPLPSIVQHGP---NMVHQGIANENPPLSDLRTSLTEQYAPSSIQHQQQ 617

Query: 506  EVQYMEPVA---------RPEIDLDPSLXXXXXXXXXXMENEVSLVEETSFFDKAKKFIG 556
              Q + P+A         RPEIDLDPS+          +EN +SL EE +FF+KAK++IG
Sbjct: 618  HPQSISPIANTQYGDIPVRPEIDLDPSIVPVVPEPTEPIENNISLNEEVTFFEKAKRYIG 677

Query: 557  NKQIYTEFLKILNLYSQDLLDRDELVEKVEYYLGGNKELFDWFKNFVGYEKKPKHIENIV 616
            NK +YTEFLKILNLYSQD+LD D+LVEKV++YLG NKELF WFKNFVGY++K K IENIV
Sbjct: 678  NKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFTWFKNFVGYQEKTKCIENIV 737

Query: 617  HEKHRLDLDLCEACGPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIA 676
            HEKHRLDLDLCEA GPSYK+LPK+DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIA
Sbjct: 738  HEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIA 797

Query: 677  HRKNQYEETLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLSPGLGH 736
            HRKNQYEETLFKIEEERHEYDFYIE+NLRTIQ LETI NKI NMT  EKA FKL PGLGH
Sbjct: 798  HRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGH 857

Query: 737  TSVTIYKKVIRKVYDKDRGFEIIDALHETPSIAVPIVLKRLKQKDEEWRRAQREWNKVWR 796
            TS+TIYKKVIRKVYDK+RGFEIIDALHE P++  P+VLKRLKQKDEEWRRAQREWNKVWR
Sbjct: 858  TSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWR 917

Query: 797  ELEQKVYYKSLDHLGLTFKQADKKLLTTKQLVSEISTIKVDQANKRIHPLTPKPKSQLDY 856
            ELEQKV++KSLDHLGLTFKQADKKLLTTKQL+SEIS+IKVDQ NK+IH LTPKPKSQLD+
Sbjct: 918  ELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDF 977

Query: 857  HFKDREVLYDILNLAKVFIDCNTTYSNPDKEKMFDFLKSFLVLFFSYPMYEVETAFARRR 916
             F D+ + YDIL LA  FI   T YSNPDKE++ D LK F+ LFFS    ++E +    +
Sbjct: 978  DFPDKNIFYDILCLADTFITHTTAYSNPDKERLKDLLKYFISLFFSISFEKIEESLYSHK 1037

Query: 917  GDIGVQDGEENSGQENSDLSRKRTREEENLLKDVLRRNKYQK-GRNXXXXXXXXXXXXXX 975
             ++        S   +S  SRKR  ++E  L D+L R++YQK  R+              
Sbjct: 1038 QNVSES---SGSDDGSSIASRKRPYQQEMSLLDILHRSRYQKLKRSNDEDGKVPQLSEPP 1094

Query: 976  XXXXXXXXXXXXXXXXXXXPWLLGSIVDEANEHGFVENRKTFNMFANTNIYVFFRHLATL 1035
                               PWL G++V+EAN  G ++NR  FN+FANTNIY+FFRH  T+
Sbjct: 1095 EEEPNTIEEEELIDEEAKNPWLTGNLVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTTI 1154

Query: 1036 YTRLSEVKDINEAVTEEIKNRKVVQFAKDLNLISTQLSDMGLDFEGADAYGQVLTLSKRL 1095
            Y RL E+K +NE VT+EI  R  V FAKDL+L+S+QLS+MGLDF G DAY QVL LS+RL
Sbjct: 1155 YERLLEIKQMNERVTKEINTRSTVTFAKDLDLLSSQLSEMGLDFVGEDAYKQVLRLSRRL 1214

Query: 1096 IEGDIEHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHTIITDPKTVEIMILFEKDRT 1155
            I GD+EHQWFEESLRQAY NKAFK+YTIDKV QSLVKHAHT++TD KT EIM LF KDR 
Sbjct: 1215 INGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRN 1274

Query: 1156 CLNTSAKEQILYRLQVRSHMTTAENMFRIEYNRQSTHASIQFVAVDDLTLEEPKSLEDRW 1215
               TSAK+QI+YRLQVRSHM+  ENMFRIE+++++ H SIQ++A+DDLTL+EPK+ ED+W
Sbjct: 1275 ASTTSAKDQIIYRLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKADEDKW 1334

Query: 1216 KYYVTSYSLSHPTEGISHEELQXXXXXXXXXXXXXXQCE--NGEYSPEGVSSSNLKVKIN 1273
            KYYVTSY+L HPTEGI HE+L+                   + E+SPEG+S S LK+KI 
Sbjct: 1335 KYYVTSYALPHPTEGIPHEKLKIPFLERLIEFGQDIDGTEVDEEFSPEGISVSTLKIKIQ 1394

Query: 1274 PETYSLDVQPGSYDFFSRKSINKFPIEINNDTYKSKRGEKAKCLTSYLNGAKGWKRGLVA 1333
            P TY L ++ GSYD F+RK+ NK+P   N++T K    +K + ++ +L+ A G +  L  
Sbjct: 1395 PITYQLHIENGSYDVFTRKATNKYPTIANDNTQKGMVSQKKELISKFLDCAVGLRNNLDE 1454

Query: 1334 SKVLKAQTEIEYVK 1347
            ++ L  Q + E +K
Sbjct: 1455 AQKLSMQKKWENLK 1468

 Score =  181 bits (459), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 87/108 (80%), Positives = 96/108 (88%), Gaps = 3/108 (2%)

Query: 155 DPSYRPLNVKDALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQG 214
           D  YRPLNVKDALSYLEQVKFQF++RPD+YN FLDIMKDFKSQAIDTPGVIERVS LF+G
Sbjct: 213 DADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRG 272

Query: 215 YPNLIQGFNTFLPQGYKIECSSNPNDPHPIKVTTPFGTTGSVTLNTAP 262
           YP LIQGFNTFLPQGY+IECSSNP+D  PI+VTTP GTT +V  N +P
Sbjct: 273 YPILIQGFNTFLPQGYRIECSSNPDD--PIRVTTPMGTT-TVNNNISP 317

 Score =  113 bits (283), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 55/60 (91%), Positives = 56/60 (93%)

Query: 333 AKKGGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 392
           AKK  DVEFS AISYVNKIKTRFA+QPDIYKHFLEILQTYQREQKPINEVYAQVT LFQN
Sbjct: 400 AKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQN 459

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 52/77 (67%), Gaps = 2/77 (2%)

Query: 153 PQDPSYRPLNVK--DALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSN 210
           PQ+ + + ++V+   A+SY+ ++K +F ++PD+Y HFL+I++ ++ +      V  +V++
Sbjct: 396 PQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTH 455

Query: 211 LFQGYPNLIQGFNTFLP 227
           LFQ  P+L++ F  FLP
Sbjct: 456 LFQNAPDLLEDFKKFLP 472

 Score = 38.1 bits (87), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 32/48 (66%)

Query: 344 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 391
           A+SY+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 224 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 271

>Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL004W
            (REAL)
          Length = 1566

 Score = 1089 bits (2816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/918 (59%), Positives = 669/918 (72%), Gaps = 28/918 (3%)

Query: 449  REGEHVGLPAVQP-PSMDISGQPQQHIITQGMSNDDIPISEVRNTADGAYR--------- 498
            ++ +H+  P + P PSM   G    +I+ QG++N+++P+S++R +    Y          
Sbjct: 592  QDQQHMQPPHLMPLPSMVQHGA---NIVHQGIANENLPLSDLRTSLTEQYAPSNIQQQQQ 648

Query: 499  ------SDLRNSGEVQYMEPVARPEIDLDPSLXXXXXXXXXXMENEVSLVEETSFFDKAK 552
                  S + NS   QY +   RPEIDLDPS+          +E+ +SL EE +FF+KAK
Sbjct: 649  QHPQSISPIANS---QYGDVPVRPEIDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAK 705

Query: 553  KFIGNKQIYTEFLKILNLYSQDLLDRDELVEKVEYYLGGNKELFDWFKNFVGYEKKPKHI 612
            ++IGNK +YTEFLKILNLYSQD+LD D+LVEKV++YLG NKELF WFKNFVGY+++ K I
Sbjct: 706  RYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQERTKFI 765

Query: 613  ENIVHEKHRLDLDLCEACGPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDS 672
            ENIVHEKHRLDLDLCEA GPSYK+LPK+DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDS
Sbjct: 766  ENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDS 825

Query: 673  GFIAHRKNQYEETLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLSP 732
            GFIAHRKNQYEETLFKIEEERHEYDFYIE+NLRTIQ LETI NKI NMT  EK  FKL P
Sbjct: 826  GFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKVNFKLPP 885

Query: 733  GLGHTSVTIYKKVIRKVYDKDRGFEIIDALHETPSIAVPIVLKRLKQKDEEWRRAQREWN 792
            GLGHTS+TIYKKVIRKVYDK+RGFEIIDALHE P++  P+VLKRLKQKDEEWRRAQREWN
Sbjct: 886  GLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWN 945

Query: 793  KVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLVSEISTIKVDQANKRIHPLTPKPKS 852
            KVWRELEQKV++KSLDHLGLTFKQADKKLLTTKQL+SEIS+IKVDQ NK+IH LTPKPKS
Sbjct: 946  KVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKS 1005

Query: 853  QLDYHFKDREVLYDILNLAKVFIDCNTTYSNPDKEKMFDFLKSFLVLFFSYPMYEVETAF 912
            QLD+ F D+ +  DIL LA  FI   T YSNPDKE++ D LK F+ LFFS  + E+E + 
Sbjct: 1006 QLDFDFPDKNIFCDILYLADSFISHTTAYSNPDKERLKDLLKYFISLFFSISLEEIEESL 1065

Query: 913  ARRRGDIGVQDGEENSGQENSDLSRKRTREEENLLKDVLRRNKYQK-GRNXXXXXXXXXX 971
               +  +        S    S +SRKR+ ++E  L D+L R++YQK  R+          
Sbjct: 1066 QAYKQSVSES---SGSDDGGSSVSRKRSYQQEMTLLDILHRSRYQKLKRSKDEDGKVPQL 1122

Query: 972  XXXXXXXXXXXXXXXXXXXXXXXPWLLGSIVDEANEHGFVENRKTFNMFANTNIYVFFRH 1031
                                   PWL G++V+EAN  G ++NR  FN+FANTNIY+FFRH
Sbjct: 1123 SEAPDEESNIIEEEELINEEAKNPWLTGNLVEEANSQGMIQNRGIFNLFANTNIYIFFRH 1182

Query: 1032 LATLYTRLSEVKDINEAVTEEIKNRKVVQFAKDLNLISTQLSDMGLDFEGADAYGQVLTL 1091
              T+Y RL E+K +NE VT+EI  R  V FAKDL+L+S QLS+MGLDF G DAY QVL L
Sbjct: 1183 WTTIYERLLEIKQMNEKVTKEINTRSTVTFAKDLDLLSNQLSEMGLDFIGEDAYKQVLKL 1242

Query: 1092 SKRLIEGDIEHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHTIITDPKTVEIMILFE 1151
            S+RLI GD+EHQWFEESLRQAY N+AFK+YTIDKV QSLVKHAHT++TD KT EIM LF 
Sbjct: 1243 SRRLINGDLEHQWFEESLRQAYNNRAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFV 1302

Query: 1152 KDRTCLNTSAKEQILYRLQVRSHMTTAENMFRIEYNRQSTHASIQFVAVDDLTLEEPKSL 1211
            KDR    TSAK QI+YRLQVRSHM+  ENMFRIE+++++ H SIQ++A+DDLTL+EPK  
Sbjct: 1303 KDRNVTTTSAKGQIIYRLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKED 1362

Query: 1212 EDRWKYYVTSYSLSHPTEGISHEELQXXXXXXXXXXXXXXQCENGE--YSPEGVSSSNLK 1269
            ED+WKYYVTSY+L HPTEG+ HE+L+                ++ +  +SPEG+S S LK
Sbjct: 1363 EDKWKYYVTSYALPHPTEGVLHEKLKIPFLERLIEFGQDIDGKDVDEKFSPEGISVSTLK 1422

Query: 1270 VKINPETYSLDVQPGSYDFFSRKSINKFPIEINNDTYKSKRGEKAKCLTSYLNGAKGWKR 1329
            +KI P TY LD++ GSYD F+RKS NK+P   N+DT+K    +K + ++ +L+ A   + 
Sbjct: 1423 IKIQPTTYKLDIENGSYDVFTRKSANKYPTVANDDTHKEVVVQKKELISRFLDCAVHLRN 1482

Query: 1330 GLVASKVLKAQTEIEYVK 1347
             L  S+ +  Q + E +K
Sbjct: 1483 DLNESQKISMQEKFESLK 1500

 Score =  182 bits (462), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 98/110 (89%), Gaps = 3/110 (2%)

Query: 156 PSYRPLNVKDALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGY 215
           P YRPLNVKDALSYLEQVKFQF++RPD+YN FLDIMKDFKSQAIDTPGVIERVS LF+GY
Sbjct: 227 PDYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGY 286

Query: 216 PNLIQGFNTFLPQGYKIECSSNPNDPHPIKVTTPFGTTGSVTLNTAPLEQ 265
           P LIQGFNTFLPQGY+IECS+NP+D  PI+VTTP GTT +V  N +P E+
Sbjct: 287 PILIQGFNTFLPQGYRIECSTNPDD--PIRVTTPMGTT-TVNNNISPPER 333

 Score =  112 bits (279), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 55/60 (91%)

Query: 333 AKKGGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 392
            KK  DVEFS AISYVNKIKTRFA+QPDIYKHFLEILQTYQREQKPINEVYAQVT LFQN
Sbjct: 413 VKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQN 472

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 51/86 (59%), Gaps = 12/86 (13%)

Query: 154 QDPSYRPLNVKD------------ALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDT 201
           Q P  +PL V++            A+SY+ ++K +F ++PD+Y HFL+I++ ++ +    
Sbjct: 400 QIPQIQPLAVQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPI 459

Query: 202 PGVIERVSNLFQGYPNLIQGFNTFLP 227
             V  +V++LFQ  P+L++ F  FLP
Sbjct: 460 NEVYAQVTHLFQNAPDLLEDFKKFLP 485

 Score = 38.1 bits (87), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 32/48 (66%)

Query: 344 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 391
           A+SY+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 237 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 284

>Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL004W
            (REAL)
          Length = 1561

 Score = 1084 bits (2803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/918 (58%), Positives = 670/918 (72%), Gaps = 21/918 (2%)

Query: 449  REGEHVGLPAVQP-PSMDISGQPQQHIITQGMSNDDIPISEVRNTADGAY---------- 497
            ++ +H+  P + P PSM   G    +++ QG+ N++IP+S++R +    Y          
Sbjct: 585  QDQQHMQPPHLMPLPSMVQQGP---NMVHQGIVNENIPLSDLRTSLTDQYAPSNFQQQQQ 641

Query: 498  -RSDLRNSGEVQYMEPVARPEIDLDPSLXXXXXXXXXXMENEVSLVEETSFFDKAKKFIG 556
             +  +    + QY +   RPEIDLDPS+          +E+ +SL EE +FF+KAK++IG
Sbjct: 642  QQPSISPIIDSQYGDVPVRPEIDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIG 701

Query: 557  NKQIYTEFLKILNLYSQDLLDRDELVEKVEYYLGGNKELFDWFKNFVGYEKKPKHIENIV 616
            NK +YTEFLKILNLYSQD+LD D+LVEKV++YLG NKELF WFKNFVGY++K K IEN+V
Sbjct: 702  NKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQEKIKSIENVV 761

Query: 617  HEKHRLDLDLCEACGPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIA 676
            HEKHRLDLDLCEA GPSYK+LPK+DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIA
Sbjct: 762  HEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIA 821

Query: 677  HRKNQYEETLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLSPGLGH 736
            HRKNQYEETLFKIEEERHEYDFYIE+NLRTIQ LETI NKI NMT  EKA FKL PGLGH
Sbjct: 822  HRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGH 881

Query: 737  TSVTIYKKVIRKVYDKDRGFEIIDALHETPSIAVPIVLKRLKQKDEEWRRAQREWNKVWR 796
            TS+TIYKKVIRKVYDK+RGFEIIDALHE P++  P+VLKRLKQKDEEWRRAQREWNKVWR
Sbjct: 882  TSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWR 941

Query: 797  ELEQKVYYKSLDHLGLTFKQADKKLLTTKQLVSEISTIKVDQANKRIHPLTPKPKSQLDY 856
            ELEQKVY+KSLDHLGLTFKQADKKLLTTKQL+SEIS+IKVDQ NK+IH LTPKPKSQLD+
Sbjct: 942  ELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDF 1001

Query: 857  HFKDREVLYDILNLAKVFIDCNTTYSNPDKEKMFDFLKSFLVLFFSYPMYEVETAFARRR 916
             F D+++ YDIL LA  FI   T YSNPDKE++ D L  F+ LFFS P+ ++E A    +
Sbjct: 1002 DFPDKDIFYDILYLADSFIAHTTAYSNPDKERLKDLLNYFISLFFSIPLEKIEEALQSYK 1061

Query: 917  GDIGVQDGEENSGQENSDLSRKRTREEENLLKDVLRRNKYQK-GRNXXXXXXXXXXXXXX 975
             ++    G ++         RKR  ++E  L D+L R+KYQK  R+              
Sbjct: 1062 QNLSDSSGSDDGDSSTP---RKRPYQQEMSLLDILHRSKYQKLKRSNDEDGKVPQLSEPL 1118

Query: 976  XXXXXXXXXXXXXXXXXXXPWLLGSIVDEANEHGFVENRKTFNMFANTNIYVFFRHLATL 1035
                               PWL G++V+EAN  G ++NR  FN+FAN+NIY+FFRH  T+
Sbjct: 1119 DEESNAIEEEELINEEAKNPWLTGNLVEEANSQGIIQNRNIFNLFANSNIYIFFRHWTTI 1178

Query: 1036 YTRLSEVKDINEAVTEEIKNRKVVQFAKDLNLISTQLSDMGLDFEGADAYGQVLTLSKRL 1095
            Y RL E+K +NE VT+EI  R +V FAKDL+L+S+QLS+MGLDF G DAY QVL LS+RL
Sbjct: 1179 YERLLEIKQMNEKVTKEISKRSMVTFAKDLDLLSSQLSEMGLDFNGEDAYKQVLKLSRRL 1238

Query: 1096 IEGDIEHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHTIITDPKTVEIMILFEKDRT 1155
            I G++EHQWFEE LRQAY NKAFK+YTIDKV+Q LVKHAHT++TD KT EIM LF KDR 
Sbjct: 1239 INGELEHQWFEEGLRQAYNNKAFKLYTIDKVIQLLVKHAHTLMTDAKTAEIMALFVKDRN 1298

Query: 1156 CLNTSAKEQILYRLQVRSHMTTAENMFRIEYNRQSTHASIQFVAVDDLTLEEPKSLEDRW 1215
               TSAK+QI+YRLQ RS+M+  ENMFR+E++R++ H S+Q++A+DDLTL+EP++ ED+W
Sbjct: 1299 ASTTSAKDQIIYRLQARSYMSNTENMFRMEFDRRNLHVSVQYIALDDLTLKEPRADEDKW 1358

Query: 1216 KYYVTSYSLSHPTEGISHEELQXXXXXXXXXXXXXXQCE--NGEYSPEGVSSSNLKVKIN 1273
            KYYVTSY+L HPTEGISHE+L+                   + ++SPEG+S S LK+KI 
Sbjct: 1359 KYYVTSYALPHPTEGISHEKLKIPFLERLIEYGQDTDGREVDEKFSPEGLSVSTLKIKIQ 1418

Query: 1274 PETYSLDVQPGSYDFFSRKSINKFPIEINNDTYKSKRGEKAKCLTSYLNGAKGWKRGLVA 1333
            P TY L ++ GSYD F+RK+ NK+P   N+D +K    +K   ++ +L+ A   +  L  
Sbjct: 1419 PVTYKLHIESGSYDVFTRKAANKYPTVANDDIHKEMVVKKTGLISKFLDNAIRLRNDLNE 1478

Query: 1334 SKVLKAQTEIEYVKTKGT 1351
            +K L  Q +++ +K   T
Sbjct: 1479 TKKLSMQEKLDSLKGATT 1496

 Score =  186 bits (473), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 104/122 (85%), Gaps = 8/122 (6%)

Query: 154 QDPSYRPLNVKDALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQ 213
           +DP YRPLNVKDALSYLEQVKFQFN+RPD+YN FLDIMKDFKSQAIDTPGVIERVS LF+
Sbjct: 63  EDPDYRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 122

Query: 214 GYPNLIQGFNTFLPQGYKIECSSNPNDPHPIKVTTPFGTTGSVTLNTAP-----LEQRYP 268
           GYP LIQGFNTFLPQGY+IECS+NP+D  PI+VTTP GTT +V  N +P     LE + P
Sbjct: 123 GYPILIQGFNTFLPQGYRIECSTNPDD--PIRVTTPMGTT-TVNNNVSPPARSALEPQEP 179

Query: 269 SN 270
           S+
Sbjct: 180 SS 181

 Score =  112 bits (279), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 55/60 (91%)

Query: 333 AKKGGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 392
            KK  DVEFS AISYVNKIKTRFA+QPDIYKHFLEILQTYQREQKPINEVYAQVT LFQN
Sbjct: 248 VKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQN 307

 Score = 57.0 bits (136), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 43/62 (69%)

Query: 166 ALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYPNLIQGFNTF 225
           A+SY+ ++K +F ++PD+Y HFL+I++ ++ +      V  +V++LFQ  P+L++ F  F
Sbjct: 259 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 318

Query: 226 LP 227
           LP
Sbjct: 319 LP 320

 Score = 37.0 bits (84), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 31/48 (64%)

Query: 344 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 391
           A+SY+ ++K +F  +PDIY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 75  ALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 122

>Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL004W
            (REAL)
          Length = 1555

 Score = 1082 bits (2798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/891 (59%), Positives = 658/891 (73%), Gaps = 21/891 (2%)

Query: 449  REGEHVGLPAVQP-PSMDISGQPQQHIITQGMSNDDIPISEVRNT-----ADGAYRSDLR 502
            ++ +H+  P + P PSM   G    +++ QG++N+++PIS++R +     A   ++   +
Sbjct: 579  QDQQHMQPPHLVPLPSMVQHGP---NMVHQGIANENLPISDLRTSLTDQYAPSTFQQQQQ 635

Query: 503  NS------GEVQYMEPVARPEIDLDPSLXXXXXXXXXXMENEVSLVEETSFFDKAKKFIG 556
            N        ++QY +   RPEIDLDPS+          +E+ +SL EE +FF+KAK++IG
Sbjct: 636  NPPSISPITDLQYGDVPVRPEIDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIG 695

Query: 557  NKQIYTEFLKILNLYSQDLLDRDELVEKVEYYLGGNKELFDWFKNFVGYEKKPKHIENIV 616
            NK +YTEFLKILNLYSQD+LD D+LVEKV++YLG NKELF WFKNFVGY++K K IENIV
Sbjct: 696  NKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQEKTKCIENIV 755

Query: 617  HEKHRLDLDLCEACGPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIA 676
            HEKHRLDLDLCEA GPSYK+LPK+DTFMPCSGRD+MCWE+LNDEWVGHPVWASEDSGFIA
Sbjct: 756  HEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEILNDEWVGHPVWASEDSGFIA 815

Query: 677  HRKNQYEETLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLSPGLGH 736
            HRKNQYEETLFKIEEERHEYDFYIE+NLRTIQ LETI NKI NMT  EK+ FKL PGLGH
Sbjct: 816  HRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTESEKSDFKLPPGLGH 875

Query: 737  TSVTIYKKVIRKVYDKDRGFEIIDALHETPSIAVPIVLKRLKQKDEEWRRAQREWNKVWR 796
            TS+TIYKKVIRKVYDK+RGFEIIDALHE P++  P+VLKRLKQKDEEWRRAQREWNKVWR
Sbjct: 876  TSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWR 935

Query: 797  ELEQKVYYKSLDHLGLTFKQADKKLLTTKQLVSEISTIKVDQANKRIHPLTPKPKSQLDY 856
            ELEQKV++KSLDHLGLTFKQADKKLLTTKQL+SEI++IKVDQ NK+IH LTPKPKSQLD+
Sbjct: 936  ELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEINSIKVDQTNKKIHWLTPKPKSQLDF 995

Query: 857  HFKDREVLYDILNLAKVFIDCNTTYSNPDKEKMFDFLKSFLVLFFSYPMYEVETAFARRR 916
             F D+++ YDIL LA  FI   T YSNPDKE++ D LK F+ LFFS P+ ++E A    +
Sbjct: 996  DFPDKDIFYDILYLADSFISHTTAYSNPDKERLKDLLKYFISLFFSIPLEKIEKALQFHK 1055

Query: 917  GDIGVQDGEENSGQENSDLSRKRTREEENLLKDVLRRNKYQK-GRNXXXXXXXXXXXXXX 975
             ++        S    S  SRKR  ++E  L D+L RN+YQK  R+              
Sbjct: 1056 ENVSES---SGSDDGGSSTSRKRPYQQEMSLLDILHRNRYQKLKRSNDEEGKIPQLSEPL 1112

Query: 976  XXXXXXXXXXXXXXXXXXXPWLLGSIVDEANEHGFVENRKTFNMFANTNIYVFFRHLATL 1035
                               PWL G++V+EAN  G ++NR  FN+FANTNIY+FFRH  T+
Sbjct: 1113 DEESNTIEEEELISEEARNPWLTGNLVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTTI 1172

Query: 1036 YTRLSEVKDINEAVTEEIKNRKVVQFAKDLNLISTQLSDMGLDFEGADAYGQVLTLSKRL 1095
            Y RL E+K +N  +T+E+  R  V FAKDL+L+S QL +MGLDF G DAY QVL LS+RL
Sbjct: 1173 YERLLEIKQMNGKITKEVNTRSTVTFAKDLDLLSNQLPEMGLDFIGEDAYKQVLRLSRRL 1232

Query: 1096 IEGDIEHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHTIITDPKTVEIMILFEKDRT 1155
            I GD+EHQWFEESLRQAY NKAFK+YTIDKV QSLVKHAHT++ D KT EIM LF KDR 
Sbjct: 1233 INGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMADVKTAEIMALFVKDRN 1292

Query: 1156 CLNTSAKEQILYRLQVRSHMTTAENMFRIEYNRQSTHASIQFVAVDDLTLEEPKSLEDRW 1215
               TSAK+QI+YRLQVRS+M+  ENMFRIE N++S H S+Q++A+DDLTL+EPK+ ED+W
Sbjct: 1293 AFTTSAKDQIIYRLQVRSYMSNIENMFRIELNKRSLHVSVQYIALDDLTLKEPKADEDKW 1352

Query: 1216 KYYVTSYSLSHPTEGISHEELQXXXXXXXXXXXXXXQCE--NGEYSPEGVSSSNLKVKIN 1273
            KYYVTSY L HPTEGISHE+L+                   + E+SPEG+S S L++KI 
Sbjct: 1353 KYYVTSYGLPHPTEGISHEKLKIPFLERLIEFGQDTDGREVDEEFSPEGISLSTLRIKIQ 1412

Query: 1274 PETYSLDVQPGSYDFFSRKSINKFPIEINNDTYKSKRGEKAKCLTSYLNGA 1324
            P TY L ++ GSYD F+RK++NK+P   N+D +K    +K   ++ +L  A
Sbjct: 1413 PITYKLHIENGSYDVFTRKAVNKYPTIANDDVHKEMVVQKTALISRFLENA 1463

 Score =  184 bits (466), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 87/109 (79%), Positives = 98/109 (89%), Gaps = 3/109 (2%)

Query: 154 QDPSYRPLNVKDALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQ 213
           +DP YRPLNVKDALSYLEQVKFQF++RPD+YN FLDIMKDFKSQAIDTPGVIERVS LF+
Sbjct: 220 EDPDYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 279

Query: 214 GYPNLIQGFNTFLPQGYKIECSSNPNDPHPIKVTTPFGTTGSVTLNTAP 262
           GYP LIQGFNTFLPQGY+IECS+NP+D  PI+VTTP GTT +V  N +P
Sbjct: 280 GYPILIQGFNTFLPQGYRIECSTNPDD--PIRVTTPMGTT-TVNNNVSP 325

 Score =  113 bits (283), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 55/60 (91%), Positives = 56/60 (93%)

Query: 333 AKKGGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 392
           AKK  DVEFS AISYVNKIKTRFA+QPDIYKHFLEILQTYQREQKPINEVYAQVT LFQN
Sbjct: 408 AKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQN 467

 Score = 57.0 bits (136), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 43/62 (69%)

Query: 166 ALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYPNLIQGFNTF 225
           A+SY+ ++K +F ++PD+Y HFL+I++ ++ +      V  +V++LFQ  P+L++ F  F
Sbjct: 419 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 478

Query: 226 LP 227
           LP
Sbjct: 479 LP 480

 Score = 38.1 bits (87), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 32/48 (66%)

Query: 344 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 391
           A+SY+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 232 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 279

>TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6.29
            YOL004W
          Length = 1739

 Score = 1061 bits (2744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/922 (56%), Positives = 664/922 (72%), Gaps = 23/922 (2%)

Query: 506  EVQYMEPVARPEIDLDPSLXXXXXXXXXXMENEVSLVEETSFFDKAKKFIGNKQIYTEFL 565
            +V Y E   RPEIDLDPSL          +E+ + LVEET+FFDK KK+IGNK IY EFL
Sbjct: 822  QVMYEENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGNKTIYAEFL 881

Query: 566  KILNLYSQDLLDRDELVEKVEYYLGGNKELFDWFKNFVGYEKKPKHIENIVHEKHRLDLD 625
            K+LNLYS DLL+ DELVEK++YYL  N+ELF WFKNFVGY +KPKHIENIVHEKH+LDLD
Sbjct: 882  KVLNLYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIENIVHEKHKLDLD 941

Query: 626  LCEACGPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEET 685
            LCEACGPSYKKLPK DT MPCSGRDEMCWE+LNDEWVGHPVWASEDSGFIAHRK   ++ 
Sbjct: 942  LCEACGPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFIAHRKINTKKP 1001

Query: 686  LFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLSPGLGHTSVTIYKKV 745
              +++++ HEYDFYIE+NLRTIQTLETIA+KIANMT  EK  FKL  GLGHT+ TIYKKV
Sbjct: 1002 YLRLKKKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDGLGHTTSTIYKKV 1061

Query: 746  IRKVYDKDRGFEIIDALHETPSIAVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYK 805
            IRKVYDK+RGFEIIDALHE P+IAVP+VLKRLKQKDEEWRRAQREWNKVWRELEQKV++K
Sbjct: 1062 IRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFK 1121

Query: 806  SLDHLGLTFKQADKKLLTTKQLVSEISTIKVDQANKRIHPLTPKPKSQLDYHFKDREVLY 865
            SLDHLGLTFKQADKKLLTTKQL+SEIS+IKVDQ +KR+H LTPKPKSQLD++  D+++++
Sbjct: 1122 SLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKDIIF 1181

Query: 866  DILNLAKVFIDCNTTYSNPDKEKMFDFLKSFLVLFFSYPMYEVETAFARR----RGDIGV 921
            DIL+  ++F++  +TYSNP+KE++ DF+K F  LFFS P+ E++ A ++R    + D  +
Sbjct: 1182 DILSFVEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAISKRDITEKNDEKL 1241

Query: 922  QDGEENSGQENSDLSRKRTREEENL-LKDVLRRNKYQKGRNXXXXXXXXXXXXXXXXXXX 980
            +D ++N G+EN   S+KRT  +  L L+D+L+R KYQ+ +                    
Sbjct: 1242 EDKQKN-GEEN---SKKRTSRDITLSLEDILQRTKYQRLK-YGDDSDEVDGHGNRHDDQK 1296

Query: 981  XXXXXXXXXXXXXXPWLLGSIVDEANEHGFVENRKTFNMFANTNIYVFFRHLATLYTRLS 1040
                          PWLLG++V+EAN  G + +R  FNMF+NTN+Y+F RHL T+Y RL 
Sbjct: 1297 LLEEEELLRQEAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFIRHLTTMYERLH 1356

Query: 1041 EVKDINEAVTEEIKNRKVVQFAKDLNLISTQLSDMGLDFEGADAYGQVLTLSKRLIEGDI 1100
            E+K +N+ V+ EI  RK+ +FAKDLNLISTQL++MGLDF   D Y Q+L L KRLI GD+
Sbjct: 1357 EIKQMNDKVSREISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLLVLCKRLILGDL 1416

Query: 1101 EHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHTIITDPKTVEIMILFEKDRTCLNTS 1160
            EHQWFEESLRQA+ NKAFK+YT+DKV Q+LVKHAHTII+D KT EIM LFEKDRT  +TS
Sbjct: 1417 EHQWFEESLRQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMALFEKDRTKNSTS 1476

Query: 1161 AKEQILYRLQVRSHMTTAENMFRIEYNRQSTHASIQFVAVDDLTLEEPKSLEDRWKYYVT 1220
            +K+QILYRLQ R+ MT  ENMFRIEYN  + H  IQ++A+DDLT+++ K+LE++WKYY+T
Sbjct: 1477 SKDQILYRLQTRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAKTLEEKWKYYIT 1536

Query: 1221 SYSLSHPTEGISHEELQXXXXXXXXXXXXXXQCENGE----------YSPEGVSSSNLKV 1270
            SY+LSHPTEGI  E +Q              + E  +          YSPEG+S S LK+
Sbjct: 1537 SYALSHPTEGIFQENIQIPFLERIIEEEQLYEDEETDDQKQTKSLMKYSPEGISGSTLKI 1596

Query: 1271 KINPETYSLDVQPGSYDFFSRKSINKFPIEINNDTYKSKRGEKAKCLTSYLNGAKGWKRG 1330
            KI+P+ Y L+++ GS+D FSRKS+N+FP+++  D+      +    +  +LN   GWKR 
Sbjct: 1597 KIDPQNYCLNIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLKNTVEKFLNSKMGWKRA 1656

Query: 1331 LVASKVLKAQTEIEYVKTKGTLVGLESXXXXXXXXXXXXGENKSYTFSTGQLHDHEEDKP 1390
            +   ++   +++ +++   G L G +                K     T  + +     P
Sbjct: 1657 ISKDQMESIESKWDHLSNNGNLEGYQEKSILKDVNGTDIS--KISPMKTFTVTESANGVP 1714

Query: 1391 ISHQEEPESKGNDTTTEEFEGE 1412
             + + + E +GNDTT EE   E
Sbjct: 1715 -NDKADGEERGNDTTAEEVGNE 1735

 Score =  179 bits (453), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 89/100 (89%), Gaps = 2/100 (2%)

Query: 154 QDPSYRPLNVKDALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQ 213
           +D  YRPLNVKDALSYLEQVKFQFN+RPDVYNHFLDIMKDFKSQAIDTPGVI RVS+LF 
Sbjct: 295 EDNQYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFH 354

Query: 214 GYPNLIQGFNTFLPQGYKIECSSNPNDPHPIKVTTPFGTT 253
            YP+LIQGFNTFLPQGY+IECSSNPN   PI V TP GTT
Sbjct: 355 DYPSLIQGFNTFLPQGYRIECSSNPN--LPITVITPMGTT 392

 Score =  104 bits (259), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 52/58 (89%)

Query: 334 KKGGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 391
           ++  DVEFS AISYVNKIK RFA QP IYKHFLEILQTYQREQKPINEVY+QVTVLFQ
Sbjct: 538 RRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQ 595

 Score = 52.8 bits (125), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 41/62 (66%)

Query: 166 ALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYPNLIQGFNTF 225
           A+SY+ ++K +F N+P +Y HFL+I++ ++ +      V  +V+ LFQ  P+L++ F  F
Sbjct: 548 AISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEAPDLLEDFKKF 607

Query: 226 LP 227
           LP
Sbjct: 608 LP 609

 Score = 42.4 bits (98), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 33/49 (67%)

Query: 344 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 392
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V A+V+ LF +
Sbjct: 307 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHD 355

>CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004w SIN3
            transcription regulatory protein
          Length = 1493

 Score = 1054 bits (2726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/916 (58%), Positives = 651/916 (71%), Gaps = 39/916 (4%)

Query: 471  QQHIITQGM-SNDDIPISEVRNTA-------------DGAYRSDLRNSGEVQY-MEPVAR 515
            QQ +++Q + SNDDIP+S +R T               G  +  + + G V    E V R
Sbjct: 535  QQQVLSQNIHSNDDIPVSNLRTTVVEQNYHPETIYQQQGNAQQHMVDGGYVGTPSELVVR 594

Query: 516  PEIDLDPSLXXXXXXXXXXMENEVSLVEETSFFDKAKKFIGNKQIYTEFLKILNLYSQDL 575
            PEIDLDPSL          +EN ++L+EET+FF++ KK IGNKQIY EFLKILNL+S DL
Sbjct: 595  PEIDLDPSLVPVVPEPTEPIENSLNLMEETNFFERVKKSIGNKQIYNEFLKILNLFSLDL 654

Query: 576  LDRDELVEKVEYYLGGNKELFDWFKNFVGYEKKPKHIENIVHEKHRLDLDLCEACGPSYK 635
            L  DELV+KVEYY+G NKELFDWFK FVGY+ KPK IENIVHEKH+LDLDLCEA GPSYK
Sbjct: 655  LTVDELVDKVEYYIGANKELFDWFKVFVGYQDKPKRIENIVHEKHKLDLDLCEAYGPSYK 714

Query: 636  KLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHE 695
            KLPK DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHE
Sbjct: 715  KLPKTDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHE 774

Query: 696  YDFYIEANLRTIQTLETIANKIANMTPEEKATFKLSPGLGHTSVTIYKKVIRKVYDKDRG 755
            YD+YIE+NLRTIQTLETIANKIANMT  EKA F+L PGLGHTS+TIYKKVIRKVYDK+RG
Sbjct: 775  YDYYIESNLRTIQTLETIANKIANMTDAEKAQFRLPPGLGHTSMTIYKKVIRKVYDKERG 834

Query: 756  FEIIDALHETPSIAVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFK 815
            FEIIDALH  P+I+VPI+L+RLKQKDEEWRRAQREWNK+WR+LEQKVY+KSLDHLGLTFK
Sbjct: 835  FEIIDALHNYPAISVPIILRRLKQKDEEWRRAQREWNKIWRDLEQKVYFKSLDHLGLTFK 894

Query: 816  QADKKLLTTKQLVSEISTIKVDQANKRIHPLTPKPKSQLDYHFKDREVLYDILNLAKVFI 875
            QADKKLLTTKQL+SEI+ IKVDQ +KRIH LTPKPK+QLDY F D ++L+DI+ L  VF 
Sbjct: 895  QADKKLLTTKQLISEINGIKVDQNSKRIHWLTPKPKNQLDYDFPDYDILFDIIALGFVFT 954

Query: 876  DCNTTYSNPDKEKMFDFLKSFLVLFFSYPMYEVETAFARRR-GDIGVQDGEENSG----- 929
                 YSNPDKE++ D L+ F+  FFS P+ EV  A  RR   D    D ++ SG     
Sbjct: 955  INTNLYSNPDKERIKDMLRVFVSQFFSIPLKEVSDALERRGFSDDNNNDSDKGSGKMDQI 1014

Query: 930  -------QENSDLSRKRTREEENLLKDVLRRNKYQKGR-NXXXXXXXXXXXXXXXXXXXX 981
                   ++++  S+KR  + +  + D+L + K QK + N                    
Sbjct: 1015 AEEIGETEQDTSSSKKRPFDNDLNMSDILHKTKQQKTKMNKEMDGSKSPSEDLGTDRNVG 1074

Query: 982  XXXXXXXXXXXXXPWLLGSIVDEANEHGFVENRKTFNMFANTNIYVFFRHLATLYTRLSE 1041
                          WL+G +VD AN+   ++NR  +N+FANTNIY+FFRHL TLY RLSE
Sbjct: 1075 TIEDSGSLSEHRKQWLVGDVVDSANKETPMDNRNIYNLFANTNIYIFFRHLVTLYERLSE 1134

Query: 1042 VKDINEAVTEEIKNRKVVQFAKDLNLISTQLSDMGLDFEGADAYGQVLTLSKRLIEGDIE 1101
            VK IN+ + +EIK+R+V  FAKDL LISTQLS++GLDF  +DAY Q+LTLSKRLIEGDIE
Sbjct: 1135 VKQINDEINKEIKSRRVTTFAKDLGLISTQLSELGLDFNSSDAYQQLLTLSKRLIEGDIE 1194

Query: 1102 HQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHTIITDPKTVEIMILFEKDRTCLNTSA 1161
            HQWFEES+RQAY N+AFK+YTIDKVVQS VKHAHT+I+D KT EIM+LFE  R    T+ 
Sbjct: 1195 HQWFEESIRQAYNNRAFKLYTIDKVVQSFVKHAHTLISDSKTSEIMLLFENQRNNTLTTT 1254

Query: 1162 KEQILYRLQVRSHMTTAENMFRIEYNRQSTHASIQFVAVDDLTLEEPKSLEDRWKYYVTS 1221
            K+QILYR+Q RSHM++ ENMFRIEY R+  HASIQ++A+DDLTL+  KS E+ W YYVTS
Sbjct: 1255 KDQILYRIQCRSHMSSTENMFRIEYKREKRHASIQYIALDDLTLKTAKSPEEAWNYYVTS 1314

Query: 1222 YSLSHPTEGISHEELQXXXXXXXXXXXXXXQCENGE---YSPEGVSSSNLKVKINPETYS 1278
            YSLS+PTEG+ HE L+                +NG    YS  G+S SNL + I+ E Y+
Sbjct: 1315 YSLSNPTEGVPHENLEVPFLEKVIEFDQEYSKDNGNNSTYSLAGISKSNLHIDIDREKYN 1374

Query: 1279 LDVQPGSYDFFSRKSINKFPIEINNDTYKSKRGEKAKCLTSYLNGAKGWKRGLVASKVLK 1338
            L +Q GS D +SR +I K+PI  ++++  +   EK + +   L+   G     V  K   
Sbjct: 1375 LILQGGSSDVYSRATIQKYPIVASDESRAANISEKTQEIRKVLSHYDGNSNDDVNEK--- 1431

Query: 1339 AQTEIEYVKTKGTLVG 1354
                  Y+   GT+ G
Sbjct: 1432 ----FNYILANGTIDG 1443

 Score =  191 bits (485), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 104/117 (88%), Gaps = 4/117 (3%)

Query: 155 DP-SYRPLNVKDALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQ 213
           DP SYRPLNVKDALSYLEQVKFQF+ RPD+YN FLDIMKDFKSQ IDTPGVIERVS+LF+
Sbjct: 181 DPMSYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFK 240

Query: 214 GYPNLIQGFNTFLPQGYKIECSSNPNDPHPIKVTTPFGTTGSVTLNTAPLEQRYPSN 270
           GYPNLIQGFNTFLPQGY+IECS+NPND  PIKVTTP G++ +V LNTAP +   PS+
Sbjct: 241 GYPNLIQGFNTFLPQGYRIECSNNPND--PIKVTTPMGSSTTV-LNTAPQKSPSPSD 294

 Score =  111 bits (277), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 52/60 (86%), Positives = 56/60 (93%)

Query: 333 AKKGGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 392
           AKK  DVEFS AI+YVNKIKTRFA+QPDIYK FLEILQTYQREQKPI+EVYAQVT+LFQN
Sbjct: 331 AKKPADVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQN 390

 Score = 50.8 bits (120), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 45/71 (63%), Gaps = 2/71 (2%)

Query: 159 RPLNVK--DALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYP 216
           +P +V+   A++Y+ ++K +F ++PD+Y  FL+I++ ++ +      V  +V+ LFQ  P
Sbjct: 333 KPADVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNAP 392

Query: 217 NLIQGFNTFLP 227
           +L+  F  FLP
Sbjct: 393 DLLDDFKKFLP 403

 Score = 36.2 bits (82), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 31/48 (64%)

Query: 344 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 391
           A+SY+ ++K +F  +PDIY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 193 ALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFK 240

>KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6.29
            YOL004W
          Length = 1492

 Score = 1042 bits (2694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/833 (61%), Positives = 617/833 (74%), Gaps = 19/833 (2%)

Query: 504  SGEVQYMEPVARPEIDLDPSLXXXXXXXXXXMENEVSLVEETSFFDKAKKFIGNKQIYTE 563
            SG++Q      RPEIDLDPS+          +EN +SL EETSFF+K KK IGN+QIY E
Sbjct: 603  SGDMQ-----VRPEIDLDPSIVPVVPEPTEPIENNLSLSEETSFFEKVKKNIGNRQIYIE 657

Query: 564  FLKILNLYSQDLLDRDELVEKVEYYLGGNKELFDWFKNFVGYEKKPKHIENIVHEKHRLD 623
            FLK+LNL+SQDL+  DELV KVE YL G  ELF+WFKNFVGY+ KPK IEN++HEKHRLD
Sbjct: 658  FLKVLNLFSQDLIAVDELVTKVENYLAGQPELFEWFKNFVGYQDKPKIIENVIHEKHRLD 717

Query: 624  LDLCEACGPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE 683
            LDLCEA GPSYKKLPK+DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE
Sbjct: 718  LDLCEAYGPSYKKLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE 777

Query: 684  ETLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLSPGLGHTSVTIYK 743
            ETLFKIEEERHEYDFYIE+NLRTIQTLETIA+KIANMT EEK  FKL PGLGHTS+TIYK
Sbjct: 778  ETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKNMFKLPPGLGHTSLTIYK 837

Query: 744  KVIRKVYDKDRGFEIIDALHETPSIAVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVY 803
            K+IRKVYDK+RGFEIID LHE P+I VPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVY
Sbjct: 838  KIIRKVYDKERGFEIIDELHEHPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVY 897

Query: 804  YKSLDHLGLTFKQADKKLLTTKQLVSEISTIKVDQANKRIHPLTPKPKSQLDYHFKDREV 863
            +KSLDHLGLTFKQADKKLLTTKQL+SEIS+IKVDQ NKR+H LTPKPK QLDY F D ++
Sbjct: 898  FKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQNNKRMHWLTPKPKKQLDYQFNDMDI 957

Query: 864  LYDILNLAKVFIDCNTTYSNPDKEKMFDFLKSFLVLFFSYPMYEVETAFARRRGDIGVQD 923
            ++DI+ L  VF+D  +TYSNPDKE++ D  + F+ LFF  P   +  A      D    +
Sbjct: 958  IFDIVGLTDVFVDHCSTYSNPDKERLKDLFRVFISLFFFIPRDLISAAL-----DTKSDE 1012

Query: 924  GEENSGQ-ENSDLSRKRTREEENL-LKDVLRRNKYQKGRNXXXXXXXXXXXXXXXXXXXX 981
            G+    + E +D S+KR R +  L L D+L R KYQK +N                    
Sbjct: 1013 GKSTDTKFEKADDSKKRPRPDVELSLSDILHRAKYQKLKN----GEGLGMSEDDDEEKLA 1068

Query: 982  XXXXXXXXXXXXXPWLLGSIVDEANEHGFVENRKTFNMFANTNIYVFFRHLATLYTRLSE 1041
                         PWL+G IV+ AN HG V +R  +N+F NTN+Y+F RH +TLY RL E
Sbjct: 1069 KEAEEMSEKNASKPWLVGDIVERANSHGLVTDRAVYNLFGNTNVYIFIRHWSTLYGRLLE 1128

Query: 1042 VKDINEAVTEEIKNRKVVQFAKDLNLISTQLSDMGLDFEGADAYGQVLTLSKRLIEGDIE 1101
            +K ++E VT+EI NRKVVQFA+DLNL+STQL DMGLDF+G +AY + L LSKRLI  ++E
Sbjct: 1129 LKQMDERVTKEINNRKVVQFAEDLNLLSTQLRDMGLDFDGKNAYQETLKLSKRLIRNELE 1188

Query: 1102 HQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHTIITDPKTVEIMILFEKDRTCLNTSA 1161
            HQWFEESLRQAY NKAFK+YT+DKVV SLVKHAHT++TD K+ E+M LFEKDR   +T  
Sbjct: 1189 HQWFEESLRQAYNNKAFKLYTVDKVVHSLVKHAHTLMTDNKSSELMELFEKDRLQSSTCV 1248

Query: 1162 KEQILYRLQVRSHMTTAENMFRIEYNRQSTHASIQFVAVDDLTLEEPKSLEDRWKYYVTS 1221
            K+QILYRL  RSHM++ ENMFR++YN+ + H SIQ++ +DD+TLE+ K   +RW YY+TS
Sbjct: 1249 KDQILYRLLTRSHMSSTENMFRVQYNKDTRHVSIQYIGLDDVTLEDAKDDNERWNYYMTS 1308

Query: 1222 YSLSHPTEGISHEELQX---XXXXXXXXXXXXXQCENGEYSPEGVSSSNLKVKINPETYS 1278
            Y+L HPTEGI  ++L                  +  +  Y+P G S S LK+ I+P+TY 
Sbjct: 1309 YALPHPTEGIMQDKLVVPFLERILEFENDMLDVEAGSDRYNPVGTSYSKLKINIDPKTYK 1368

Query: 1279 LDVQPGSYDFFSRKSINKFPIEINNDTYKSKRGEKAKCLTSYLNGAKGWKRGL 1331
            L +Q GSYD FSR SIN++PI  ++  Y     ++ +    +L+G  GWK+ L
Sbjct: 1369 LIIQDGSYDIFSRSSINEYPIRPDSKGYVQMVEKRKETAQKFLDGRFGWKKDL 1421

 Score =  172 bits (435), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 88/102 (86%), Gaps = 2/102 (1%)

Query: 155 DPSYRPLNVKDALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQG 214
           D  YRPLNVKDALSYLEQVK QFN+RP +YN FLDIMKDFKSQ IDTPGVIERVS LF+G
Sbjct: 215 DSPYRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKG 274

Query: 215 YPNLIQGFNTFLPQGYKIECSSNPNDPHPIKVTTPFGTTGSV 256
           +P LIQGFNTFLPQGY+IECSSNPN+  PIKVTTP G   +V
Sbjct: 275 FPALIQGFNTFLPQGYRIECSSNPNE--PIKVTTPMGVLENV 314

 Score =  108 bits (270), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 54/59 (91%)

Query: 334 KKGGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 392
           KK  DVEFS AISYVNKIK RF++QPDIYK+FLEILQTYQREQKPINEVYAQVTVLF N
Sbjct: 374 KKANDVEFSQAISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLFHN 432

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 41/62 (66%)

Query: 166 ALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYPNLIQGFNTF 225
           A+SY+ ++K +F+++PD+Y +FL+I++ ++ +      V  +V+ LF   P+L+  F  F
Sbjct: 384 AISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLFHNAPDLLDDFKKF 443

Query: 226 LP 227
           LP
Sbjct: 444 LP 445

 Score = 35.8 bits (81), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 30/48 (62%)

Query: 344 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 391
           A+SY+ ++K +F  +P IY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 226 ALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFK 273

>NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1657

 Score = 1039 bits (2687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/849 (60%), Positives = 623/849 (73%), Gaps = 26/849 (3%)

Query: 511  EPVARPEIDLDPSLXXXXXXXXXXMENEVSLVEETSFFDKAKKFIGNKQIYTEFLKILNL 570
            E   RPEIDLDPS+          +EN ++LVEETSFF+K KKFI +K IY EFLK+LNL
Sbjct: 713  EAPTRPEIDLDPSIVPIIPEPTEPIENNITLVEETSFFEKVKKFISSKPIYMEFLKVLNL 772

Query: 571  YSQDLLDRDELVEKVEYYLGGNKELFDWFKNFVGYEKKPKHIENIVHEKHRLDLDLCEAC 630
            YSQDLL  +ELV +V+YY+G NKELFDWFK FVGY + P  IENI+HEKH+LDLDLCEA 
Sbjct: 773  YSQDLLSTNELVTRVDYYIGSNKELFDWFKTFVGYSEIPSTIENIIHEKHKLDLDLCEAY 832

Query: 631  GPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 690
            GPSYKKLPK DTFMPCSGRD MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE
Sbjct: 833  GPSYKKLPKTDTFMPCSGRDAMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 892

Query: 691  EERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLSPGLGHTSVTIYKKVIRKVY 750
            EERHEYDF+IE+NLRTIQTLETIANKI NMT EEK  FKL  GLGHTS TIYKKVIRKVY
Sbjct: 893  EERHEYDFHIESNLRTIQTLETIANKINNMTAEEKKNFKLPVGLGHTSSTIYKKVIRKVY 952

Query: 751  DKDRGFEIIDALHETPSIAVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHL 810
            DK+RGFEIIDALHE P+ AVPI+L+RLK+KDEEWRRAQREWNKVWRELEQKVYYKSLDHL
Sbjct: 953  DKERGFEIIDALHEHPAFAVPIILRRLKEKDEEWRRAQREWNKVWRELEQKVYYKSLDHL 1012

Query: 811  GLTFKQADKKLLTTKQLVSEISTIKVDQANKRIHPLTPKPKSQLDYHFKDREVLYDILNL 870
            GLTFKQADKKLLTTKQL+SEIS+I+VDQ NKRIH LTPKPKSQLD+ F D ++L DIL+L
Sbjct: 1013 GLTFKQADKKLLTTKQLISEISSIQVDQNNKRIHWLTPKPKSQLDFTFNDHDILVDILDL 1072

Query: 871  AKVFIDCNTTYSNPDKEKMFDFLKSFLVLFFSYPMYEVETAFARRRGDIGVQDG--EENS 928
            A VFID  +TYSN +KE++ DFL+ F+ LFFS P  E++   +  + D   + G    +S
Sbjct: 1073 ANVFIDHTSTYSNSEKERLKDFLRVFIGLFFSIPSSEIDKKLS-GKNDEKFEKGSSSSSS 1131

Query: 929  GQENSDLSRKRTREEENLLKDVLRRNKYQK-----------GRNXXXXXXXXXXXXXXXX 977
               ++  ++KR+ E +  L DVLR+ KYQK             N                
Sbjct: 1132 TSNSTPSAKKRSLELDIPLADVLRKYKYQKIKEKVINELENNSNEYDERDEEFDEELKRQ 1191

Query: 978  XXXXXXXXXXXXXXXXXPWLLGSIVDEANEHGFVENRKTFNMFANTNIYVFFRHLATLYT 1037
                             PWLLGS++D+ +EHG +ENR  FN+FANTNIYVFFRH  T+Y 
Sbjct: 1192 QQEQEEEDHMIDEEMKKPWLLGSVIDKTSEHGLIENRHIFNLFANTNIYVFFRHWTTIYE 1251

Query: 1038 RLSEVKDINEAVTEEIKNRKVVQFAKDLNLISTQLSDMGLDFEGADAYGQVLTLSKRLIE 1097
            RL E+K IN+ VT EI +RKV  FAKDL LISTQL+ MGLDF+ +D+Y ++L L+KRLI+
Sbjct: 1252 RLLELKQINDKVTREINSRKVTPFAKDLGLISTQLTMMGLDFKTSDSYKELLNLTKRLIK 1311

Query: 1098 GDIEHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHTIITDPKTVEIMILFEKDRTCL 1157
             DIEHQWFEESLRQAY NKAFK+YT DKV+Q+LVKHA++I+TD K  EIM LFEKDR   
Sbjct: 1312 NDIEHQWFEESLRQAYNNKAFKLYTADKVIQALVKHANSILTDSKASEIMALFEKDRLRS 1371

Query: 1158 NTSAKEQILYRLQVRSHMTTAENMFRIEYNRQSTHASIQFVAVDDLTLEEPKSLEDRWKY 1217
            +T+ ++QI+YRLQ R+HMT  ENMFRIE+N  + H  IQ++AV+DLTL+   + ++ W+Y
Sbjct: 1372 STTTRDQIIYRLQTRTHMTNTENMFRIEFNENTNHVCIQYIAVEDLTLKPSPTTKETWEY 1431

Query: 1218 YVTSYSLSHPTEGISHEELQX------XXXXXXXXXXXXXQCENGEY----SPEGVSSSN 1267
            YVTSY+L HPTEG+  E L+                    + E  E+    SPEG+S+S 
Sbjct: 1432 YVTSYALPHPTEGVPQEGLKVPFLEKNLNLELENAQDLDNETEKNEFIEKISPEGISTSK 1491

Query: 1268 LKVKINPETYSLDVQPGSYDFFSRKSINKFPIEINNDTYKSKRGEKAKCLTSYLNGAKGW 1327
            LK+KI+ ETY+LDV+PGS+D FSRKS+NKFP +      +S   EK++    +L+  +GW
Sbjct: 1492 LKIKIDQETYNLDVEPGSFDVFSRKSLNKFPTDAKK--IESSIKEKSEAFNKFLSSKRGW 1549

Query: 1328 KRGLVASKV 1336
                   +V
Sbjct: 1550 NNQFKPDQV 1558

 Score =  170 bits (431), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 88/105 (83%), Gaps = 2/105 (1%)

Query: 154 QDPSYRPLNVKDALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQ 213
           +DP YRPLNVKDALSYLEQVK QFN++P +YN FLDIMKDFKSQ IDTPGVIERVS LF+
Sbjct: 266 EDPEYRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFK 325

Query: 214 GYPNLIQGFNTFLPQGYKIECSSNPNDPHPIKVTTPFGTTGSVTL 258
           GYP LIQGFNTFLPQGY I CS NP+D  P++VTTP GT+    L
Sbjct: 326 GYPVLIQGFNTFLPQGYTIHCSDNPDD--PVRVTTPMGTSTYTNL 368

 Score = 94.4 bits (233), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 51/55 (92%)

Query: 338 DVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 392
           +VEFS AI+YVNKIKTR+A+QP IYKHFLEILQTYQRE+KPI+EVY QVTVLF +
Sbjct: 464 EVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFND 518

 Score = 49.7 bits (117), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 42/63 (66%)

Query: 166 ALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYPNLIQGFNTF 225
           A++Y+ ++K ++ ++P +Y HFL+I++ ++ +      V E+V+ LF   P+L++ F  F
Sbjct: 470 AINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKF 529

Query: 226 LPQ 228
           LP+
Sbjct: 530 LPE 532

 Score = 37.4 bits (85), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 30/48 (62%)

Query: 344 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 391
           A+SY+ ++K +F  QP IY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 278 ALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFK 325

>CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa]
           {ON} weakly similar to uniprot|P22579 Saccharomyces
           cerevisiae YOL004w SIN3 transcription regulatory protein
          Length = 937

 Score =  248 bits (632), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 143/367 (38%), Positives = 206/367 (56%), Gaps = 35/367 (9%)

Query: 552 KKFIGNKQIYTEFLKILNLYSQDLLDRDELVEKVEYYLGGNKELFDWFKNFVG-YEKKPK 610
           +  + ++ IY EFLK++NL++Q L+D +   ++   + G +  L   F N +  Y+   +
Sbjct: 211 RNLVYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHNGLKTAFGNIMSEYKDIHQ 270

Query: 611 HIENIVHEKHRLDL-DLCEACGPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWAS 669
            ++  +      D+ D     GPSYK+L   +T   C GRD +C EVLNDEWVGHPVWAS
Sbjct: 271 RMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDRLCHEVLNDEWVGHPVWAS 330

Query: 670 EDSGFIAHRKNQYEETLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFK 729
           E+ GFIAH+KNQYEETLFK+EEERHEYDF+          L ++ + I   T  EK+  +
Sbjct: 331 EEVGFIAHKKNQYEETLFKVEEERHEYDFF----------LLSVEHLIVKFTEYEKS-LQ 379

Query: 730 LS---------------PGLGHTSVTIYKKVIRKVYDKDRGFEIIDALHETPSIAVPIVL 774
           LS               P +   S+T  +KVIR++Y  + G  +IDA+   P   VP +L
Sbjct: 380 LSKDDGRRRNRVSSPKEPMISLNSIT--EKVIRRLYGIEHGNILIDAIKTNPEKVVPTIL 437

Query: 775 KRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLVSEISTI 834
           K  K+K ++W  A+ EWNK WRE+EQK YYKSLDHLGL FK A+K+ L  KQL+ E  + 
Sbjct: 438 KTAKEKYQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKNAEKRFLNDKQLLLEYKSE 497

Query: 835 KVDQANKRIHPLTPKPKSQLDYHFKDREVLYDILNLAKVFIDCNTTYSNPDKEKMFDFLK 894
           K D+  K  +        +  Y F D+ VLYD+ ++    +  N++ S   K       +
Sbjct: 498 KQDKLLKEHY-----DNYEYKYEFFDKSVLYDVKDIILCGLRSNSSTSESQKNLYCQIFE 552

Query: 895 SFLVLFF 901
           +F  L F
Sbjct: 553 AFFDLLF 559

 Score =  140 bits (354), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 98/320 (30%), Positives = 157/320 (49%), Gaps = 10/320 (3%)

Query: 1013 NRKTFNMFANTNIYVFFRHLATLYTRLSEVKDINEAVTEEI--KNRKVVQFAKDLNLIST 1070
            NR+  N+F + NI   F ++ TLY R ++VK     + +++  K R+    AK L L+  
Sbjct: 619  NRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLRTKKRRPSLLAKSLKLLPM 678

Query: 1071 QLSDMGLDFEGADAYGQVLTLSKRLIEGDIEHQWFEESLRQAYKNKAFKIYTIDKVVQSL 1130
            QLSD GL+    D Y  + T SK+ + G+++HQWFEESLR  ++NKA+K+YTID+V++++
Sbjct: 679  QLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVIRNI 738

Query: 1131 VKHAHTIITDPKTVEIMILFEKDRTCLNTSAKEQILYRLQVRSHMTTAENMFRIEYNRQS 1190
            +    TI   P  ++I+ L   +   L T+  +Q+ YR +VR  M    +MFR+E  R S
Sbjct: 739  LGVITTISQTPSLLQILDLLVDNMKKLTTTKLQQLTYRTKVRMLMDGVGDMFRLEIVRDS 798

Query: 1191 THASIQFVAVDDLTLEEPKSLEDRWKYYVTSYSLSHPTEGISHEELQXXXXXXXXXXXXX 1250
                 Q++ VDDL   +    +     Y   Y  +  T+ +  + L              
Sbjct: 799  NAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPYYSLNLLKREE 858

Query: 1251 XQCENGEYSPEGVSSSNLKVKINPETYSLDVQPGSYDFFSRKSINKFPIEINNDTYKSKR 1310
               +N  +    +   +L V INP  Y +D+ PGS D  S   I K        + KS R
Sbjct: 859  ---QNIPFMNGNIYKPHLSVNINPLDYVVDIAPGSIDICSSTHITKLK-----SSLKSSR 910

Query: 1311 GEKAKCLTSYLNGAKGWKRG 1330
              +   L S +   +  +R 
Sbjct: 911  KTQMASLISKIAKNRKQQRA 930

>KAFR0D03340 Chr4 (656834..656869,656954..657211) [294 bp, 97 aa]
           {ON} Anc_2.504 YKL006C-A
          Length = 97

 Score = 32.0 bits (71), Expect = 2.1,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 29/57 (50%)

Query: 176 QFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYPNLIQGFNTFLPQGYKI 232
           + NN  +    F +I +D   QA+D   VI ++SN F    N I+  +T L +  ++
Sbjct: 16  KLNNLANKLATFRNINQDINDQAVDQNSVINQISNSFDALSNNIRNSSTRLTRSLQV 72

>KNAG0E00460 Chr5 complement(77112..81209) [4098 bp, 1365 aa] {ON}
            Anc_7.57 YOR336W
          Length = 1365

 Score = 33.9 bits (76), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 63/141 (44%), Gaps = 12/141 (8%)

Query: 1043 KDINEAVTEEIKNRKVVQFAKDLNLISTQLSDMGLDFEGADAYGQVLTLSKRLIEGDIEH 1102
            K + + +T   K +K      +LN I   L D+ L+F  A   G+ + L+ R I  + + 
Sbjct: 727  KSLRKTITS-FKQQKRRSLGVNLNWIKQWLPDIALEFLEA---GRFMVLNGRFIHFNKDE 782

Query: 1103 QWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHTIITDPKTVEIM--ILFEKDRTCLNTS 1160
               +E      K +A +   + + ++ LV   H  I+DP T E++  IL +     L  +
Sbjct: 783  IPSKEHFEAIVKREAQRTLDMVRALEGLVPEDHEEISDPNTYEVVSSILAKTYYHSLQIN 842

Query: 1161 AK------EQILYRLQVRSHM 1175
             K      E  L RL ++ H+
Sbjct: 843  RKGFEFTTETTLSRLDLQGHV 863

>Suva_12.122 Chr12 (181865..184195) [2331 bp, 776 aa] {ON} YJR040W
            (REAL)
          Length = 776

 Score = 33.1 bits (74), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 44/89 (49%), Gaps = 5/89 (5%)

Query: 1257 EYSPEGVSSSNLKVKINPETYSLDVQPGSYDFFSRKSINKFPIEINNDTYKSKRGEKAKC 1316
            EY+ E + SS L + IN   Y  +++   YD  S  S++ FPI  + D ++ ++    +C
Sbjct: 581  EYTAEQIMSSKL-ITINDTIYLSELESLLYDSASEFSVHGFPITRDEDKFEKEK----RC 635

Query: 1317 LTSYLNGAKGWKRGLVASKVLKAQTEIEY 1345
            +   L      K  + +S   KAQT + Y
Sbjct: 636  IGYVLKRHLASKIMMQSSNSAKAQTTLVY 664

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 137,095,987
Number of extensions: 5899120
Number of successful extensions: 15290
Number of sequences better than 10.0: 39
Number of HSP's gapped: 15560
Number of HSP's successfully gapped: 142
Length of query: 1415
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1293
Effective length of database: 39,492,147
Effective search space: 51063346071
Effective search space used: 51063346071
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 72 (32.3 bits)