Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E01518g6.28ON37937920320.0
Ecym_30326.28ON37737912681e-175
TDEL0G044106.28ON38138012351e-169
ACL003C6.28ON37537912121e-166
Skud_15.1596.28ON37938112121e-166
ZYRO0C07546g6.28ON37738012051e-165
Suva_15.1726.28ON39838012061e-165
Kwal_56.224596.28ON38337911791e-161
Kpol_1037.236.28ON37837911771e-161
KLTH0C10978g6.28ON37737911671e-159
NDAI0C026506.28ON38939311611e-158
Smik_15.1676.28ON37838011591e-158
YOL003C (PFA4)6.28ON37838011431e-155
NCAS0D021406.28ON37638111231e-153
KLLA0C06204g6.28ON37737911211e-152
CAGL0E02497g6.28ON37638111081e-150
TPHA0J003906.28ON38038010661e-144
KAFR0A051306.28ON3963979611e-128
KNAG0F029306.28ON3863889501e-126
TBLA0B004806.28ON3774125083e-60
Kwal_55.221263.12ON3601272204e-19
NCAS0E013003.12ON3271302124e-18
KAFR0A085903.12ON3311292107e-18
KNAG0K025703.12ON3281312081e-17
CAGL0D02508g3.12ON3321292053e-17
KLTH0F19580g3.12ON3421272011e-16
NDAI0G013403.12ON3351352001e-16
KLTH0G13112g8.286ON3492852002e-16
Kpol_1014.293.12ON326611983e-16
KLLA0E02069g3.12ON3251341964e-16
TPHA0P015603.12ON3311291956e-16
TDEL0A003103.12ON329531949e-16
NCAS0B035908.286ON3291391912e-15
YNL326C (PFA3)3.12ON3362341903e-15
TBLA0H001503.12ON3451291903e-15
Smik_14.63.12ON3342511832e-14
SAKL0C13596g3.12ON333921823e-14
ZYRO0C03410g3.12ON3272011806e-14
KAFR0B053708.286ON3291431806e-14
NDAI0J010008.286ON3391451799e-14
SAKL0H16434g8.286ON5552281801e-13
ZYRO0C04092g8.389ON3661031781e-13
TPHA0C023608.389ON4041281782e-13
Suva_14.153.12ON3301291762e-13
Skud_12.3218.389ON356611743e-13
TDEL0F041308.286ON3281881744e-13
AGL125C8.389ON367621745e-13
Ecym_20143.12ON3391161735e-13
SAKL0H13860g8.389ON352671735e-13
ZYRO0D13860g5.579ON3652101727e-13
TDEL0F051308.389ON359611728e-13
Ecym_41788.389ON368861719e-13
Skud_14.153.12ON336511701e-12
TPHA0C010708.286ON3331421701e-12
CAGL0B01991g8.286ON3301401691e-12
Smik_4.3728.286ON3351641691e-12
KNAG0A027108.389ON354611692e-12
ZYRO0D06600g8.286ON3301361682e-12
TBLA0D040408.286ON3291411663e-12
KLLA0F19690g8.286ON3242261663e-12
ADL197C3.12ON390771673e-12
KAFR0H019808.389ON361611664e-12
YLR246W (ERF2)8.389ON359611665e-12
Suva_2.2898.286ON3351421646e-12
NCAS0C029208.389ON374601657e-12
KLTH0F08668g8.389ON358611631e-11
Smik_12.3068.389ON359611621e-11
CAGL0G08217g8.389ON326611611e-11
Suva_10.3428.389ON356611621e-11
TBLA0H009208.389ON3601501612e-11
NDAI0G022508.389ON389601612e-11
Kwal_23.33028.389ON353501602e-11
KLLA0D18370g8.389ON355811593e-11
Skud_4.3878.286ON336571576e-11
YDR126W (SWF1)8.286ON3361681567e-11
Kpol_1033.168.286ON3211611478e-10
KNAG0H031108.286ON3311141479e-10
Ecym_42828.286ON3401601471e-09
Kwal_56.236978.286ON3381951381e-08
KAFR0I011105.579ON3701441381e-08
NCAS0F013905.579ON3742871382e-08
AGR065W8.286ON326661326e-08
KNAG0C028305.579ON3542611273e-07
TDEL0A044405.579ON365801212e-06
TBLA0E028305.579ON386901212e-06
Kpol_1004.575.579ON3621081212e-06
KLTH0G04972g5.579ON367661203e-06
Ecym_41145.579ON372771184e-06
NDAI0H018905.579ON406501176e-06
Kwal_47.183665.579ON356501132e-05
Smik_4.7375.579ON3781061122e-05
TPHA0C003705.626ON7591511132e-05
KNAG0C062305.626ON7521031133e-05
Skud_4.7345.579ON380481114e-05
SAKL0G06160g5.579ON364471104e-05
Smik_4.5155.626ON764701114e-05
NDAI0H008505.626ON786581115e-05
YDR459C (PFA5)5.579ON3741051095e-05
KLTH0E02420g5.626ON734801106e-05
ZYRO0C11132g5.626ON759701106e-05
Skud_4.5275.626ON764551107e-05
Suva_8.875.626ON7301631072e-04
KLLA0D06149g5.579ON349511052e-04
Kpol_526.325.626ON777591062e-04
TBLA0J008305.626ON739961062e-04
YDR264C (AKR1)5.626ON764711062e-04
Suva_2.4325.626ON763551062e-04
Suva_2.6345.579ON388501033e-04
YOR034C (AKR2)5.626ON749581043e-04
KAFR0H005705.626ON757581026e-04
AER388C5.626ON724581018e-04
Skud_15.1995.626ON7411851000.001
CAGL0K06347g5.579ON35250990.001
NCAS0C052805.626ON75757990.001
Smik_15.2135.626ON744184980.002
CAGL0M08712g5.626ON76360980.002
ABR203W5.579ON35948960.002
Ecym_13305.626ON73962950.004
KNAG0B031405.626ON682143940.005
SAKL0G07326g5.626ON73769920.009
TDEL0A049205.626ON75073910.013
KLLA0E16721g5.626ON752153780.40
NCAS0E033607.258ON801102760.74
KAFR0C059605.626ON72792703.6
KNAG0K001705.10ON144221704.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E01518g
         (379 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} simila...   787   0.0  
Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to ...   493   e-175
TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {O...   480   e-169
ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON} S...   471   e-166
Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {...   471   e-166
ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {...   468   e-165
Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {...   469   e-165
Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003...   458   e-161
Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {O...   457   e-161
KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {...   454   e-159
NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28     451   e-158
Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {...   451   e-158
YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON} ...   444   e-155
NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {O...   437   e-153
KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {...   436   e-152
CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {...   431   e-150
TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28...   415   e-144
KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa] ...   374   e-128
KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {O...   370   e-126
TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28 ...   200   3e-60
Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL3...    89   4e-19
NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON...    86   4e-18
KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3....    86   7e-18
KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.1...    85   1e-17
CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar...    84   3e-17
KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} simi...    82   1e-16
NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12      82   1e-16
KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]...    82   2e-16
Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON} (48992.....    81   3e-16
KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {O...    80   4e-16
TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.1...    80   6e-16
TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON} ...    79   9e-16
NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON}      78   2e-15
YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}  P...    78   3e-15
TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}...    78   3e-15
Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON} ...    75   2e-14
SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} simi...    75   3e-14
ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar...    74   6e-14
KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {...    74   6e-14
NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8....    74   9e-14
SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]...    74   1e-13
ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {...    73   1e-13
TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.3...    73   2e-13
Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON} ...    72   2e-13
Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246...    72   3e-13
TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.28...    72   4e-13
AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON} S...    72   5e-13
Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON} s...    71   5e-13
SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} simi...    71   5e-13
ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]...    71   7e-13
TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {O...    71   8e-13
Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar t...    70   9e-13
Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}...    70   1e-12
TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {O...    70   1e-12
CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar...    70   1e-12
Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W ...    70   1e-12
KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.3...    70   2e-12
ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {O...    69   2e-12
TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {...    69   3e-12
KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} simil...    69   3e-12
ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON} S...    69   3e-12
KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.3...    69   4e-12
YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subun...    69   5e-12
Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W ...    68   6e-12
NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389     68   7e-12
KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} simila...    67   1e-11
Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246...    67   1e-11
CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {O...    67   1e-11
Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246...    67   1e-11
TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.3...    67   2e-11
NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389     67   2e-11
Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W...    66   2e-11
KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]...    66   3e-11
Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W ...    65   6e-11
YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}  SWF1Palmit...    65   7e-11
Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON} (35544.....    61   8e-10
KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON...    61   9e-10
Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}...    61   1e-09
Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {...    58   1e-08
KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.5...    58   1e-08
NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {O...    58   2e-08
AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic hom...    55   6e-08
KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {O...    54   3e-07
TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {O...    51   2e-06
TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.5...    51   2e-06
Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa] ...    51   2e-06
KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {...    51   3e-06
Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}...    50   4e-06
NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {O...    50   6e-06
Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459...    48   2e-05
Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {...    48   2e-05
TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626...    48   2e-05
KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa] ...    48   3e-05
Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {...    47   4e-05
SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {...    47   4e-05
Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON...    47   4e-05
NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.6...    47   5e-05
YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}...    47   5e-05
KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {...    47   6e-05
ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {...    47   6e-05
Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON...    47   7e-05
Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}...    46   2e-04
KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} simila...    45   2e-04
Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}...    45   2e-04
TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {...    45   2e-04
YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}  ...    45   2e-04
Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON...    45   2e-04
Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {...    44   3e-04
YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON} ...    45   3e-04
KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.6...    44   6e-04
AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}...    44   8e-04
Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {...    43   0.001
CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa] ...    43   0.001
NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa] ...    43   0.001
Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {...    42   0.002
CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} simil...    42   0.002
ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic ho...    42   0.002
Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar t...    41   0.004
KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.6...    41   0.005
SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {...    40   0.009
TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {O...    40   0.013
KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} simi...    35   0.40 
NCAS0E03360 Chr5 (668230..670635) [2406 bp, 801 aa] {ON} Anc_7.2...    34   0.74 
KAFR0C05960 Chr3 complement(1187537..1189720) [2184 bp, 727 aa] ...    32   3.6  
KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {O...    32   4.8  

>SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} similar
           to uniprot|Q12006 Saccharomyces cerevisiae YOL003C
           DHHC-CRD protein
          Length = 379

 Score =  787 bits (2032), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/379 (100%), Positives = 379/379 (100%)

Query: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60
           MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT
Sbjct: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60

Query: 61  NPGKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNF 120
           NPGKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNF
Sbjct: 61  NPGKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNF 120

Query: 121 AHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLT 180
           AHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLT
Sbjct: 121 AHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLT 180

Query: 181 ISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQDDDI 240
           ISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQDDDI
Sbjct: 181 ISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQDDDI 240

Query: 241 RKLLSQNRLSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMIFEKNELSVYE 300
           RKLLSQNRLSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMIFEKNELSVYE
Sbjct: 241 RKLLSQNRLSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMIFEKNELSVYE 300

Query: 301 PEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDPRTTMPRKK 360
           PEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDPRTTMPRKK
Sbjct: 301 PEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDPRTTMPRKK 360

Query: 361 WYNDWGENLADFGVDLDEE 379
           WYNDWGENLADFGVDLDEE
Sbjct: 361 WYNDWGENLADFGVDLDEE 379

>Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to
           Ashbya gossypii ACL003C
          Length = 377

 Score =  493 bits (1268), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 227/379 (59%), Positives = 285/379 (75%), Gaps = 3/379 (0%)

Query: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60
           M VKLKWPWLGIAIP FLI+FIGY A  F+L  FL  K+Q+WF+FSL MIW+SYY AIYT
Sbjct: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60

Query: 61  NPGKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNF 120
           NPG P PGF+P K EW+N+C KC N+KPER HHCK C QCVL MDHHCP+TMNCVG+ NF
Sbjct: 61  NPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNF 120

Query: 121 AHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLT 180
            HF+RFLFW+I TT++L     KR  F+WN RH     V + E+IFLTILTP +AFVLLT
Sbjct: 121 PHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLT 180

Query: 181 ISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQDDDI 240
           IS+L  RC KNQ+L GMTQIE+WEMDRIE+MF++ +L+P++L NL+E+ P SL     +I
Sbjct: 181 ISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLDGHKGEI 240

Query: 241 RKLLSQNRLSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMIFEKNELSVYE 300
            ++L+  ++S +++VNFPYD +PW N +N +G M +W+ P+G   GNGM+FEKNELS YE
Sbjct: 241 DRILNNRKISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMVFEKNELSAYE 300

Query: 301 PEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDPRTTMPRKK 360
               + DKLLSLPWPPDG R       +N    VESSTR+GE ++RKR  +PR  + R +
Sbjct: 301 HGSTLTDKLLSLPWPPDGERAP---NSSNSRLKVESSTRNGEHIIRKRSPEPRLNLSRTE 357

Query: 361 WYNDWGENLADFGVDLDEE 379
           WYNDWGENLA FGVD+D +
Sbjct: 358 WYNDWGENLAHFGVDVDAD 376

>TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {ON}
           Anc_6.28 YOL003C
          Length = 381

 Score =  480 bits (1235), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 224/380 (58%), Positives = 282/380 (74%), Gaps = 3/380 (0%)

Query: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60
           M VKLKWPWLGIAIP  L+SFIGYC H+FILSNFL   KQLWF+ +L +IW+SYY AIYT
Sbjct: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60

Query: 61  NPGKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNF 120
           NPG+P P F   K+EW+N+C KC NYKPERAHHCK CNQCVL MDHHCPWTMNCVGH NF
Sbjct: 61  NPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNF 120

Query: 121 AHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLT 180
            HF+RFL WVI  T+FLL  LV RI+ LW  R++P+Y  HRSEL+FLTILTP+DAFVLLT
Sbjct: 121 PHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVLLT 180

Query: 181 ISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQDDDI 240
           I++LL RC  NQI  GM+QIE+WE++R++ +F S +L+P ++E   +I PG+    ++  
Sbjct: 181 ITILLCRCLANQIFNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQINEST 240

Query: 241 RKLLSQNR-LSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMIFEKNELSVY 299
              LS N+ L L+++VNFPYDL+PW+NA   LG+   W+ P+G  KG+GM F KNE+S Y
Sbjct: 241 AAELSMNKELRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGMSFVKNEISEY 300

Query: 300 EPEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDPRTTMPRK 359
                 ED LLSLPWPPDGGR +   G  +    +ES T+ GE+++R+R  D    + R+
Sbjct: 301 SSRASYEDLLLSLPWPPDGGRTRAGPGSLSSS--IESITKQGEQLIRRRPNDTSDLIGRR 358

Query: 360 KWYNDWGENLADFGVDLDEE 379
           +W NDWGENL DFGVD+D E
Sbjct: 359 QWQNDWGENLEDFGVDVDTE 378

>ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL003C
          Length = 375

 Score =  471 bits (1212), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 221/379 (58%), Positives = 278/379 (73%), Gaps = 4/379 (1%)

Query: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60
           MAV +KWPWLG+AIP FLISF GY AH+F+L+NFL  K+ LWF+ SL MIWISY+ AIY 
Sbjct: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60

Query: 61  NPGKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNF 120
           NPG+PT GFRP ++EW+N+C KC  YKPER HHCK CNQCVL MDHHCPWTMNC+G +  
Sbjct: 61  NPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYL 120

Query: 121 AHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLT 180
           A       W+I TT  LL Y VKRI F W  R+     V + ELIFLTILTP+DAF+LLT
Sbjct: 121 APQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLT 180

Query: 181 ISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQDDDI 240
           ISLL +RC KNQI+ G TQIE+WEMDRIEN+F+  +L+P++L NLKEI PGSL  Q+ ++
Sbjct: 181 ISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEGQEKEV 240

Query: 241 RKLLSQNRLSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMIFEKNELSVYE 300
            + LS +  S DE++NFPYD+NPW N +N +G   +W+ P+G  K +GM+F+KNE+S Y+
Sbjct: 241 EEFLSSSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKNEISDYD 300

Query: 301 PEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDPRTTMPRKK 360
               I+DKLL+LPWPPD  RH   G     V+ VE  T+ GE+VVR+R V P    PR +
Sbjct: 301 EATSIQDKLLALPWPPDDTRH---GIAFPSVSHVEKDTQGGEQVVRRRHV-PIAVPPRNE 356

Query: 361 WYNDWGENLADFGVDLDEE 379
           WYNDWGE+L  FGVD++ E
Sbjct: 357 WYNDWGESLEHFGVDVEVE 375

>Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {ON}
           YOL003C (REAL)
          Length = 379

 Score =  471 bits (1212), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 228/381 (59%), Positives = 279/381 (73%), Gaps = 4/381 (1%)

Query: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60
           MAVKLKWPWLGIAIP FLISFIGY AHYFILSNFL   KQL FE SL MIW+SYYLAIYT
Sbjct: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60

Query: 61  NPGKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNF 120
           N G+P P +RPS   W NFC KC +YKPER+HHCKACNQCVL MDHHCPWTMNCVG RN+
Sbjct: 61  NAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNY 120

Query: 121 AHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLT 180
            HF+RFLFWVI TTS L    VKRI F+W +R +P Y   +SELIFLTIL+P+D FVLLT
Sbjct: 121 PHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLT 180

Query: 181 ISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQDD-D 239
           I++L LRC  NQI+ G +QIESW+MDR+E++  SG+LIP++++N   I P + S+Q + D
Sbjct: 181 IAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERD 240

Query: 240 IRKLLSQ-NRLSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMIFEKNELSV 298
             KLL+Q  R   DE+V+FPY+ NP  NA+  LG +  W+ P+GT  G+G  F KN++S 
Sbjct: 241 ADKLLTQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNSFPKNDISQ 300

Query: 299 YEPEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDPRTTMPR 358
           YE   P+ED +LSLPWPPDG + K      N    +E+    GE++VR R     +   R
Sbjct: 301 YEVNSPLEDIILSLPWPPDGNKTKAVSNHNNST--IETYNEGGEQIVRSRNAQHGSDAIR 358

Query: 359 KKWYNDWGENLADFGVDLDEE 379
           +KWYNDWGE+L DFGVD+D E
Sbjct: 359 EKWYNDWGESLDDFGVDVDME 379

>ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  468 bits (1205), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 223/380 (58%), Positives = 283/380 (74%), Gaps = 4/380 (1%)

Query: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60
           M V+LKWP+LGIAIP FLISFIGY AHYFILSNFL T+KQ+WFEFSL MIW SYYLAIYT
Sbjct: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60

Query: 61  NPGKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNF 120
            PG+P P F+PSK  W+++C KC NYKPERAHHCK CNQCVL+MDHHCPWT NCVG+ NF
Sbjct: 61  LPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNF 120

Query: 121 AHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLT 180
            HF+RFLFWVI TT +LL  L  R  F+ +  + P Y  ++SELIFLTIL PMD F+LLT
Sbjct: 121 PHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLT 180

Query: 181 ISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQ-DDD 239
           IS+L +RC  NQI  G TQIE+WE +R+E +++S +L+P +L N  E+ P   + + +D+
Sbjct: 181 ISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELEDE 240

Query: 240 IRKLLSQNRLSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMIFEKNELSVY 299
             +L ++ R+ LD +VNFPYD++PW+N +  LG    W+ P+G  KG+GM F KN++S +
Sbjct: 241 ASRLSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMFFPKNDISEF 300

Query: 300 EPEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDPRTTMPRK 359
           E E  + D LL+LPWPPDGG+ KV     +  N VE++ RDGE+V+RKR VDPR    R 
Sbjct: 301 E-ETNLTDMLLALPWPPDGGKDKV--ISIDGPNAVETTVRDGEQVIRKRLVDPRDPSSRT 357

Query: 360 KWYNDWGENLADFGVDLDEE 379
           +W N WGENL DFGVD+D E
Sbjct: 358 QWQNTWGENLEDFGVDVDAE 377

>Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {ON}
           YOL003C (REAL)
          Length = 398

 Score =  469 bits (1206), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 220/380 (57%), Positives = 282/380 (74%), Gaps = 3/380 (0%)

Query: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60
           MAVKLKWPWLGIAIP FLISFIGY AHYFILSNFL   KQ+ FE SL MIW+SYYLAIYT
Sbjct: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80

Query: 61  NPGKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNF 120
           NPGKP+P ++P+   W N+C KC NYKPER+HHCKACNQCVL MDHHCPWTMNCVG +N+
Sbjct: 81  NPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNY 140

Query: 121 AHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLT 180
            HF+RF+FWVI TT FL    +KR+ F+W +RH+P Y   +SEL+FLTILTP++ FVLLT
Sbjct: 141 PHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFKKSELVFLTILTPLNFFVLLT 200

Query: 181 ISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQ-DDD 239
           I +L LRC  NQI+ G +QIESW+MDR+E++F S +LI +++EN   I P + S Q + D
Sbjct: 201 IVILFLRCLFNQIINGRSQIESWDMDRLESLFDSQRLIKKLIENTWRIYPEARSPQLERD 260

Query: 240 IRKLLSQNRLSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMIFEKNELSVY 299
             KLL+Q+++  +E+VNFPY+++ + NA   LG ++ W+ P G   G+G  F+KN++S Y
Sbjct: 261 AEKLLTQHKIRFEEVVNFPYNIDLFTNATIYLGPLHLWLWPCGAPAGDGNSFQKNDISKY 320

Query: 300 EPEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDPRTTMPRK 359
           E    +ED +LSLPWPPDGG+ K     +N    +E+    GE+VVR R      +  R+
Sbjct: 321 EVNSSLEDIMLSLPWPPDGGKIKTASNHSNLA--IETCNEGGEQVVRSRIAQHGRSATRE 378

Query: 360 KWYNDWGENLADFGVDLDEE 379
           KWYNDWGE+L DFGVD+D E
Sbjct: 379 KWYNDWGESLDDFGVDVDME 398

>Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003C -
           Hypothetical ORF [contig 185] FULL
          Length = 383

 Score =  458 bits (1179), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 226/379 (59%), Positives = 277/379 (73%), Gaps = 3/379 (0%)

Query: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60
           M VKLKWPWLGIAIP  LI+FIGY +HYFIL NFL   +Q+WF+  L MIWISY LAI+T
Sbjct: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60

Query: 61  NPGKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNF 120
           NPGKP  GF+P   +W+N C KC  YKPER HHCK C+QCVL MDHHCPWTMNCVGH NF
Sbjct: 61  NPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNF 120

Query: 121 AHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLT 180
            HF+RFL WVI TTS+L   L KRI   W  RH    +V + EL+F+ I TP++AFV LT
Sbjct: 121 PHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHT-RIYVQKIELVFIFINTPLNAFVWLT 179

Query: 181 ISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQDDDI 240
           I LLLLRC+KNQ L GMTQIE WE +RIEN F++G+LIP++LENL EI    + N   + 
Sbjct: 180 IILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGDDILN-SPNA 238

Query: 241 RKLLSQNRLSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMIFEKNELSVYE 300
           +KL++   L L+EIVNFPYDLN  AN  +++G++ + ILPW +  GNG+ F KN+LS Y+
Sbjct: 239 KKLINARDLQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTKNDLSSYD 298

Query: 301 PEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDPRTTMPRKK 360
               IEDKLLSLPWPPDGGR + P G +   + +E  +  GE V+RKR  DPR  M R +
Sbjct: 299 TCHTIEDKLLSLPWPPDGGRQQ-PTGDSQVSSRIEMHSSRGEPVLRKRLRDPRINMQRTE 357

Query: 361 WYNDWGENLADFGVDLDEE 379
           WYNDWGENL+DFGVD++ E
Sbjct: 358 WYNDWGENLSDFGVDVESE 376

>Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {ON}
           complement(51397..52533) [1137 nt, 379 aa]
          Length = 378

 Score =  457 bits (1177), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 213/379 (56%), Positives = 277/379 (73%), Gaps = 1/379 (0%)

Query: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60
           M VKLK+PW+GIAIP FLISFI Y AHYFIL NFL   KQ+WFE S+ MIWISYYLAIYT
Sbjct: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60

Query: 61  NPGKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNF 120
           NPGKP   + P   +W+N+C KCN YKPER HHCK C QCVL MDHHCPWTMNCVG++NF
Sbjct: 61  NPGKPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNF 120

Query: 121 AHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLT 180
            HF+RFLFWVI TT++LL +L+ RI+FLW  R++P+Y  ++SE+IFLTI TPMD FVLLT
Sbjct: 121 PHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLT 180

Query: 181 ISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQDDDI 240
           ISLL +RC  NQ+L G TQIE+WE +R+E++F+  +L P+++ NL E  P   +  ++  
Sbjct: 181 ISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPELKTPDNEAK 240

Query: 241 RKLLSQNRLSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMIFEKNELSVYE 300
            + +   R+  D +V+FPYDL    N    LG   +W+  +G   G+GM+F+KNE S++E
Sbjct: 241 AEKIVSKRIRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGMLFKKNEYSLFE 300

Query: 301 PEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDPRTTMPRKK 360
            +  +ED++LSLPWPPDGG+H      ++  N +E+ST+DGE V+RKR    +    R +
Sbjct: 301 EDSILEDQILSLPWPPDGGKHGFNIENSS-TNSIETSTKDGEHVIRKRSPVSKLLESRTQ 359

Query: 361 WYNDWGENLADFGVDLDEE 379
           WYNDWGENL DFGVD+D E
Sbjct: 360 WYNDWGENLEDFGVDIDVE 378

>KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  454 bits (1167), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 213/379 (56%), Positives = 275/379 (72%), Gaps = 3/379 (0%)

Query: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60
           M V+LKWPWLGIA+P FLI++IGY +HYFIL NF  T +QLWFEFSL +IW+SY  AI+ 
Sbjct: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60

Query: 61  NPGKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNF 120
           NPG+P P F P   +W+N+C KC+NYKPER HHCK C QCVLSMDHHCPWTMNCVGH NF
Sbjct: 61  NPGRPPPNFEPPIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNF 120

Query: 121 AHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLT 180
            HF+RFL WV+ TTS+L   L +R    W  R+    FVH SEL FL +  P++AF+LLT
Sbjct: 121 PHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRNT-RKFVHTSELCFLFVNAPLNAFILLT 179

Query: 181 ISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQDDDI 240
           +SLL+ RC KNQ L GMTQIESWE DRIEN+F + +L+P++++NLKE+ P    ++    
Sbjct: 180 VSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPEDTFDE-GAA 238

Query: 241 RKLLSQNRLSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMIFEKNELSVYE 300
           +KLLS  +L L++I+NFPYD++   N  +S+G +YSW LP G  +  G  F  N+LS Y+
Sbjct: 239 QKLLSSKQLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTRFVTNDLSDYD 298

Query: 301 PEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDPRTTMPRKK 360
            +  IEDKLLSLPWPPDGGR K     A+  + +E+ +  GE  +R R  D R ++PR +
Sbjct: 299 IKASIEDKLLSLPWPPDGGRQK-SQRSADIASTLETFSSGGEATLRNRSFDSRISVPRTE 357

Query: 361 WYNDWGENLADFGVDLDEE 379
           W+NDWGENL+DFGVD+D E
Sbjct: 358 WHNDWGENLSDFGVDVDAE 376

>NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28
          Length = 389

 Score =  451 bits (1161), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 218/393 (55%), Positives = 283/393 (72%), Gaps = 20/393 (5%)

Query: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60
           MA+KLK+PWLG+AIP F+ISFIGY +HYFILSNFL  KKQ+WF+FSL MIW+SY LAI+T
Sbjct: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60

Query: 61  NPGKPTPGFRPSKF----EWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVG 116
           NPGKP    +P  F    +W   C KCNNYKPER+HHCK CNQCVL MDHHCPWTMNCVG
Sbjct: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120

Query: 117 HRNFAHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAF 176
           ++NF HFIRFL W+I TT FLL +L+KR + +WN RH+P+Y   R+E+IFLTIL PMDAF
Sbjct: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF 180

Query: 177 VLLTISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLS-- 234
           +LLTISLL +RC  NQI++GMTQIE WE++R+EN+F++ +L+P ++  L E+ P   +  
Sbjct: 181 ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKV 240

Query: 235 --NQDDDIRKLLSQNRLSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMIFE 292
             N  DD+  L  + ++  + IVNFPYD++ W N    +G  ++WI  +G    NG+ FE
Sbjct: 241 ADNYADDL--LSRRKKVRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNGLKFE 298

Query: 293 KNELSVYEPEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDP 352
           KNE+S+YEP   +ED LLSLPWPPD GR+ +    +N    VES   DGE+VVR R  + 
Sbjct: 299 KNEISLYEPGSSVEDLLLSLPWPPDKGRNFI----SNKDTSVESLVYDGEQVVRNRASND 354

Query: 353 RTT------MPRKKWYNDWGENLADFGVDLDEE 379
                    + R++W NDWGE+L DFGVD++ E
Sbjct: 355 TNISTINKDISREEWNNDWGESLVDFGVDIEAE 387

>Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {ON}
           YOL003C (REAL)
          Length = 378

 Score =  451 bits (1159), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 218/380 (57%), Positives = 270/380 (71%), Gaps = 3/380 (0%)

Query: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60
           MAVKL+WPWLGIAIP  LISFIGY AHYFILSNFLP  KQ+ FEFSL MIW SYYLAIYT
Sbjct: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60

Query: 61  NPGKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNF 120
           NPG+P P ++P+   W NFC KC NYKPER+HHCK CNQCVL MDHHCPWTMNCVG  N+
Sbjct: 61  NPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNY 120

Query: 121 AHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLT 180
            HF+RFLFW+I TTS L    VKRI F+W RR+ P Y   +SEL FLTIL+P++ FVLLT
Sbjct: 121 PHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSPLNFFVLLT 180

Query: 181 ISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQDD-D 239
           I++L LRC  NQI+ G +QIESW+MDR+E++F S +LI +++ N   I P S + Q + D
Sbjct: 181 ITVLFLRCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPESKTLQHERD 240

Query: 240 IRKLLSQNRLSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMIFEKNELSVY 299
              LL Q R S + +VNFPY+ +   NA+  LG ++ W+ P+G   GNG  F KN++S Y
Sbjct: 241 AEGLLKQQRSSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNNFPKNDISNY 300

Query: 300 EPEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDPRTTMPRK 359
           E + P+ED +LSLPWPPDGG              +E+    GE+VVR R      +  R+
Sbjct: 301 EVDSPLEDIILSLPWPPDGGETTTVSNPKTST--IETCNEGGEQVVRSRVAQNGRSASRE 358

Query: 360 KWYNDWGENLADFGVDLDEE 379
           KW+NDWGE+L DFGVD+D E
Sbjct: 359 KWFNDWGESLDDFGVDVDME 378

>YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON}
           PFA4Palmitoyltransferase with autoacylation activity,
           required for palmitoylation of amino acid permeases
           containing a C-terminal Phe-Trp-Cys site; required for
           modification of Chs3p; member of the DHHC family of
           putative palmitoyltransferases
          Length = 378

 Score =  444 bits (1143), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 213/380 (56%), Positives = 270/380 (71%), Gaps = 3/380 (0%)

Query: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60
           M VKL+WPWLGIAIP FLISFIGY AHYFILSNFL   KQ+ FEF L MIW+SYYLAI T
Sbjct: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60

Query: 61  NPGKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNF 120
           NPG+P P ++P    W NFC KC +YKPER+HHCK CNQCVL MDHHCPWTMNCVG  N+
Sbjct: 61  NPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANY 120

Query: 121 AHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLT 180
            HF+RFLFW+I TTS L     KRI F+W +RH+P YF  +SELIFLTI +P+++FVLLT
Sbjct: 121 PHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLT 180

Query: 181 ISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQD-DD 239
           I++L LRC  NQIL G +QIESW+MDR+E++F+SG+L  ++++N   I P S S Q+  D
Sbjct: 181 ITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKD 240

Query: 240 IRKLLSQNRLSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMIFEKNELSVY 299
             + L++ R   DE+VNFPYD + + NA+  LG ++ W+ P+G   G+G  F KN +S Y
Sbjct: 241 AEEHLTKKRPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKNGISKY 300

Query: 300 EPEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDPRTTMPRK 359
           E    +ED +LSLPWPPDGG+        +    +E     GE+++R R         R+
Sbjct: 301 EANSSLEDHILSLPWPPDGGKTNTVFNHGSST--IEMRNESGEQLIRTRLPQNGRHASRE 358

Query: 360 KWYNDWGENLADFGVDLDEE 379
           KWYNDWGE+L DFGVD+D E
Sbjct: 359 KWYNDWGESLDDFGVDVDME 378

>NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {ON}
           Anc_6.28
          Length = 376

 Score =  437 bits (1123), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 207/381 (54%), Positives = 273/381 (71%), Gaps = 7/381 (1%)

Query: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60
           M VKLK+PW+G+ IP  L SFIGY AH F+L+NF+  K QLWF+ SL M+WISY LAI+T
Sbjct: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60

Query: 61  NPGKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNF 120
           NPG+P   F+P K EW +FC KC  +KPERAHHCK CNQCVL MDHHCPWTMNCVG +NF
Sbjct: 61  NPGRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNF 120

Query: 121 AHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLT 180
            HF+RFLFWV+ TT FLL  L+KR ++LW  + +P+Y   ++E+ FL IL PMD FVL+T
Sbjct: 121 PHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLIT 180

Query: 181 ISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQDDDI 240
           ++LL +RC  NQI+ G TQIESWE++R+EN+++  +L+P++L NL EI P   + ++  +
Sbjct: 181 VALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPENKVL 240

Query: 241 RKLLSQ--NRLSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMIFEKNELSV 298
            K L +   ++  + IV FPYDL+ W+NA+  LG    W+  +G    +GM F+KNEL++
Sbjct: 241 AKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMHFKKNELAL 300

Query: 299 YEPEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDPRTTMPR 358
           YE    IED LLSLPWPPDGGR+ +   G N    VES T +GE+V+R+R  +   +  R
Sbjct: 301 YEEGAAIEDLLLSLPWPPDGGRNFIQQKGTN----VESITENGEQVIRQRNFENDNSY-R 355

Query: 359 KKWYNDWGENLADFGVDLDEE 379
           K W NDWGENL DFGVD+D E
Sbjct: 356 KTWNNDWGENLEDFGVDVDVE 376

>KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC- CRD protein
          Length = 377

 Score =  436 bits (1121), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 207/379 (54%), Positives = 266/379 (70%), Gaps = 2/379 (0%)

Query: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60
           MA+KLK  WLG+AIP FL++ IGY +HYFILSNFL   +Q++++    MIW+SYYLAIYT
Sbjct: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60

Query: 61  NPGKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNF 120
           NPG P   F+PS  EW N+C KC  YKPERAHHCK CNQCVL+MDHHCPWT+NCVGH NF
Sbjct: 61  NPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNF 120

Query: 121 AHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLT 180
            HF+RFLFWVI +T++LL  L+ RI  LW+ RH   +    SE+IF+ I+TPMDAFVLLT
Sbjct: 121 PHFMRFLFWVIFSTAYLLFLLIGRIYLLWSIRHTAFHHRSTSEIIFICIMTPMDAFVLLT 180

Query: 181 ISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQDDDI 240
           +S LL RC  NQ L GMTQIESWEMDRI+++ +  +L+ ++++ L E RP  L  +  +I
Sbjct: 181 VSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRPEILPAKQHEI 240

Query: 241 RKLLSQNRLSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMIFEKNELSVYE 300
            KLLS+  ++ ++  NFPYD+NPW N  N++G  Y W+ PW      G  F KNEL  Y+
Sbjct: 241 NKLLSKRYVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKNELFFYD 300

Query: 301 PEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDPRTTMPRKK 360
           P   IED L+SLPWPPDG  H     G+     +E+    GE+V+R + VD R  + R  
Sbjct: 301 PNSSIEDMLMSLPWPPDGLTHHSRALGSGSS--IETIVSGGEQVIRDKSVDLRDRLGRNS 358

Query: 361 WYNDWGENLADFGVDLDEE 379
           WYNDWGE+L+DFGVD + E
Sbjct: 359 WYNDWGEDLSDFGVDTELE 377

>CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003c
          Length = 376

 Score =  431 bits (1108), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 211/381 (55%), Positives = 270/381 (70%), Gaps = 7/381 (1%)

Query: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60
           M VKLKWPWLGIAIP FLI+ IGYCAHYFIL NFL  +KQLW++F   MIW+SYYLAIYT
Sbjct: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60

Query: 61  NPGKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNF 120
            PGKP   F+PSK EW+ +C KC  YKPER+HHCK CNQCVL MDHHCPWTMNCVG+ NF
Sbjct: 61  PPGKPPTNFKPSKNEWKVYCKKCKCYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNF 120

Query: 121 AHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLT 180
            HFIRFLFWVI  T+ L  +L  RI  +W  R  P+Y  ++SELIFLTILTP++AF+LLT
Sbjct: 121 PHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLT 180

Query: 181 ISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQ--DD 238
           IS+L++RC  NQI  G +QIESWEMDR+E +    +L+P ++EN+  I P +L N+  + 
Sbjct: 181 ISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFP-NLRNEHVES 239

Query: 239 DIRKLLSQNRLSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMIFEKNELSV 298
               LL++ RLSLDE+VNFPYDL P+ NA+  LG    W+ P+   + +G+ F+KNE S+
Sbjct: 240 QAEALLNKKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKNEESM 299

Query: 299 YEPEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDPRTTMPR 358
            E    + D +L LPWPPD  +H      +   + V+  + +GE+V+R R   P   + R
Sbjct: 300 IEDPNSLNDIILCLPWPPDSTKHL--NSTSEHTSNVQIISEEGEQVIRIR--TPEKKLSR 355

Query: 359 KKWYNDWGENLADFGVDLDEE 379
            +W NDWGE+L DFGVD+D E
Sbjct: 356 SEWLNDWGESLEDFGVDVDVE 376

>TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28
           YOL003C
          Length = 380

 Score =  415 bits (1066), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 205/380 (53%), Positives = 265/380 (69%), Gaps = 2/380 (0%)

Query: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60
           M VK KWPW+GIAIP  LISFIGY +HY+IL   L   KQ +FEFSL MIW+SYY+AI  
Sbjct: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60

Query: 61  NPGKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNF 120
           NPGKP   F+P   EW NFC KCNNYKPER+HHCK CNQCVL MDHHCPWTMNC+G  NF
Sbjct: 61  NPGKPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNF 120

Query: 121 AHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLT 180
            HF+RFL W++ TT FLL Y +KRI+++WN R++P+Y   RSE+I L + TP++ F+LLT
Sbjct: 121 PHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPLNLFILLT 180

Query: 181 ISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLS-NQDDD 239
           I+LL  RC  NQI+ G TQIE WEMDR+EN F+  +L+P+++ NL E+ P   S   D++
Sbjct: 181 ITLLFCRCLFNQIINGKTQIEDWEMDRLENRFYLKKLLPQLILNLWELYPELKSAKHDEE 240

Query: 240 IRKLLSQNRLSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMIFEKNELSVY 299
             +L+ +  +  D IVNFPYDL  + N    +G    W+ P+G   GNGM FEKNE++++
Sbjct: 241 AERLIEKKGIRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMNFEKNEIALF 300

Query: 300 EPEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDPRTTMPRK 359
           +P+  +    L+LPWPPD GRH        D N VE  T DGE+VVR R       + R+
Sbjct: 301 DPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSN-VEFITTDGEQVVRNRTHAKNPILSRE 359

Query: 360 KWYNDWGENLADFGVDLDEE 379
           +W+N+WGENL DFGVD++ E
Sbjct: 360 EWFNEWGENLEDFGVDVEME 379

>KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa]
           {ON} Anc_6.28 YOL003C
          Length = 396

 Score =  374 bits (961), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 200/397 (50%), Positives = 258/397 (64%), Gaps = 19/397 (4%)

Query: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60
           MA++LKWPWLGIAIP FLISFIGY AHYFIL + L  K QLWF+FSL MIW+SYYLAI  
Sbjct: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60

Query: 61  NPGKPTPGFRPSKFEW-ENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRN 119
           +PG P+   +    +    +C KC+ YKP RAHHCK CN+C+L MDHHCPWTMNCVG +N
Sbjct: 61  DPGSPSIADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKN 120

Query: 120 FAHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLL 179
           + HF+RFLFWVI TT+FLL  L +RI F+W   +  +  V R E++ LTILTPMDAF+LL
Sbjct: 121 YPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAFILL 180

Query: 180 TISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPR-----MLENLKEI-RPGSL 233
           TI+LLL+RC  NQI  GM+QIE WEM+R+E+ F+S +   R     ++ N+  I    S 
Sbjct: 181 TITLLLIRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIFSIESP 240

Query: 234 SNQDDDIRKLLSQN---RLSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMI 290
            +  +++  LL Q+   RL+   I+NFPYD++   NA   LG  +SW+ P+G  +G+GM 
Sbjct: 241 EDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEGDGMH 300

Query: 291 FEKNELSVYEPEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWV 350
           FE NE++  E    + D LLSLPWPPD    K           VE+    GE V+R R V
Sbjct: 301 FELNEIAS-EKASTLADLLLSLPWPPDTCTSKYGKSIDEGTKYVETHIEGGECVLRNRTV 359

Query: 351 DPRTTMP--------RKKWYNDWGENLADFGVDLDEE 379
            P   +P        RK W N+WGENL  FGVD++ E
Sbjct: 360 SPSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396

>KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {ON}
           Anc_6.28 YOL003C
          Length = 386

 Score =  370 bits (950), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 195/388 (50%), Positives = 252/388 (64%), Gaps = 19/388 (4%)

Query: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60
           M V+LK PW GIAIP  LI FIGY AH+FIL N L  K+Q+ F+F L MIWISYY+AIYT
Sbjct: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60

Query: 61  NPGKPTPGF--RPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHR 118
           NPGKP  G   + +  +   +C KCN +KPER+HHCK C QCVL MDHHCPWTMNC+G  
Sbjct: 61  NPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFG 120

Query: 119 NFAHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMP----NYFVHRSELIFLTILTPMD 174
           NF  F+RFL WVI TTS L  YL+ RI  +W  R+MP           EL+ L +LTPMD
Sbjct: 121 NFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMD 180

Query: 175 AFVLLTISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLS 234
            FVL TI+ L +RC  NQ++ GMTQIESWEM+R++NMF+S +L+P M+E + E  P   +
Sbjct: 181 LFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQT 240

Query: 235 NQDD-DIRKLLSQNR---LSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMI 290
            + + +  KLL  N    L    +VNFPYD++   N   SLG     + P+ TA+GNG+ 
Sbjct: 241 PEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNGVT 300

Query: 291 FEKNELSVYEPEIPIEDKLLSLPWPPDGGRHKVPGGGAND-VNIVESSTRDGERVVRKR- 348
           F+KN++S YE  + I D LL L WPPDGGR ++P     D  ++++ +  DGE ++RKR 
Sbjct: 301 FQKNDISTYEDNLSISDLLLCLSWPPDGGR-RIPHPQREDGAHMIDQTVEDGEFMIRKRN 359

Query: 349 -WVDPRTTMPRKKWYNDWGENLADFGVD 375
             ++ RTT     W N WGE L  FGVD
Sbjct: 360 SPIESRTT-----WENQWGETLEGFGVD 382

>TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28
           YOL003C
          Length = 377

 Score =  200 bits (508), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 149/412 (36%), Positives = 207/412 (50%), Gaps = 69/412 (16%)

Query: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60
           M ++   PW G+AIP  +I  +   +++ IL + L T + +W+  +  MI  SYYLAI T
Sbjct: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60

Query: 61  NPGKPTPGFRPSKFEWENFCNKCNNYKPE------------RAHHCKACNQCVLSMDHHC 108
            P  P P      F   +  N  N+  P             RAHHCK CN CV+ MDHHC
Sbjct: 61  -PPTPAPSTLTQSFI-SDVMNNENDIFPTTTCKKCKKIKLPRAHHCKTCNTCVVMMDHHC 118

Query: 109 PWTMNCVGHRNFAHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVH--RSELIF 166
           PWTMNCVG+ N+ HFIRFL WVI +T+ LL+ L+K+   L+  R+ P +     + ++I 
Sbjct: 119 PWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKYKIII 178

Query: 167 LTILTPMDAFVLLTISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLK 226
           LT+L P   FV LT+ LLLL+  +NQI  GMTQIE W+ + IEN +   +     L+   
Sbjct: 179 LTLLIPGTIFVWLTVLLLLLKTLQNQIWNGMTQIEYWQFEMIENKYFQSKSSKVALQLQL 238

Query: 227 EIRPGSLSNQD------DDIRKLLS--QN----RLSLDEIVNFPYDLNPWANAVNSLGDM 274
                +  N+         I+KL+S  QN      S   I+NFPYDL    N   ++G +
Sbjct: 239 LENLLNFYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNITTTMGSL 298

Query: 275 --YSWILPWG---TAKGNGMIFEKNELSVY---EPEIPIEDKLLSLPWPPDGGRHKVPGG 326
              SW  PW    TA  N +    NE +++   E    I+D LL LPWP +   +     
Sbjct: 299 NPLSWFNPWYTPLTASYNKI----NEFAIWDDNETHDNIKDMLLCLPWPLNYSNN----- 349

Query: 327 GANDVNIVESSTRDGERVVRKRWVDPRTTMPRKKWYNDWGENLADFGVDLDE 378
                    S+ +DGE VV+                ND+GE L DFGVD D+
Sbjct: 350 ---------STFQDGELVVKS---------------NDYGETLQDFGVDYDD 377

>Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL326C
           - Hypothetical ORF [contig 124] FULL
          Length = 360

 Score = 89.4 bits (220), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 68/127 (53%), Gaps = 7/127 (5%)

Query: 79  FCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLL 138
           FC  C  +KP+R HHC  CN+C L MDHHCPW  +CVG+RN  +FI FL +     S L+
Sbjct: 132 FCRTCVVWKPDRCHHCSGCNKCYLKMDHHCPWFASCVGYRNQKYFIHFLLYT-TAYSILV 190

Query: 139 TYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLTISLLLLRCAKNQIL-KGM 197
            +L    L +W R    N      ELI L +L      +++TIS+L        ++ K  
Sbjct: 191 FFLTGADLLMWFRSQGYN-----QELINLPLLIVWILSLVITISMLAFTSYTIYLVAKNQ 245

Query: 198 TQIESWE 204
           T IE +E
Sbjct: 246 TTIEMYE 252

>NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON}
           Anc_3.12
          Length = 327

 Score = 86.3 bits (212), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 70/130 (53%), Gaps = 7/130 (5%)

Query: 79  FCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLL 138
            C  C  +KP+R HHC  C++C+L MDHHCPW   C+G  N  +F++FL +    +  +L
Sbjct: 100 LCQTCQVWKPDRCHHCSTCDKCILKMDHHCPWFAECIGFENQKYFVQFLIYCTAYSIVVL 159

Query: 139 TYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLTISLLLLRC-AKNQILKGM 197
            +    + + ++ +       +  ELI L +LT     +++T+SL+     +  Q+LK  
Sbjct: 160 FFTSCELHYWFSGKQ------YEDELIDLMLLTVWILAIVITVSLIFFSSFSIYQLLKNQ 213

Query: 198 TQIESWEMDR 207
           T IE + M R
Sbjct: 214 TTIEMYGMKR 223

>KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 85.5 bits (210), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 45/129 (34%), Positives = 70/129 (54%), Gaps = 7/129 (5%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLLT 139
           C  C  +KP+R HHC +CN+C+L MDHHCPW   C+G +N  +FI+FLF+   + S ++ 
Sbjct: 106 CQTCMFWKPDRCHHCSSCNRCILKMDHHCPWFAECIGFKNQKYFIQFLFYC-TSYSIIVL 164

Query: 140 YLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLTISLLLLR-CAKNQILKGMT 198
           ++    ++ W R     Y     E I   +LT     +++ ISL+L    +  Q+L   T
Sbjct: 165 FVTSIQIYHWFRSTSYEY-----EFIDFKLLTVWLLAIVIFISLVLFTGFSVFQLLGNQT 219

Query: 199 QIESWEMDR 207
            IE +   R
Sbjct: 220 TIELYAYRR 228

>KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.12
           YNL326C
          Length = 328

 Score = 84.7 bits (208), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 69/131 (52%), Gaps = 5/131 (3%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLLT 139
           C  C  +KP+R HHC +C++C+L MDHHCPW   CVG RN   FI+FL +      F+L+
Sbjct: 103 CQSCRYWKPDRCHHCSSCDRCILKMDHHCPWIAGCVGFRNQKLFIQFLLYTTAYAIFVLS 162

Query: 140 YLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLTISLLLLRCAKNQILKGMTQ 199
            +    L+ W         +    L+FL I + +  F+ +T   L    + +Q+LK  T 
Sbjct: 163 -MTSVQLYRWFYNDKFQEELISGYLLFLWIFS-LVVFIAMT---LFSAFSVSQVLKNQTT 217

Query: 200 IESWEMDRIEN 210
           IE + + R  N
Sbjct: 218 IEMYGVQRWRN 228

>CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326c
          Length = 332

 Score = 83.6 bits (205), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 45/129 (34%), Positives = 70/129 (54%), Gaps = 7/129 (5%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLLT 139
           C  C+++KP+R HHC  CN CVL MDHHCPW   CVG+RN   FI+FL +     S L+ 
Sbjct: 106 CKSCSSWKPDRCHHCSTCNVCVLKMDHHCPWFAGCVGYRNQKFFIQFLIYC-TVYSILVL 164

Query: 140 YLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLTISLLLLRC-AKNQILKGMT 198
            L    ++ W +           ELI  T+L+     ++++IS+ +    + +Q+ +  T
Sbjct: 165 ILSSMEIYTWFKGEF-----FEVELINFTLLSLWLLALVVSISITIFTVFSISQVCQNQT 219

Query: 199 QIESWEMDR 207
            IE + + R
Sbjct: 220 TIELYSLRR 228

>KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 342

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/127 (37%), Positives = 65/127 (51%), Gaps = 7/127 (5%)

Query: 79  FCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLL 138
           FC  C  +KP+R HHC AC +C L MDHHCPW  +CVG+ N  +F++FL +     S L+
Sbjct: 105 FCRVCAVWKPDRCHHCSACKKCFLKMDHHCPWFASCVGYANQKYFVQFLIYG-TVFSILI 163

Query: 139 TYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLTISLLLLRC-AKNQILKGM 197
             L    L LW +    N      E+I L +L      V ++IS+L         I K  
Sbjct: 164 FLLSGTELLLWFKNQRYN-----QEMIQLPLLVVWILSVAISISMLAFTSYTVYLITKNQ 218

Query: 198 TQIESWE 204
           T IE +E
Sbjct: 219 TTIEMYE 225

>NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12
          Length = 335

 Score = 81.6 bits (200), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 67/135 (49%), Gaps = 9/135 (6%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLLT 139
           C  C  +KP+R HHC  CN+C+L MDHHCPW   C+G +N   FI+FL +     +F+  
Sbjct: 109 CQTCQVWKPDRCHHCSTCNKCILKMDHHCPWFAECIGFKNQKFFIQFLIYC-TIYAFVAL 167

Query: 140 YLVKRILFLW--NRRHMPNYFVHRSELIFLTILTPMDAFVLLTISLLLLRCAKNQILKGM 197
            L+      W  N+ +M  Y      + F  ++  + AFV+    L     +  Q+LK  
Sbjct: 168 GLISYQFVNWYKNQNYMNEY------IDFTLLIVGLLAFVISISVLAFSSFSIYQVLKNR 221

Query: 198 TQIESWEMDRIENMF 212
           T IE + + R    F
Sbjct: 222 TTIEMYGIRRYNRDF 236

>KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 349

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 76/285 (26%), Positives = 112/285 (39%), Gaps = 41/285 (14%)

Query: 6   KWPWLGIAIPLFLISFIGYCAHYF-------ILSNFLPTKKQLWFEFSLGMIWISYYLAI 58
           ++ W   AIP F +S   YC   F       I S     ++ L    +L    I+  L I
Sbjct: 47  RFRWKFRAIPAFYLSIYAYCTFLFFKDIEGLIRSRLFGVERLLIIPVALSAPIITGLLTI 106

Query: 59  YTNPGKPTPGFRPSKFEWENF-----CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMN 113
           +  P           ++   F     C  C   K  R  HC  C+QCV   DHHC W  N
Sbjct: 107 WIKPKSTYASPMLDAYDELIFHSGVSCRTCKLPKFARTKHCPICDQCVQLADHHCVWANN 166

Query: 114 CVGHRNFAHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPM 173
           C+G  N+ +F  FL     +  FL  Y   R+LFL         FVH  +L+ L+IL   
Sbjct: 167 CIGRGNYQYFYLFLV----SNVFLTNYGFLRLLFLQR-------FVHSRQLLILSILLGC 215

Query: 174 DAFVLLTISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIP--------RMLENL 225
              +L   S       ++    GMT  E  +   I +M  + Q++         R+L + 
Sbjct: 216 FGVILAVFSYFQFVLVRD----GMTTNEENKWLVIHDMIRARQMVTDDTGKYYFRLLADC 271

Query: 226 KEIRPGSLSNQDDDIRKLLSQNRLSLDEI---VNFPYDLNPWANA 267
           +E    SL+N     +     N   L++    +   Y  NP+ NA
Sbjct: 272 QEDSAESLTNPRHSSQ---GPNEFHLNDSSPDIYVYYSTNPYDNA 313

>Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON}
           (48992..49972) [981 nt, 327 aa]
          Length = 326

 Score = 80.9 bits (198), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 41/61 (67%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLLT 139
           C  CN +KP+R HHC AC++C+L MDHHCPW   CVG +N  +F++FL +       ++T
Sbjct: 106 CRTCNVWKPDRCHHCSACDKCILKMDHHCPWFAECVGFKNQKYFVQFLIYTTVYAILVMT 165

Query: 140 Y 140
           Y
Sbjct: 166 Y 166

>KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {ON}
           weakly similar to uniprot|P42836 Saccharomyces
           cerevisiae YNL326C PFA3 Palmitoyltransferase for Vac8p
           one of three yeast DHHC-cysteine rich domain proteins
           (Pfa3p Erf2p Akr1p) with palmitoyltransferase activity
           required for vacuolar integrity under stress conditions
          Length = 325

 Score = 80.1 bits (196), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 68/134 (50%), Gaps = 21/134 (15%)

Query: 79  FCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLL 138
           FC  C  +KP+R HHC  CN+C L MDHHCPW  +CVG RN   F++FL +    + ++L
Sbjct: 104 FCQTCEIWKPDRCHHCSKCNKCFLKMDHHCPWFASCVGFRNQKFFVQFLAYTTVYSLYVL 163

Query: 139 TYLVKRILFLWNRRHMPNYFVHRSELI--------FLTILTPMDAFVLLTISLLLLRCAK 190
             +    L+ W R+       ++SEL+         L+++  +  F   T ++ L     
Sbjct: 164 L-MTSAQLYSWFRQMK-----YKSELLDLHLLVVWVLSVIAAIATFAFTTYTIWL----- 212

Query: 191 NQILKGMTQIESWE 204
             + K  T IE +E
Sbjct: 213 --VTKNETTIEQYE 224

>TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 79.7 bits (195), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 70/129 (54%), Gaps = 7/129 (5%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLLT 139
           C  CN +KP+R+HHC  CN+CVL MDHHCPW   C+G +N   FI+FL +   T ++++ 
Sbjct: 110 CRTCNVWKPDRSHHCSTCNRCVLKMDHHCPWFSECIGFKNQKFFIQFLIYN-TTYAYVIA 168

Query: 140 YLVKRILFLW-NRRHMPNYFVHRSELIFLTILTPMDAFVLLTISLLLLRCAKNQILKGMT 198
            L  + ++ W +     N FV+   L+FL IL  + +  L   +      +   ++   T
Sbjct: 169 ILTSKQMYNWFDDGSYENEFVNM-YLLFLWILALVVSLALSCFAGF----SVYMVMNNKT 223

Query: 199 QIESWEMDR 207
            IE + M +
Sbjct: 224 TIEMYAMRK 232

>TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON}
           Anc_3.12 YNL326C
          Length = 329

 Score = 79.3 bits (194), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 29/53 (54%), Positives = 38/53 (71%)

Query: 78  NFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWV 130
             C  C+ +KP+R HHC ACN+C+L MDHHCPW  +CVG RN  +FI+FL + 
Sbjct: 106 RLCRTCHVWKPDRCHHCSACNRCILRMDHHCPWLPDCVGFRNQKYFIQFLMYA 158

>NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON} 
          Length = 329

 Score = 78.2 bits (191), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 71/139 (51%), Gaps = 12/139 (8%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLLT 139
           C  C +YKP R+ HC  C++CVL  DHHC W  NCVG  N+ +F  FL     T +F LT
Sbjct: 137 CRTCQSYKPARSKHCSICDRCVLVADHHCIWVNNCVGKGNYTYFYMFLI----TNTFSLT 192

Query: 140 YLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLTISLLLLRCAKNQILKGMTQ 199
           Y   R+L ++   +  N ++ ++ L  LTIL    + +    + L L  A+    +GMT 
Sbjct: 193 YAFIRLLTIF---YTTNVYLPKNTLT-LTILCGCFSVICGIFTFLQLNLAQ----EGMTT 244

Query: 200 IESWEMDRIENMFHSGQLI 218
            E  +   +      G+L+
Sbjct: 245 NEKDKWFTVHEFMRDGKLV 263

>YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}
           PFA3Palmitoyltransferase for Vac8p, required for
           vacuolar membrane fusion; contains an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain;
           autoacylates; required for vacuolar integrity under
           stress conditions
          Length = 336

 Score = 77.8 bits (190), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 96/234 (41%), Gaps = 36/234 (15%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLLT 139
           C  C+ +KP+R HHC +C+ C+L MDHHCPW   C G RN   FI+FL +       +L 
Sbjct: 106 CQVCHVWKPDRCHHCSSCDVCILKMDHHCPWFAECTGFRNQKFFIQFLMYTTLYAFLVLI 165

Query: 140 YLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLTISLLLLRC-AKNQILKGMT 198
           Y    +   +N            ELI   +L      V + IS+L   C +  Q+ K  T
Sbjct: 166 YTCYELGTWFNSGSF------NRELIDFHLLGVALLAVAVFISVLAFTCFSIYQVCKNQT 219

Query: 199 QIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQDDDIRKLLSQNRLSLDEIVNFP 258
            IE   M R                +L+ +     +N+              L+ I +  
Sbjct: 220 TIEVHGMRRYR-------------RDLEILNDSYGTNE-------------HLENIFDLG 253

Query: 259 YDLNPWANAVNSLGDMYSWILPWGTAKGNGMIFEKNELSVYEPEIP-IEDKLLS 311
             +  W + + +      WILP  T K       K+E  +Y    P ++D+LLS
Sbjct: 254 SSMANWQDIMGT--SWLEWILPIETFKYKKSKHTKDEKGLYFNVRPQVQDRLLS 305

>TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}
           Anc_3.12 YNL326C
          Length = 345

 Score = 77.8 bits (190), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 66/129 (51%), Gaps = 7/129 (5%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLLT 139
           C  C  +KP+R HHC +C++C+L MDHHCPW   C+G +N  +FI FL +     +F+  
Sbjct: 106 CRTCLVWKPDRCHHCSSCDRCILKMDHHCPWFAECIGFKNHKYFINFLIYNSLYATFVCL 165

Query: 140 YLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLTISLLLLRC-AKNQILKGMT 198
              K    LWN      Y    +ELI + +L      ++ ++S+ L    +  Q+L   T
Sbjct: 166 ISSKE---LWNWFSQEKYV---TELINIHLLLLFIVSLITSVSMTLFTAYSIYQVLINRT 219

Query: 199 QIESWEMDR 207
            IE +   R
Sbjct: 220 TIELYAYRR 228

>Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON}
           YNL326C (REAL)
          Length = 334

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 65/251 (25%), Positives = 97/251 (38%), Gaps = 70/251 (27%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLLT 139
           C  C+ +KP+R HHC +C+ CVL MDHHCPW   C G +N   FI+FL +       +L 
Sbjct: 106 CQVCHVWKPDRCHHCSSCDICVLKMDHHCPWFAECTGFKNQKFFIQFLMYTTCYAFLVLI 165

Query: 140 YLVKRILFLWNR----RHMPNYFVHRSELIFLTILTPMDAFVLLTISLLLLRCAKNQILK 195
           Y    +   +N     R + ++ +    L+ + +   + AF + +I          Q+ K
Sbjct: 166 YTCYELGTWFNSGSFNRELIDFQLLGVALLAVAVFITVLAFTVFSIY---------QVCK 216

Query: 196 GMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQDDDIRKLLSQNRLSLDEIV 255
             T IE   M R                                 R L         EI+
Sbjct: 217 NQTTIEVHGMRRYR-------------------------------RDL---------EII 236

Query: 256 NFPYDLNPWANAVNSLGDMYS------------WILPWGTAKGNGMIFEKNELSVY---E 300
           N  Y  N ++  V  LG   +            W+LP  T K       K+E  +Y    
Sbjct: 237 NDSYGTNVYSENVFDLGSSMANWQDIMGSSWLEWLLPIETYKYKKSKHTKDEKGLYFNVR 296

Query: 301 PEIPIEDKLLS 311
           PE  ++D+LLS
Sbjct: 297 PE--VQDRLLS 305

>SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 333

 Score = 74.7 bits (182), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 57/92 (61%), Gaps = 6/92 (6%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLLT 139
           C  C  +KP+R+HHC +CN+C L MDHHCPW  +C+G +N   FI+FL +   TT + + 
Sbjct: 105 CRNCKVWKPDRSHHCSSCNKCFLKMDHHCPWFASCIGFKNQKLFIQFLLY---TTWYAVF 161

Query: 140 YLVKRILFLWNRRHMPNYFVHRSELIFLTILT 171
             +   L LW  + + N  ++  ELI L+++T
Sbjct: 162 VFMTTGLQLW--KWLDNK-MYEKELIDLSLMT 190

>ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 327

 Score = 73.9 bits (180), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 87/201 (43%), Gaps = 50/201 (24%)

Query: 40  QLWFEF---------SLGMIWISYYLAIYTNPGKPT--------------------PGF- 69
           Q+W++F         ++G+   +YY  I T PG P                     P F 
Sbjct: 34  QIWYKFLVSVDVFLVAIGLY--TYYKVIITGPGSPLDYDTIKVYDMQAVESGAELPPEFL 91

Query: 70  --------RPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFA 121
                   R  +F     C  C+ +KP+R HHC  C++C+L MDHHCPW   C+G  N  
Sbjct: 92  SRRSITTKRDGRFR---VCRTCHVWKPDRCHHCSRCDKCILKMDHHCPWFPGCIGFNNQR 148

Query: 122 HFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLTI 181
            FI++L +   TT  ++ +L   I  L    H  N   +  ELI   +L+     V +++
Sbjct: 149 FFIQYLLYA--TTYSIVIFLFSSIQLL----HWFNTKQYEVELIDFHLLSVWLLGVAVSV 202

Query: 182 SL-LLLRCAKNQILKGMTQIE 201
           SL      +  Q+ K  T +E
Sbjct: 203 SLSFFTGFSIYQVTKNQTTVE 223

>KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 73.9 bits (180), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 67/143 (46%), Gaps = 16/143 (11%)

Query: 78  NFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFL 137
            FC+ C   KP R+ HC  CN+CVL  DHHC W  NC+G  N+ +F  FL     + + L
Sbjct: 135 TFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFL----VSNTLL 190

Query: 138 LTYLVKRILFL--WNRRHMPNYFVHRSELIFLTILTPMDAFVLLTISLLLLRCAKNQILK 195
           L Y   RI+ L  ++    PN        I LT L    AF  + +    L+ A   +  
Sbjct: 191 LGYAFLRIILLTAYSDIGFPN--------IVLTFLILSGAFFAILLVFTYLQFA--LVYD 240

Query: 196 GMTQIESWEMDRIENMFHSGQLI 218
           GMT  E  +   I+     G+LI
Sbjct: 241 GMTTNEKDKWFTIQEFMREGRLI 263

>NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8.286
           YDR126W
          Length = 339

 Score = 73.6 bits (179), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 66/145 (45%), Gaps = 12/145 (8%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLLT 139
           C  C   KP R+ HC+ CN C+L  DHHC W  NC+G  N+ +F  FL          +T
Sbjct: 139 CRTCGIVKPARSKHCEICNSCILLCDHHCLWVNNCIGEGNYLYFYSFLL----CNCITMT 194

Query: 140 YLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLTISLLLLRCAKNQILKGMTQ 199
           Y   R+  ++ + H P+       ++ L IL    A +    + L L+  K+    GMT 
Sbjct: 195 YSFIRLFLMYCQGHAPS----SRNILTLLILCGSFAVICAGFTFLQLQLVKD----GMTT 246

Query: 200 IESWEMDRIENMFHSGQLIPRMLEN 224
            E  +   ++     G+LI    EN
Sbjct: 247 NEQDKWFTLQEYMRDGKLIRTKDEN 271

>SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 555

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 88/228 (38%), Gaps = 25/228 (10%)

Query: 5   LKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFE--------FSLGMIWISYYL 56
           L++ W    +PLF  S   YC   F    +      L F           LG I I+ YL
Sbjct: 44  LRYRWKYNVVPLFYTSIYIYCVLMFYKDLYRDLSPYLLFLERFLIVPLLLLGPI-ITGYL 102

Query: 57  AIYTNPGKPTP------GFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPW 110
            +   P            F    F     C  C+  KP R+ HC  CN+C+L +DHHC W
Sbjct: 103 CMTIEPDSTKSLADCRVPFDEIIFHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIW 162

Query: 111 TMNCVGHRNFAHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTIL 170
             NC+G  N+ +F  FL   +     LL+Y   R+  +       N  +    ++ LTIL
Sbjct: 163 VNNCIGKGNYKYFYGFLLSNVT----LLSYSFLRLTSIQLMSQTEN--IKTKPMLVLTIL 216

Query: 171 TPMDAFVLLTISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLI 218
           T     ++            N +  GMT  E  +   ++     G L+
Sbjct: 217 TGCFDIIVAVFGYTQF----NLVHDGMTTNEQDKWFTVQEFMRDGNLV 260

>ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {ON}
           similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 366

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 56/103 (54%), Gaps = 4/103 (3%)

Query: 54  YYLAIYTNPGKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMN 113
           YY  I     +   G   +K E + +C  C  ++P RA HC  C  C+L+ DHHC W  N
Sbjct: 156 YYSTISLPAPQTIRGDIQAKIELK-YCTSCRIWRPPRASHCSTCEACILTHDHHCIWVNN 214

Query: 114 CVGHRNFAHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPN 156
           C+G RN+ +FI FL   I ++ FL+       + +++ R++P+
Sbjct: 215 CIGQRNYRYFILFLASAILSSIFLIANCS---IHIYHHRNLPS 254

>TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.389
           YLR246W
          Length = 404

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 65/128 (50%), Gaps = 9/128 (7%)

Query: 72  SKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVI 131
           S++    +C  C  ++P R+ HC  C+ CV+S+DHHC W  NCVG RN+ +F+ FL   I
Sbjct: 188 SQYVEITYCRTCRIWRPPRSSHCSICDCCVMSLDHHCLWLNNCVGKRNYRYFLIFLTSTI 247

Query: 132 ETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLTISLLLLRCAKN 191
            T  FL   L+   + +   RH      +    I LT+      +  L+IS  ++  A +
Sbjct: 248 MTVIFL---LINTGIHIGKNRHEKKPASNIPVTILLTV------YGSLSISYPIILLAYH 298

Query: 192 QILKGMTQ 199
            +L G  Q
Sbjct: 299 LVLTGTNQ 306

>Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON}
           YNL326C (REAL)
          Length = 330

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 63/129 (48%), Gaps = 7/129 (5%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLLT 139
           C  C+ +KP+R HHC +C+ C+L MDHHCPW   C G +N   FI+FL +   TT +   
Sbjct: 106 CQICHVWKPDRCHHCSSCDMCILKMDHHCPWFAECTGFKNQKLFIQFLMY---TTFYAFL 162

Query: 140 YLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLTISLLLLRC-AKNQILKGMT 198
            L+     L    H  ++     ELI   +L      + + IS+L     +  Q+    T
Sbjct: 163 VLIYSCYELGTWFHSGSF---NQELIDFHLLGVALLAIAIFISVLAFTAFSIYQVCNNQT 219

Query: 199 QIESWEMDR 207
            IE + M R
Sbjct: 220 TIELYGMRR 228

>Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 37/61 (60%)

Query: 79  FCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLL 138
           +C  C  ++P R  HC  CN CV+  DHHC W  NCVG RN+  F+ FL   I ++ FLL
Sbjct: 174 YCQSCRIWRPPRTSHCSTCNVCVMVHDHHCVWVNNCVGKRNYRFFLIFLLSAIFSSVFLL 233

Query: 139 T 139
           T
Sbjct: 234 T 234

>TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.286
           YDR126W
          Length = 328

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 85/188 (45%), Gaps = 19/188 (10%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLLT 139
           C  C+  KP R+ HC  C +CVL  DHHC W  NC+G  N+  F  FL  V+   S  L+
Sbjct: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFL--VVNVIS--LS 193

Query: 140 YLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLTISLLLLRCAKNQILKGMTQ 199
           Y   R+L++   +  P+  V+   ++  TIL    A +    + L L+   +    GMT 
Sbjct: 194 YGFLRVLWISVMKD-PSMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVND----GMTT 248

Query: 200 IESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQ-----DDDIRKLLSQNRLSLDEI 254
            E  +   I+ +   G L+ R L+    I+     NQ       D +  + QN      I
Sbjct: 249 GEKDKWYTIQQIMREGNLV-RTLDGQFFIQDQQNPNQFYSTNAYDSKLYVPQNY----SI 303

Query: 255 VNFPYDLN 262
           VN P D+ 
Sbjct: 304 VNDPKDIT 311

>AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR246W
           (ERF2)
          Length = 367

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 40/62 (64%)

Query: 78  NFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFL 137
            +C  C  ++P RA HC  C+ C+LS DHHC W  NC+G RN  +F+ FLF  + ++ +L
Sbjct: 185 KYCTTCRIWRPPRASHCAVCDSCILSFDHHCDWLNNCIGQRNHRYFLAFLFSSVLSSIWL 244

Query: 138 LT 139
           LT
Sbjct: 245 LT 246

>Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON}
           similar to Ashbya gossypii ADL197C
          Length = 339

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 61/116 (52%), Gaps = 4/116 (3%)

Query: 79  FCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFW-VIETTSFL 137
           +C  C  +KP+R+HHC +CN+C L  DHHCPW  +C+G  N   F++FL +  + + S  
Sbjct: 109 YCATCGVWKPDRSHHCSSCNKCYLKRDHHCPWFSSCIGFNNQKFFVQFLMYSTLYSISIF 168

Query: 138 LTYLVKRILFLWNRRHMPNYF-VHRSELIFLTILTPMDAFVLLTISLLLLRCAKNQ 192
           +   ++ + +  N+ +   Y  ++   +  L+    +  F     S+ LL   KNQ
Sbjct: 169 IAATLQIVSWFRNQNYTTQYIDINLLVVWLLSTGASVSLFCFTGFSIYLL--TKNQ 222

>SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 352

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 39/67 (58%)

Query: 79  FCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLL 138
           +C  C  ++P RA HC  C  C+++ DHHC W  NC+G RN+ +F  FL   +  T+F++
Sbjct: 171 YCTTCRIWRPPRASHCSTCEACIITHDHHCKWVNNCIGQRNYHYFFTFLVSCVIATAFII 230

Query: 139 TYLVKRI 145
                R+
Sbjct: 231 ANCAIRV 237

>ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 365

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 97/210 (46%), Gaps = 32/210 (15%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLLT 139
           C  C + K ERAHH +    CV   DH C +  + +G  N+  F+++  ++    + + T
Sbjct: 127 CTNCQSLKTERAHHSRELGHCVPKFDHKCTYLGSIIGKDNYRLFVQYCVFMTIWLAIIWT 186

Query: 140 YLVKRILFLWNRRHMPNYFVHRSE----LIFLTILTPMDAFVLLTISLLLLRCAKNQILK 195
            +V  I     R    +Y  H S     LI + ILT +  F +   SLLL +   N I+K
Sbjct: 187 SIVAYI-----RSITRDYRGHGSHLNGNLIAILILTTL--FWITVTSLLLTQL--NCIVK 237

Query: 196 GMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQDDDIRKLLSQNRLSLDEIV 255
             T IE   M+R    F + ++                 N DD  R ++  N+   +   
Sbjct: 238 NKTSIEV--MERRRKAFSTRKMF-------------CYYNPDDGCRYVVELNKKEYESC- 281

Query: 256 NFPYDLNPWANAVNSLG-DMYSWILPWGTA 284
            +  D + WANAV SLG +++ W++PWGT+
Sbjct: 282 -WSKD-SWWANAVESLGSNIFMWVIPWGTS 309

>TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {ON}
           Anc_8.389 YLR246W
          Length = 359

 Score = 70.9 bits (172), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 36/61 (59%)

Query: 79  FCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLL 138
           +C  C  ++P RA HC  C  CV++ DHHC W  NCVG RN+ +FI FL   +    FL+
Sbjct: 180 YCTSCRIWRPPRASHCSTCGVCVMTHDHHCIWVNNCVGQRNYRYFIIFLIGTVLAELFLI 239

Query: 139 T 139
            
Sbjct: 240 A 240

>Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar to
           Ashbya gossypii AGL125C
          Length = 368

 Score = 70.5 bits (171), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 48/86 (55%), Gaps = 5/86 (5%)

Query: 53  SYYLAIYTNPGKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTM 112
           S Y +I T P   T    P + +   +C  C  ++P RA HC  CN C+++ DHHC W  
Sbjct: 167 SEYYSIITLPSSSTNS--PIQLK---YCTTCRIWRPLRASHCSTCNSCIMTFDHHCIWVN 221

Query: 113 NCVGHRNFAHFIRFLFWVIETTSFLL 138
           NCVG RN+ +F+ F++  + T   L+
Sbjct: 222 NCVGQRNYRYFLTFIYSAVLTIILLV 247

>Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}
           YNL326C (REAL)
          Length = 336

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 34/51 (66%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWV 130
           C  C+ +KP+R HHC +C+ C+L MDHHCPW   C G +N   FI+FL + 
Sbjct: 106 CQICHVWKPDRCHHCSSCDICILKMDHHCPWFAECTGFKNQKFFIQFLMYT 156

>TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {ON}
           Anc_8.286 YDR126W
          Length = 333

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 72/142 (50%), Gaps = 13/142 (9%)

Query: 78  NFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFL 137
           N C+ CN  KP R+ HC  C  C+L  DHHC W  NC+G  N+ +F  F+F ++ T S  
Sbjct: 137 NVCSTCNIEKPARSKHCNICGTCILLQDHHCIWVNNCIGLGNYKYF--FMFLLLNTIS-- 192

Query: 138 LTYLVKRILFL-WNRRHMPNYFVHRSELIFLTILTPMDAFVLLTISLLLLRCAKNQILKG 196
           L+Y   R+L +  ++  +P        ++ L ILT   + +      L ++    Q+  G
Sbjct: 193 LSYAFLRLLHITLSKPDVPK----SKNILALCILTGSFSVICGVFFYLQMK----QVNNG 244

Query: 197 MTQIESWEMDRIENMFHSGQLI 218
           MT  E+ +   ++ +   G+LI
Sbjct: 245 MTTNETDKWYAVQELMREGKLI 266

>CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar to
           uniprot|Q04629 Saccharomyces cerevisiae YDR126w
          Length = 330

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 62/140 (44%), Gaps = 9/140 (6%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLLT 139
           C  C   KP R+ HC  CN C+   DHHC W  NCVG  N+ +F  FL     +   LL+
Sbjct: 136 CRTCKQVKPARSKHCTVCNSCIYLADHHCVWINNCVGMGNYMYFYSFL----CSNLLLLS 191

Query: 140 YLVKRILFL-WNRRHMPNYFVHRSELIFLTILTPMDAFVLLTISLLLLRCAKNQILKGMT 198
           Y   R++F+ +N+            L+ L+IL      +L      +     +    GMT
Sbjct: 192 YSFIRLIFIQFNKSAYNTTPTGEKSLLILSILCGSFTVILAVYCYFVFELVNS----GMT 247

Query: 199 QIESWEMDRIENMFHSGQLI 218
             E  +   + +  ++G L+
Sbjct: 248 TNEKDKWQMVHDYINTGDLV 267

>Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 76/164 (46%), Gaps = 15/164 (9%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLLT 139
           C+ C+  KP R+ HC  CN+C+L  DHHC W  NC+G  N+  F  +LF +    S L  
Sbjct: 136 CSTCHIIKPARSKHCSICNRCILVADHHCIWVNNCIGKGNYLQF--YLFLISNIFSLLYA 193

Query: 140 YLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLTISLLLLRCAKNQILKGMTQ 199
           +L    + L ++  +P        ++ LTIL      + +  + L L   +    +GMT 
Sbjct: 194 FLRLWCISLNSKTALPR------AVLTLTILCGCFTIICIIFTYLQLTIVR----EGMTT 243

Query: 200 IESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQDDDIRKL 243
            E  +   I+     G+L+  + +N +      L   +DD  KL
Sbjct: 244 NEQDKWYTIQEYMREGKLVRSLNDNCQS---WFLKLTEDDTTKL 284

>KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.389
           YLR246W
          Length = 354

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 35/61 (57%)

Query: 78  NFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFL 137
            +C  C  ++P RA HC+ C  CV + DHHC W  NCVG RN+ +F+ FL     T + L
Sbjct: 184 KYCTACKIWRPPRASHCRICQVCVQTQDHHCAWINNCVGQRNYRYFLTFLTATCATCTVL 243

Query: 138 L 138
            
Sbjct: 244 F 244

>ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {ON}
           similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 330

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 69/136 (50%), Gaps = 18/136 (13%)

Query: 73  KFEWENF-------CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIR 125
           KF ++N        C  C   KP R+ HC  CNQCVL++DHHC W  NCVG  N+ +F  
Sbjct: 121 KFRYDNLLFYPNINCRTCQLPKPARSKHCNVCNQCVLAVDHHCIWINNCVGLGNYLYF-- 178

Query: 126 FLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLTISLLL 185
           +LF V+ + S  ++Y   R + +   +  PN    RS L F  +LT   A + +  + L 
Sbjct: 179 YLFLVLNSLS--MSYAFIRSMSIVGLK--PNIKYPRSILAF-NLLTGCFALICIVFTYLQ 233

Query: 186 LRCAKNQILKGMTQIE 201
           L   +    +GMT  E
Sbjct: 234 LCMVR----EGMTTNE 245

>TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 68/141 (48%), Gaps = 13/141 (9%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLLT 139
           C  C   KP R+ HC  C+QC+L  DHHC W  NC+G  NF +F  FLF      +  ++
Sbjct: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNFLYFYLFLF----DNTLFMS 192

Query: 140 YLVKRIL--FLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLTISLLLLRCAKNQILKGM 197
           Y   R+L   L  RR   N  V R +++ L IL     F+  T S + L   K+    GM
Sbjct: 193 YASMRLLEITLNFRRAGEN--VPR-DVMTLDILCGCFLFICGTFSYMQLLIVKD----GM 245

Query: 198 TQIESWEMDRIENMFHSGQLI 218
           T  E  +   I+ +    +L+
Sbjct: 246 TTNEKDKWYTIQCLMEDKKLV 266

>KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} similar
           to uniprot|Q04629 Saccharomyces cerevisiae YDR126W SWF1
           Spore Wall Formation
          Length = 324

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 53/226 (23%), Positives = 95/226 (42%), Gaps = 22/226 (9%)

Query: 6   KWPWLGIAIPLFLISFIGYCAHYF------ILSNFLPTKKQLWFEFSLGMIWISYYLAIY 59
           ++ W    +P F    + +C H F       ++ +L + ++ +   ++    ++   +++
Sbjct: 45  RYRWKYWLVPGFYACILIFCVHLFYNKLNDTVNPYLYSLEKAFIPITIAFTSLTGVASVF 104

Query: 60  TNPG--KPTPGFRPSK--FEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCV 115
             P   +  P F+P    F     C  C   K  R+ HC  C +C+   DHHC W  NCV
Sbjct: 105 VKPLGLQAGPQFQPDYIIFHPSAVCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCV 164

Query: 116 GHRNFAHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDA 175
           G+ N+ +F  FL     +   LLTY   R+L L+           + +  FL++     A
Sbjct: 165 GYGNYEYFYSFLL----SNCLLLTYASLRLLTLFRIT------AFKKDKFFLSLFLLTTA 214

Query: 176 FVLLTISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRM 221
           F L+ I     +     +  GMT  E  +   ++    +G L+  M
Sbjct: 215 FSLIAIVFTYYQL--KLVNDGMTNNEQDKWYLVQEYMRNGNLVKDM 258

>ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL326C
          Length = 390

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 42/77 (54%), Gaps = 1/77 (1%)

Query: 77  ENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSF 136
             +C KC  +KP+R HHC AC++C L  DHHC W   C+G+ N   F+ FL +     +F
Sbjct: 168 HRYCVKCKVWKPDRCHHCSACDKCYLRRDHHCVWFPGCIGYNNHKFFLHFLLYA-SVYAF 226

Query: 137 LLTYLVKRILFLWNRRH 153
            +  +    L +W R H
Sbjct: 227 WICIITTWDLVVWFRAH 243

>KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.389
           YLR246W
          Length = 361

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 36/61 (59%)

Query: 79  FCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLL 138
           +C  C  ++P RA HC  C  CV++ DHHC W  NCVG RN+ +F+ FL      + FLL
Sbjct: 177 YCRTCRIWRPPRASHCSICEACVMTHDHHCIWINNCVGQRNYRYFVTFLISGTLASIFLL 236

Query: 139 T 139
            
Sbjct: 237 A 237

>YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subunit
           of a palmitoyltransferase, composed of Erf2p and Shr5p,
           that adds a palmitoyl lipid moiety to heterolipidated
           substrates such as Ras1p and Ras2p through a thioester
           linkage; mutants partially mislocalize Ras2p to the
           vacuole
          Length = 359

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 37/61 (60%)

Query: 79  FCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLL 138
           +C  C  ++P R+ HC  CN CV+  DHHC W  NC+G RN+  F+ FL   I ++  LL
Sbjct: 174 YCPSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLIFLLGAILSSVILL 233

Query: 139 T 139
           T
Sbjct: 234 T 234

>Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 67.8 bits (164), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 64/142 (45%), Gaps = 12/142 (8%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLLT 139
           C+ C   K  R+ HC  CN+CVL  DHHC W  NC+G  N+  F  FLF  I    F ++
Sbjct: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNI----FSMS 191

Query: 140 YLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLTISLLLLRCAKNQILKGMTQ 199
           Y   R+ F+       +  V    ++ LTIL      +    + L L   K    +GMT 
Sbjct: 192 YAFLRLYFI----SFNSTAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVK----EGMTT 243

Query: 200 IESWEMDRIENMFHSGQLIPRM 221
            E  +   I+     G+L+  +
Sbjct: 244 NEQDKWYTIQEYMREGKLVRSL 265

>NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389
          Length = 374

 Score = 68.2 bits (165), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 36/60 (60%)

Query: 79  FCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLL 138
           +C  C  ++P R+ HC  C  CVL  DHHC W  NCVG RN+ +F+ FL     T+ FL+
Sbjct: 183 YCKTCRIWRPPRSSHCSICETCVLMHDHHCVWVNNCVGQRNYRYFLTFLTSSTLTSIFLI 242

>KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 358

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 35/61 (57%)

Query: 78  NFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFL 137
            +C  C  ++P RA HC  C  CVL+ DHHC W  NC+G RN+ +F+ FL      T+  
Sbjct: 176 KYCATCRIWRPPRASHCSTCEACVLTHDHHCTWVNNCIGQRNYRYFLTFLASCCLATTLC 235

Query: 138 L 138
           +
Sbjct: 236 I 236

>Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246W
           (REAL)
          Length = 359

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 36/61 (59%)

Query: 79  FCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLL 138
           +C  C  ++P R+ HC  CN CV+  DHHC W  NC+G RN+  F+ FL   + ++  LL
Sbjct: 174 YCQSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLVFLLSAVISSIILL 233

Query: 139 T 139
            
Sbjct: 234 A 234

>CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {ON}
           similar to uniprot|Q06551 Saccharomyces cerevisiae
           YLR246w ERF2
          Length = 326

 Score = 66.6 bits (161), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 36/61 (59%)

Query: 79  FCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLL 138
           +C+ C  ++P RA HC  C  CVL+ DHHC W  NCVG RN+ +F+ FL       + L+
Sbjct: 159 YCHTCKIWRPPRASHCSVCECCVLTHDHHCIWVNNCVGQRNYRYFLAFLLSSTLACALLI 218

Query: 139 T 139
            
Sbjct: 219 A 219

>Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 36/61 (59%)

Query: 79  FCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLL 138
           +C  C  ++P R+ HC  CN CV+  DHHC W  NC+G RN+  F+ FL   I ++  LL
Sbjct: 174 YCTSCRIWRPPRSSHCSTCNICVMVHDHHCIWVNNCIGKRNYRFFLIFLLSAIFSSILLL 233

Query: 139 T 139
            
Sbjct: 234 V 234

>TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.389
           YLR246W
          Length = 360

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 71/150 (47%), Gaps = 10/150 (6%)

Query: 79  FCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLL 138
           +C+ C+ ++P RA HC  C  C+   DHHC W  NCVG+RN+ +FI FL   I ++ F++
Sbjct: 189 YCSTCHIWRPPRASHCSICQACIDVHDHHCIWINNCVGNRNYRYFIIFLVGAILSSIFII 248

Query: 139 TYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLTISLLLLRCAKN--QILKG 196
                 +  +    + P   +    LI    LT +   +LL   + L    +   + L  
Sbjct: 249 INCSIHVARIRRASNAPVAIL----LIVYGCLTIIYPGILLGYHIALTGTGQTTREFLHT 304

Query: 197 MTQIESWEMDRI----ENMFHSGQLIPRML 222
           +  I++  + R+    +N F SG     M+
Sbjct: 305 LHGIKNPMLSRVTRARDNAFDSGSFFHNMI 334

>NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389
          Length = 389

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 36/60 (60%)

Query: 79  FCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLL 138
           +C  C  ++P R+ HC  C  C+++ DHHC W  NC+G RN+  F+ FL     T+ FL+
Sbjct: 216 YCTTCRIWRPPRSSHCSICEACIITHDHHCIWVNNCIGQRNYRFFLTFLLSGTFTSIFLI 275

>Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W
           (ERF2) - Mutation has an Effect on Ras Function [contig
           251] FULL
          Length = 353

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 32/50 (64%)

Query: 78  NFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFL 127
            +C  C  ++P RA HC  C  C+L+ DHHC W  NC+G RN+ +F+ FL
Sbjct: 171 KYCPTCRIWRPPRASHCSVCGACILNHDHHCKWVNNCIGQRNYRYFLTFL 220

>KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]
           {ON} similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 355

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 43/81 (53%), Gaps = 7/81 (8%)

Query: 67  PGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRF 126
           P   P+      +C  C  ++P R+ HC  C+ CVLS DHHC W  NC+G RN+  F+ F
Sbjct: 161 PTKNPNASVSMKYCQTCRIWRPPRSAHCSVCDVCVLSHDHHCKWLNNCIGKRNYRFFLEF 220

Query: 127 L-------FWVIETTSFLLTY 140
           L         +I  +SF L+Y
Sbjct: 221 LMASTISCILLILLSSFRLSY 241

>Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W
           (REAL)
          Length = 336

 Score = 65.1 bits (157), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 33/57 (57%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSF 136
           C+ C   KP R+ HC  CN+C+L  DHHC W  NC+G  N+  F  FL   I + S+
Sbjct: 136 CSTCRITKPARSRHCSICNRCILVADHHCIWVNNCIGKGNYIQFYLFLISNIVSMSY 192

>YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}
           SWF1Palmitoyltransferase that acts on transmembrane
           proteins, including the SNAREs Snc1p, Syn8p, Tlg1p and
           likely all SNAREs; contains an Asp-His-His-Cys-cysteine
           rich (DHHC-CRD) domain; may have a role in vacuole
           fusion
          Length = 336

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 71/168 (42%), Gaps = 12/168 (7%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLLT 139
           C+ C   KP R+ HC  CN+CVL  DHHC W  NC+G  N+  F  +LF +    S    
Sbjct: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQF--YLFLISNIFSMCYA 193

Query: 140 YLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLTISLLLLRCAKNQILKGMTQ 199
           +L    + L +   +P        ++ LTIL      +    + L L   K    +GMT 
Sbjct: 194 FLRLWYISLNSTSTLPR------AVLTLTILCGCFTIICAIFTYLQLAIVK----EGMTT 243

Query: 200 IESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQDDDIRKLLSQN 247
            E  +   I+     G+L+  + ++           +DD    L  Q+
Sbjct: 244 NEQDKWYTIQEYMREGKLVRSLDDDCPSWFFKCTEQKDDAAEPLQDQH 291

>Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON}
           (35544..36509) [966 nt, 322 aa]
          Length = 321

 Score = 61.2 bits (147), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 71/161 (44%), Gaps = 20/161 (12%)

Query: 4   KLKWPWLGIAIP-LFLISFIGYCAHYFILSNFLPTKKQLWFE--FSLGMIWISY-YLAIY 59
           K ++ W    +P L+L  ++    +Y +  NF+      WFE    L +++ S  Y  + 
Sbjct: 43  KERYRWKYYLVPGLYLGLYLFVIIYYHLRVNFMVNPHLYWFEKGLILPIMFTSLPYFGVM 102

Query: 60  TNPGKPTPGFRP-----SKFEWENF-------CNKCNNYKPERAHHCKACNQCVLSMDHH 107
           T   KP           +++ ++         C  C   KP R+ HC  C++C+L  DHH
Sbjct: 103 TMITKPENSIEHGINSNNRYRFDEILYFPNVSCKTCRKPKPARSKHCSICDKCILLQDHH 162

Query: 108 CPWTMNCVGHRNFAHFIRFLFWVIETTSFLLTYLVKRILFL 148
           C W  NC+G  N+  F  F    I   S  + Y   R+LF+
Sbjct: 163 CIWVNNCIGMGNYKWFYLF----IGGNSLTMIYCFTRLLFI 199

>KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON}
           Anc_8.286 YDR126W
          Length = 331

 Score = 61.2 bits (147), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 49/114 (42%), Gaps = 16/114 (14%)

Query: 47  LGMIWISYYLAIYTNP---GKPTPGFRPSKFEW---------ENFCNKCNNYKPERAHHC 94
           L  I +S  L ++T P   G    G  PS+ +W            C  C+  K  R+ HC
Sbjct: 94  LAAIPVSGLLTMFTRPEGCGGRDQGVAPSEGQWPYDGILYYPNTTCRSCHTVKWARSKHC 153

Query: 95  KACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLLTYLVKRILFL 148
             C +C+   DHHC W   C+G  NF +F  FL         +LTY   R+ F 
Sbjct: 154 SICRRCIQLADHHCIWFNTCIGRGNFFYFYVFL----ACHCLILTYAFARLFFF 203

>Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii AGR065W
          Length = 340

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 70/160 (43%), Gaps = 15/160 (9%)

Query: 59  YTNPGKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHR 118
           Y  P  P  G     F     C  C   K  R+ HC  C +C+L  DHHC W  NC+G  
Sbjct: 115 YVGPEIPFDGI---IFHDNIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLG 171

Query: 119 NFAHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVL 178
           N+ +F  FL     +   +L+Y   R+        +    + RS   FL+++  +  F +
Sbjct: 172 NYQYFYLFLL----SNCSMLSYATIRL------SSVAPSGLWRSNKSFLSLMILVCCFAV 221

Query: 179 LTISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLI 218
           ++IS   ++ A   +  GMT  E  +   I  +  + QL+
Sbjct: 222 ISISFTYMQFA--LVRDGMTTNEKDKWYTIHKLMRNEQLL 259

>Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {ON}
           YDR126W (PSL10) - Hypothetical ORF [contig 174] FULL
          Length = 338

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 78/195 (40%), Gaps = 21/195 (10%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLLT 139
           C  C   K  R+ HC  C +C    DHHC W  NC+G  N+ +F  FL     +  FL  
Sbjct: 131 CRTCKMPKYARSKHCAICGRCTQLADHHCVWANNCIGKGNYEYFYLFL----ASNVFLTV 186

Query: 140 YLVKRILFLW---NRRHMPNYFVHRSELIFLTILTPMDAFVLLTISLLLLRCAKNQILKG 196
           Y   R+L+L      R +    +       + ++      VL+   +     +K  ++  
Sbjct: 187 YGFTRLLYLQPTVKSRTLLTLALLLGSFALILVIFSYFQVVLIKDGMTTNEESKWLVVHD 246

Query: 197 MTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQDDDIRKLLSQNRLSLDEIVN 256
           M +     +D      ++G+   R+ EN   + P   SN+  ++    S +R +      
Sbjct: 247 MMRARKLVVD------NAGKFYYRIPENEDSLSPELKSNEGPELTT-TSPSRYTF----- 294

Query: 257 FPYDLNPWANAVNSL 271
             Y  NP+ N   ++
Sbjct: 295 --YSTNPYDNCTYTV 307

>KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.579
           YDR459C
          Length = 370

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 62/144 (43%), Gaps = 8/144 (5%)

Query: 60  TNPGKPTPG--FRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGH 117
           T P    P   ++     +  +C+ C   K  R+HH    N C+   DH+C W    +G 
Sbjct: 97  TQPTSTVPAKLYQCDSNGYPRWCSNCEGLKSLRSHHSSVANYCIPRFDHYCIWLGTTIGK 156

Query: 118 RNFAHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFV 177
            N+  F+ FLF+   T SF + ++   + +L   RH          L+ L IL  M  F 
Sbjct: 157 DNYKQFVIFLFYC--TVSFGIMWISAIVCYLKYGRHYQEQNNFDGNLVTLVILGAMGWFF 214

Query: 178 LLTISLLLLRCAKNQILKGMTQIE 201
           +      LL    + +++ +T +E
Sbjct: 215 VAG----LLLAHISYMVRNLTSLE 234

>NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {ON}
           Anc_5.579 YDR459C
          Length = 374

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/287 (21%), Positives = 115/287 (40%), Gaps = 30/287 (10%)

Query: 64  KPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHF 123
           KP   ++  K  +  +C  C + K  R+HH K   +C+L  DH+C W    +   N+  F
Sbjct: 102 KPPKYYQCDKNGYPPWCTHCQSLKLSRSHHSKQVGRCILRFDHYCAWIGCVIARNNYRLF 161

Query: 124 IRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLTISL 183
           ++++ W       LL Y +   +F+     M N       +I   IL+ +   + L + +
Sbjct: 162 LQYVGWF---NLLLLWYWLTIAVFI-RTIGMLN-----GNVIVGFILSCLGWMMTLGLFI 212

Query: 184 LLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLK---EIRPGSLSNQDDDI 240
             +    N      T IE+ + +R +   H   +    +E+ +     +     NQ D  
Sbjct: 213 SHIYYMSN----NKTSIETLDAERGKRKKHKMMVTNDEIEHARIEYNRKYFCYYNQQDKF 268

Query: 241 RKLLSQNRLSLDEIVNFPYDLNPWANAVNSLG-DMYSWILPWGTAKGNGMIFEKNELSVY 299
           R ++    L+ DE        + W NA   LG D+  W+ PWG+   +    E +    Y
Sbjct: 269 RYVV---ELTADEFAKCWKKRSFWINAREFLGSDIIFWLFPWGSYFPDLRKREASSFQSY 325

Query: 300 EPEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVR 346
                +E+ +        G   +V    A  ++++E+    G  V +
Sbjct: 326 GQSYDLENII--------GPYKEVLSSSA--IDLIENRITQGNYVTK 362

>AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR126W (SWF1)
          Length = 326

 Score = 55.5 bits (132), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 32/66 (48%), Gaps = 4/66 (6%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLLT 139
           C  C   KP R+ HC  C +CV   DHHC W  NCVG  N+  F    +  +     LLT
Sbjct: 126 CRTCRVRKPARSRHCGVCGRCVPLADHHCVWLNNCVGRGNYGLF----YLALGAHCALLT 181

Query: 140 YLVKRI 145
           Y   R+
Sbjct: 182 YGAVRL 187

>KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {ON}
           Anc_5.579 YDR459C
          Length = 354

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 60/261 (22%), Positives = 106/261 (40%), Gaps = 40/261 (15%)

Query: 59  YTNP--GKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVG 116
           +T+P   KP   ++  +  +  +C  C + K  R HH      CV   DH+C W    +G
Sbjct: 103 FTSPQVNKPPLIYQCDENGYPTWCAHCQSVKSLRTHHSGRTGSCVFKFDHYCGWLGTLIG 162

Query: 117 HRNFAHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAF 176
             N+  FI+F           L Y+   +L +W            S   F+ + T     
Sbjct: 163 AGNYLLFIQF-----------LVYMDCLLLIMW-----------ISMSPFIRVYTFRRDG 200

Query: 177 VLLTISLLLLRCA--KNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSL- 233
            L+ I +L + C+     +L     + S  +  +E     G ++ +  +   E +P  + 
Sbjct: 201 NLIAIYILSVWCSLFVTGLLTAHIYMISLNLTSLE-----GIILKKTPKKNAEPKPYYVC 255

Query: 234 -SNQDDDIRKLLSQNRLSLDEIVNFPYDLNPWANAVNSLGD-MYSWILPWGTAKGNGMIF 291
             N  D  R ++   +L+  + ++       WAN ++ LG+  Y W +P  T+KG     
Sbjct: 256 YKNPKDHCRYVI---KLTGPQFMSIWRKCTIWANWIDQLGERAYLWFVPIYTSKGKSRDI 312

Query: 292 EKNELSVYEPEIPIEDKLLSL 312
           E    +  E    I DK+L+L
Sbjct: 313 ES---AFDETGSRINDKILTL 330

>TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {ON}
           Anc_5.579 YDR459C
          Length = 365

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 41/80 (51%), Gaps = 3/80 (3%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFL-- 137
           C+ C++ K ERAHH      CV   DH C W    +G  N+  FI+F+ ++   + F+  
Sbjct: 127 CSACDSVKTERAHHSSDMEYCVPRFDHKCAWLGAVIGRDNYRFFIQFVMYMAILSLFVFV 186

Query: 138 -LTYLVKRILFLWNRRHMPN 156
            +   ++RI+   + +H  N
Sbjct: 187 PICAFIRRIIHDGDTQHSLN 206

>TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.579
           YDR459C
          Length = 386

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 45/90 (50%), Gaps = 1/90 (1%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLLT 139
           C++C + K ER HH  A   CV   DH+C W    +G  N+  F++F+ +     S +  
Sbjct: 123 CSECQSLKLERTHHSSAMGHCVPRFDHYCVWVGTVIGKDNYLLFLQFVAYYAINLSIIWV 182

Query: 140 YLVKRILFLWNRR-HMPNYFVHRSELIFLT 168
            +V  I  +  +R + P++  + + +I L 
Sbjct: 183 SIVSYIHMIIRKRPNQPHHHFNTNLIIILV 212

>Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa]
           {ON} complement(123368..124456) [1089 nt, 363 aa]
          Length = 362

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 52/108 (48%), Gaps = 8/108 (7%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLLT 139
           C+ C + K  R HH K    C+   DHHC W    +G  N+  F +F+F+    +  LL 
Sbjct: 124 CDTCKSLKIGRTHHSKRLGYCIPRFDHHCMWVGTVIGKSNYLLFTQFVFYF---SCLLLI 180

Query: 140 YLVKRILFLWNRRHMPN--YFVHRSELIFLTILTPMDAFVLLTISLLL 185
           + +  + ++      P+  Y +  + ++ L +  P   F ++T+SL L
Sbjct: 181 FWISIVSYIKRIVDYPHTGYKLDPNLIVILILSVP---FSIMTLSLFL 225

>KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 367

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 8/66 (12%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFW--------VI 131
           C  C + K  R HH      C+   DH+C W    VG +N+  F++F F+        ++
Sbjct: 132 CTACQSIKANRTHHSSTLGYCIPRFDHYCVWIGTVVGRKNYRLFVQFAFYFWAFAIFVIV 191

Query: 132 ETTSFL 137
            T SFL
Sbjct: 192 STASFL 197

>Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}
           similar to Ashbya gossypii ABR203W
          Length = 372

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 42/77 (54%), Gaps = 4/77 (5%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWV---IETTSF 136
           C+ C + K ER+HH +    CV   DH+C W    +G +N+  F++++ +    + T S 
Sbjct: 127 CSTCQSLKIERSHHSELLKYCVPRFDHYCVWLGTVIGRKNYKLFMQYVMYFTIYLVTASL 186

Query: 137 LLTYLVKRILFLWNRRH 153
            +   +KRI+  +N+ H
Sbjct: 187 TIALFMKRIV-DYNKEH 202

>NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {ON}
           Anc_5.579 YDR459C
          Length = 406

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFW 129
           C  C + K ER HH +    C+   DH+C W    +G  N+  FI+++F+
Sbjct: 117 CTYCQSLKLERVHHSRQLGYCIFRFDHYCAWIGTVIGRNNYRLFIQYVFY 166

>Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459C -
           Hypothetical ORF [contig 196] FULL
          Length = 356

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFW 129
           C  C + K  R HH      C+   DH+C W    VG +N+  F++F F+
Sbjct: 125 CTACQSLKSNRTHHSSTLGYCIPRFDHYCVWIGTIVGRKNYRLFVQFAFY 174

>Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {ON}
           YDR459C (REAL)
          Length = 378

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 52/106 (49%), Gaps = 5/106 (4%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLLT 139
           C+ C + K ER+HH      C+   DH+C W    +G  N+  F++F  +    +S LL 
Sbjct: 131 CSPCQSLKMERSHHSSELGHCIPRFDHYCVWIGTIIGRDNYRPFVQFTGYF---SSLLLI 187

Query: 140 YLVKRILFLWN-RRHMPNYFVHRSELIFLTILTPMDAFVLLTISLL 184
             V   +F+ N  +H  N+    +  +FLT+   +  + L T S+L
Sbjct: 188 MWVSICVFIRNITQHHHNHNSPLNANVFLTLAFAIFGW-LFTTSML 232

>TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626
           YOR034C
          Length = 759

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 69/151 (45%), Gaps = 18/151 (11%)

Query: 70  RPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFW 129
           +  K++  NFC +    KP R+ +    N  V   DH+CPW  N VG +N   F+ F+  
Sbjct: 454 KLGKYDTSNFCIETLTRKPLRSRYSYMNNALVSRFDHYCPWVYNDVGLKNHKTFLFFIL- 512

Query: 130 VIET-----TSFLLTYLVKRILFLWNRRHMPNYFVHRSELI-------FLTILTPMDAFV 177
            +ET     TS  L Y   ++  L++   +    +   EL        F  ++    AF 
Sbjct: 513 SMETGIGLFTSLCLEYF-DQLEDLYDDDKLKCLLLGDDELCAGFTHDRFSFLIMAWSAFQ 571

Query: 178 LLTISLLLLRCAKNQILKGMTQIESWEMDRI 208
            L +SLL+      Q+ KG+T   S+E ++I
Sbjct: 572 FLWVSLLIF-VQVFQVTKGVT---SYEFNKI 598

>KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa]
           {ON} Anc_5.626 YOR034C
          Length = 752

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 48/103 (46%), Gaps = 13/103 (12%)

Query: 41  LWFEFSLGMIWISYYLAIYTNPG--KPTPGF-----------RPSKFEWENFCNKCNNYK 87
           + F   LG + + ++  +Y++PG  +P   F           +  KF+ +NFC +    K
Sbjct: 408 ILFVAVLGCVHLLFFQLVYSDPGVLEPETDFNEIRNKISELLKIGKFDTKNFCIETWQRK 467

Query: 88  PERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWV 130
           P R       ++ VL  DH+CPW  N VG  N   F+ ++  V
Sbjct: 468 PLRCKFSSFHSRLVLRFDHYCPWVYNDVGLLNHKKFMYYVMSV 510

>Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {ON}
           YDR459C (REAL)
          Length = 380

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFL 127
           C+ C + K ER HH      CV   DH+C W    +G  N+  F++F+
Sbjct: 132 CSPCQSLKTERTHHSSELGHCVPRFDHYCMWAGTVIGRDNYRLFVQFV 179

>SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 364

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRF 126
           C+ C + K ER HH      CV   DH+C W    VG +N+  FI+F
Sbjct: 127 CSMCQSLKMERTHHSATLGYCVPRFDHYCVWIGTVVGRKNYRLFIQF 173

>Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 3/70 (4%)

Query: 73  KFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIE 132
           KF+ ++FC +    KP R+ +    N  V   DH+CPW  N VG +N   FI   F++  
Sbjct: 465 KFDTKSFCIETWTRKPLRSKYSSLNNAVVARFDHYCPWIFNDVGLKNHKAFI---FFITS 521

Query: 133 TTSFLLTYLV 142
             S + T+L 
Sbjct: 522 MESGIFTFLA 531

>NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.626
           YDR264C
          Length = 786

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 31/58 (53%)

Query: 73  KFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWV 130
           KF+ +NFC +    KP R+ +    N  V   DH CPW  N VG +N  +FI F+  V
Sbjct: 467 KFDSKNFCLESWTRKPLRSKYSHLNNALVARFDHFCPWIYNDVGLKNHKNFIGFILLV 524

>YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}
           PFA5Palmitoyltransferase with autoacylation activity;
           likely functions in pathway(s) outside Ras; member of a
           family of putative palmitoyltransferases containing an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain
          Length = 374

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 51/105 (48%), Gaps = 3/105 (2%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLLT 139
           C++C + K ER HH      C+   DH+C W    +G  N+  F++F  +   +T  L+ 
Sbjct: 131 CSECQSLKMERTHHSSELGHCIPRFDHYCMWIGTVIGRDNYRLFVQFAAYF--STLLLIM 188

Query: 140 YLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLTISLL 184
           ++   +      +H  NY  + +  I  T++  +  + LLT SLL
Sbjct: 189 WVSICVYIRIITQHNHNYSPNLNANIISTLVFAILGW-LLTASLL 232

>KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 734

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 34/80 (42%)

Query: 69  FRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLF 128
            R  KF+  +FC      KP R+   +     ++  DH CPW  N VG  N   FI FL 
Sbjct: 443 LRIGKFDTRHFCVDTYKRKPLRSKFSRFNEALIVRFDHFCPWIYNDVGLLNHKQFIYFLL 502

Query: 129 WVIETTSFLLTYLVKRILFL 148
            ++   S      ++   FL
Sbjct: 503 SLVSGVSCFFIACIEYFDFL 522

>ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 759

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 34/70 (48%), Gaps = 1/70 (1%)

Query: 72  SKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVI 131
            KF+ +NFC +    KP R+      N  V   DH+CPW  N +G RN   F+  +  ++
Sbjct: 456 GKFDSKNFCIETWVKKPLRSRFSSLSNSLVARFDHYCPWVYNDIGLRNHKAFLMCIL-LV 514

Query: 132 ETTSFLLTYL 141
           E    L  YL
Sbjct: 515 EILMLLFNYL 524

>Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 29/55 (52%)

Query: 73  KFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFL 127
           KF+ +NFC +    KP R+      N  V   DH+CPW  N VG +N   FI F+
Sbjct: 465 KFDTKNFCIETWTRKPLRSKFSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}
           YOR034C (REAL)
          Length = 730

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 70/163 (42%), Gaps = 21/163 (12%)

Query: 73  KFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIE 132
           K++  NFC +    KP R+ +       V   +H+CPW  N +G +N   F+ F F V +
Sbjct: 424 KYDRNNFCVETLERKPLRSKYSLFSGALVARFNHYCPWVYNDIGLKNHKLFMFFAFSV-Q 482

Query: 133 TTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILT--------PMDAFVLLTIS-- 182
              FL  +L   + +     H+       ++  FL   T        P   F+ + IS  
Sbjct: 483 YEMFLFMWLC--LEYFKKTNHIYEQVEEYAKCTFLKNETLCKGSNYDPSTFFLFIWISMN 540

Query: 183 ------LLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIP 219
                 +L+++C   QI KG+T  E + + + E    +  LIP
Sbjct: 541 FVWLGGMLIVQCF--QIFKGITSPELYALIKEERKAEALNLIP 581

>KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} similar
           to uniprot|Q03289 Saccharomyces cerevisiae YDR459C
           likely functions in pathway(s) outside Ras
          Length = 349

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWV 130
           C+ C + K  R HH      CV   DH+C W    +G  N+  F++F F++
Sbjct: 128 CSNCQSLKMSRTHHSTKVGYCVPRFDHYCVWIGTVLGRLNYKLFVQFTFYL 178

>Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}
           complement(77926..80259) [2334 nt, 778 aa]
          Length = 777

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%)

Query: 73  KFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVI 131
           KF+  NFC + +  KP R+ +    +  V   DH CPW  N +G +N   F+ F+  ++
Sbjct: 472 KFDTNNFCIESSVRKPLRSRYSYLNSAIVTRFDHFCPWIYNDIGLKNHKLFVLFIILMV 530

>TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {ON}
           Anc_5.626 YOR034C
          Length = 739

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 42/96 (43%), Gaps = 14/96 (14%)

Query: 47  LGMIWISYYLAIYTNPGKPTPG-------------FRPSKFEWENFCNKCNNYKPERAHH 93
           +G+I+  +Y  I +NPG+                     KF+  +FC +    KP R+  
Sbjct: 423 IGVIY-EFYKLIRSNPGRKNRNHDMESVRKTIQTLMELGKFDIRHFCLETWVRKPLRSKF 481

Query: 94  CKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFW 129
                  V   DH+CPW  N +G RN   FI F+F+
Sbjct: 482 SYLNQSVVNRYDHYCPWVYNDIGLRNHKRFIMFIFF 517

>YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}
           AKR1Palmitoyl transferase involved in protein
           palmitoylation; acts as a negative regulator of
           pheromone response pathway; required for endocytosis of
           pheromone receptors; involved in cell shape control;
           contains ankyrin repeats
          Length = 764

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 35/71 (49%), Gaps = 3/71 (4%)

Query: 72  SKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVI 131
            KF+ +NFC +    KP R+      N  V   DH+CPW  N VG +N   FI   F++ 
Sbjct: 464 GKFDTKNFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFI---FFIT 520

Query: 132 ETTSFLLTYLV 142
              S + T+L 
Sbjct: 521 LMESGIFTFLA 531

>Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON}
           YDR264C (REAL)
          Length = 763

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (52%)

Query: 73  KFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFL 127
           KF+ +NFC +    KP R+      N  V   DH+CPW  N VG +N   F+ F+
Sbjct: 464 KFDTKNFCIETWARKPLRSRFSSLNNAVVARFDHYCPWIFNDVGLKNHKGFMFFI 518

>Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {ON}
           YDR459C (REAL)
          Length = 388

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFW 129
           C+ C + K ER HH      CV   DH+C W    +G  N+  F++F+ +
Sbjct: 137 CSPCQSLKMERTHHSSELGHCVPRFDHYCLWVGTVIGRDNYRLFVQFVTY 186

>YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON}
           AKR2Ankyrin repeat-containing protein similar to Akr1p;
           member of a family of putative palmitoyltransferases
           containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD)
           domain; possibly involved in constitutive endocytosis of
           Ste3p
          Length = 749

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 29/58 (50%)

Query: 73  KFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWV 130
           KF+ ENFC +    KP R+ +       V   DH+CPW  N VG +N   F+ F   V
Sbjct: 441 KFDRENFCVETLERKPLRSKYSFFSGALVARYDHYCPWIYNDVGLKNHKLFVFFAVTV 498

>KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.626
           YOR034C
          Length = 757

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 29/58 (50%)

Query: 73  KFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWV 130
           KF+  NFC +    KP R+      N  V   DH+CPW  N +G +N   FI F+  V
Sbjct: 456 KFDTRNFCIETWIRKPLRSKFSTFYNSTVSRFDHYCPWVYNDIGLKNHKIFIFFIISV 513

>AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR264C
           (AKR1) and YOR034C (AKR2)
          Length = 724

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 30/58 (51%)

Query: 69  FRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRF 126
            R  K++ ++FC       P RA + +  +  +L  DH+CPW  N +G RN   FI F
Sbjct: 437 LRVGKYDSKHFCIHSWIRLPLRAKYKRFVHSVILRYDHYCPWIYNYIGFRNHKIFIYF 494

>Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {ON}
           YOR034C (REAL)
          Length = 741

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 78/185 (42%), Gaps = 24/185 (12%)

Query: 73  KFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIE 132
           KF+ ENFC +    K  R+ +       V   DH+CPW  N +G +N  H +  LF+ + 
Sbjct: 435 KFDKENFCVETLERKSLRSKYSVFSGALVARFDHYCPWIYNDIGLKN--HKLS-LFFAMT 491

Query: 133 TTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILT--------PMDAFVLLTISL- 183
               +  ++   + +     H+       ++  FL   T        P   F+ + IS+ 
Sbjct: 492 VQYHMFLFMWLSLAYFKKTNHIYEQVDEYAKCTFLKNETLCKGSNYDPSTFFLFIWISVN 551

Query: 184 -----LLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLEN-LKEIRPGSLSNQD 237
                 +L     QILKG+T  E + + + E    +  LIP   EN +  I+    + +D
Sbjct: 552 FVWLGAMLSVQFFQILKGITTPELFTLIKEERRAETFNLIP--FENPIYSIQ----NTKD 605

Query: 238 DDIRK 242
            DIR 
Sbjct: 606 SDIRS 610

>CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459c
          Length = 352

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 26/50 (52%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFW 129
           C+ C + K  R  H      CV   DH+C W    +G +N+  F++F+F+
Sbjct: 116 CSNCQSLKVGRTKHSSHQGHCVPRFDHYCVWLGAVIGFKNYRLFVQFVFY 165

>NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa]
           {ON} Anc_5.626
          Length = 757

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 29/57 (50%)

Query: 72  SKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLF 128
            KF+ +NFC +    KP R+H        V   DH CPW  N +G +N  +F+ F+ 
Sbjct: 449 GKFDIKNFCLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWFIL 505

>Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {ON}
           YOR034C (REAL)
          Length = 744

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 78/184 (42%), Gaps = 22/184 (11%)

Query: 73  KFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIE 132
           KF+ ENFC +    KP R+         V   DH CPW  N +G +N   F+ F    ++
Sbjct: 438 KFDRENFCVETLERKPLRSKFSPFSGALVARYDHFCPWVYNDIGLKNHKLFL-FFALTVQ 496

Query: 133 TTSFLLTYLV----KRILFLWNR--RHMPNYFVHRSELIFLTILTPMDAFVLLTIS---- 182
              FL  +L     KR   ++ +   +          L   +   P   F+ + +S    
Sbjct: 497 YHMFLFMWLCLAYFKRTNHIYEQVDGYARCALFKNETLCKGSNYDPSTFFLFIWVSVNFL 556

Query: 183 ----LLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQDD 238
               +L+++C   QILKG+T  E + + + E    S  LIP      ++      S++D+
Sbjct: 557 WLGAMLIVQCF--QILKGITVPELFILIKEERRAKSFSLIP-----FEKPIYSMASSEDN 609

Query: 239 DIRK 242
           D+R 
Sbjct: 610 DMRS 613

>CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264c
           ankyrin repeat-containing protein
          Length = 763

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 31/60 (51%)

Query: 69  FRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLF 128
            +  KF+  +FC +    KP R+ +    +  +L  DH+CPW  N VG +N   FI F+ 
Sbjct: 445 LKEGKFDTRSFCLETWVRKPLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFIL 504

>ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR459C
          Length = 359

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%)

Query: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFL 127
           C+ C + K  R HH      CV  +DH+C W    +G RN+  F +FL
Sbjct: 122 CSVCQSLKGLRTHHSVHLGFCVPRLDHYCVWLGTVIGRRNYRLFNQFL 169

>Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar to
           Ashbya gossypii AER388C
          Length = 739

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 3/62 (4%)

Query: 69  FRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVG---HRNFAHFIR 125
            R  KF+ ++FC       P R+ +  A N  +   DH+CPW  N +G   H+ F  FI 
Sbjct: 445 LRIGKFDAKHFCIHSWVRIPLRSKYKTARNVLIARYDHYCPWVYNQIGFCNHKIFLFFIM 504

Query: 126 FL 127
           FL
Sbjct: 505 FL 506

>KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.626
           YOR034C
          Length = 682

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 62/143 (43%), Gaps = 18/143 (12%)

Query: 70  RPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFW 129
           +   F    FC K    KP R    K   Q V   DH+C W  N VG +N   +I   F+
Sbjct: 395 KLGSFNCHTFCLKTWIRKPVRCSLSKLNQQQVARFDHYCAWIYNDVGLKNHKLYI---FF 451

Query: 130 VIETTSFLLTY---------LVKRI--LFLWNRRHMPNYFVHRSELIFLTILTPMDAFVL 178
           +I   +FL+T+         L+++    FL+NR  + + + +   +    + T   A  +
Sbjct: 452 LILLETFLMTFGVLNWRYFGLMEKTAECFLFNRTIICHGYKNLKVVFLFLVWTIFQAIFV 511

Query: 179 LTISLLLLRCAKNQILKGMTQIE 201
             + +L LR    +I  G+T  E
Sbjct: 512 GNLLMLQLR----KIAYGITTFE 530

>SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {ON}
           uniprot|Q875S9 Saccharomyces kluyveri AKR1
           Palmitoyltransferase AKR1
          Length = 737

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 32/69 (46%), Gaps = 1/69 (1%)

Query: 73  KFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIE 132
           KF+ ++FC      KP R+         V   DH CPW  N +G RN   F+ F+   +E
Sbjct: 445 KFDAKHFCISTWVRKPIRSKFSNFSRALVTRFDHFCPWIYNDIGLRNHKTFLFFIL-CLE 503

Query: 133 TTSFLLTYL 141
           T  F+   L
Sbjct: 504 TCIFVFLKL 512

>TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {ON}
           Anc_5.626 YOR034C
          Length = 750

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 35/73 (47%), Gaps = 1/73 (1%)

Query: 69  FRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLF 128
            +  K++  +FC +    KP R+         +   DH+CPW  N VG +N   F+ F+ 
Sbjct: 451 LKVGKYDTRHFCIESWIRKPLRSRFSSLNGTLIARFDHYCPWIYNDVGLKNHKRFLYFV- 509

Query: 129 WVIETTSFLLTYL 141
            +IE   ++  +L
Sbjct: 510 ALIEVAVWIFAHL 522

>KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264C AKR1
           Palmitoyl transferase involved in protein palmitoylation
          Length = 752

 Score = 34.7 bits (78), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 67/153 (43%), Gaps = 23/153 (15%)

Query: 73  KFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIE 132
           KF+ ++FC       P R+ + +     + + DH CPW  N +G  N  H + ++F V+ 
Sbjct: 461 KFDAKHFCVHTWIRIPLRSKYDRDSACLISAFDHFCPWVYNQIGLLN--HKLFYMFVVLL 518

Query: 133 TTS------FLLTYLVKRILFLWNR--RHMPN-YFVHRSELIFLTILTPMDAFVLLTIS- 182
             S       ++ Y  +   +L NR  +H  + +F+   +L F       D F  L +  
Sbjct: 519 EISVWWFLPLMMEYFDELEDYLENRKGKHFGDCHFLGDEDLCF---GLHHDTFNFLLLCW 575

Query: 183 --------LLLLRCAKNQILKGMTQIESWEMDR 207
                   L L+     Q+LKG+T  E  ++++
Sbjct: 576 VIFQAFWVLCLIAVQTVQMLKGVTDYEFVQINK 608

>NCAS0E03360 Chr5 (668230..670635) [2406 bp, 801 aa] {ON} Anc_7.258
           YIL068C
          Length = 801

 Score = 33.9 bits (76), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 22/102 (21%), Positives = 51/102 (50%), Gaps = 2/102 (1%)

Query: 181 ISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQDDDI 240
           ISL  +R  K Q++K  + +E +++++  + + S       L NL +    S+  + DD+
Sbjct: 15  ISLEKIRDIKQQLMKQKSTVE-YQLNKESDKYFSSIQESLQLLNLSQKSVTSIREKLDDV 73

Query: 241 RKLLSQNRLSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWG 282
            KL  +++ S+D   +  +D     + +N+   +Y  ++ + 
Sbjct: 74  NKLSEESKSSIDR-YDVIFDATKLYDTINTTSAIYDKVVNFN 114

>KAFR0C05960 Chr3 complement(1187537..1189720) [2184 bp, 727 aa]
           {ON} Anc_5.626 YOR034C
          Length = 727

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 38/92 (41%), Gaps = 15/92 (16%)

Query: 47  LGMIWISYYLA-IYT-NPGKPTPGFRPSK-------------FEWENFCNKCNNYKPERA 91
           LG ++++Y L  +YT +PG   P F   K             F+   FC      +P ++
Sbjct: 387 LGTLFVTYLLHYVYTSDPGNIPPEFSHDKIRQDMEDLLSLNNFDVSGFCLTTWVRRPFKS 446

Query: 92  HHCKACNQCVLSMDHHCPWTMNCVGHRNFAHF 123
           H      + V   DH+C W  N +  +N   F
Sbjct: 447 HISPLQKKRVAGFDHYCMWLYNDIALKNRKAF 478

>KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1442

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 13/21 (61%)

Query: 8    PWLGIAIPLFLISFIGYCAHY 28
            PW  IA+P  LI F+  C HY
Sbjct: 998  PWFAIAVPFLLIIFVLICDHY 1018

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.141    0.474 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,312,390
Number of extensions: 2035856
Number of successful extensions: 6627
Number of sequences better than 10.0: 134
Number of HSP's gapped: 6662
Number of HSP's successfully gapped: 134
Length of query: 379
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 268
Effective length of database: 40,753,473
Effective search space: 10921930764
Effective search space used: 10921930764
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 66 (30.0 bits)