Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E01474g6.27ON31131116450.0
NCAS0H015106.27ON31329711101e-153
KNAG0M012406.27ON31431011061e-152
ZYRO0C07612g6.27ON31929210761e-147
Kwal_56.224546.27ON31530610731e-147
YOL002C (IZH2)6.27ON31728110611e-145
CAGL0E02519g6.27ON31530410591e-145
TDEL0G044206.27ON32230310591e-145
NDAI0F017406.27ON31331210561e-144
KLTH0C11044g6.27ON31530310511e-144
Smik_15.1686.27ON32728110501e-143
Skud_15.1606.27ON32727910441e-142
KAFR0G026506.27ON32130510371e-141
Kpol_1032.96.27ON31828110011e-136
Suva_15.1736.27ON3272819991e-136
TPHA0M002906.27ON3272709881e-134
KLLA0D01331g6.27ON3083069821e-133
Ecym_30316.27ON3282959801e-133
TBLA0E030606.27ON3193179771e-132
ACL002C6.27ON3292769461e-127
TPHA0A006403.90ON3273097661e-100
SAKL0C09218g3.90ON3143017504e-98
KLTH0C09504g3.90ON3193067331e-95
AFR337W3.90ON3172897322e-95
ZYRO0B06556g3.90ON3183107289e-95
Suva_2.6683.90ON3153167262e-94
TDEL0D053403.90ON3162987252e-94
Skud_4.7663.90ON3163157173e-93
YDR492W (IZH1)3.90ON3163167165e-93
Kpol_1053.263.90ON3242787167e-93
Smik_4.7693.90ON3163157113e-92
Ecym_35883.90ON3052707077e-92
NDAI0A071603.90ON3302917081e-91
Kwal_56.227043.90ON3203056974e-90
CAGL0G04631g3.90ON3162816896e-89
KAFR0A081303.90ON3193076757e-87
NCAS0I025703.90ON3143116687e-86
KLLA0C12441g3.90ON3152976541e-83
TBLA0B022903.90ON3262766505e-83
KNAG0K021603.90ON3232896002e-75
TBLA0B082553.90ON2962904163e-48
NCAS0C049203.90ON3262833783e-42
NDAI0G043003.90ON3182843391e-36
CAGL0I07491g3.90ON3012962742e-27
Skud_15.533.90ON3123162303e-21
Suva_15.643.90ON3123162201e-19
Smik_15.563.90ON3123162191e-19
YOL101C (IZH4)3.90ON3122421971e-16
TPHA0E031205.197ON5692921762e-13
KAFR0J006705.197ON5092321701e-12
KLLA0F15510g5.197ON6222921701e-12
Kpol_2002.945.197ON5772341691e-12
SAKL0G12980g5.197ON5632541673e-12
NCAS0D026005.197ON5432331654e-12
AAL153C5.197ON4193251565e-11
KNAG0B051005.197ON5383261512e-10
NDAI0I023305.197ON5782331504e-10
TDEL0E043205.197ON4502361461e-09
YLR023C (IZH3)5.197ON5432351461e-09
Skud_12.915.197ON5422351415e-09
TBLA0C060505.197ON4373281415e-09
Ecym_71095.197ON5682501407e-09
Smik_12.865.197ON5422351381e-08
KLTH0B03498g5.197ON5462431336e-08
Kwal_33.151225.197ON5662431326e-08
ZYRO0B10538g5.197ON5312321318e-08
Suva_10.1045.197ON5412331301e-07
CAGL0D03322g5.197ON5452421239e-07
KNAG0K006703.90ON321103770.31
SAKL0C01210g1.35ON50681750.60
KAFR0A006202.454ON66468740.98
KNAG0I009908.303ON153562721.6
Smik_5.345.521ON73255676.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E01474g
         (311 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar...   638   0.0  
NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON...   432   e-153
KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.2...   430   e-152
ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {O...   419   e-147
Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C...   417   e-147
YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}  ...   413   e-145
CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {O...   412   e-145
TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON...   412   e-145
NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27      411   e-144
KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {O...   409   e-144
Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {O...   409   e-143
Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {O...   406   e-142
KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON...   404   e-141
Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON} (22700..2...   390   e-136
Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {O...   389   e-136
TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27 ...   385   e-134
KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar...   382   e-133
Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to A...   382   e-133
TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27...   380   e-132
ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON} Sy...   369   e-127
TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON...   299   e-100
SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar...   293   4e-98
KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {O...   286   1e-95
AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic h...   286   2e-95
ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar...   285   9e-95
Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W...   284   2e-94
TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90...   283   2e-94
Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W...   280   3e-93
YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membr...   280   5e-93
Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON...   280   7e-93
Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W...   278   3e-92
Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar ...   276   7e-92
NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {...   277   1e-91
Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W...   273   4e-90
CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar...   270   6e-89
KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3....   264   7e-87
NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON...   261   7e-86
KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa] ...   256   1e-83
TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON...   254   5e-83
KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.9...   235   2e-75
TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}             164   3e-48
NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {...   150   3e-42
NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90    135   1e-36
CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {O...   110   2e-27
Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON} ...    93   3e-21
Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON...    89   1e-19
Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON} ...    89   1e-19
YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}  ...    80   1e-16
TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {O...    72   2e-13
KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5....    70   1e-12
KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some...    70   1e-12
Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON} (2295...    70   1e-12
SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]...    69   3e-12
NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.1...    68   4e-12
AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON} Syn...    65   5e-11
KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.1...    63   2e-10
NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197     62   4e-10
TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {O...    61   1e-09
YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON} ...    61   1e-09
Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {O...    59   5e-09
TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON} Anc_5...    59   5e-09
Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}...    59   7e-09
Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {O...    58   1e-08
KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {...    56   6e-08
Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023...    55   6e-08
ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {...    55   8e-08
Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {...    55   1e-07
CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {...    52   9e-07
KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {O...    34   0.31 
SAKL0C01210g Chr3 complement(107136..108656) [1521 bp, 506 aa] {...    33   0.60 
KAFR0A00620 Chr1 complement(112316..114310) [1995 bp, 664 aa] {O...    33   0.98 
KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8....    32   1.6  
Smik_5.34 Chr5 complement(56141..58339) [2199 bp, 732 aa] {ON} Y...    30   6.1  

>SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 311

 Score =  638 bits (1645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/311 (100%), Positives = 311/311 (100%)

Query: 1   MEPEPNRRRLQIKRANIVKEETMSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHGYVRET 60
           MEPEPNRRRLQIKRANIVKEETMSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHGYVRET
Sbjct: 1   MEPEPNRRRLQIKRANIVKEETMSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHGYVRET 60

Query: 61  NSFLGCFDSLFYMHNESVNIYTHLLPGLCFFFVVLFDKVAIKVFDTTTFLDYIMVDLFFL 120
           NSFLGCFDSLFYMHNESVNIYTHLLPGLCFFFVVLFDKVAIKVFDTTTFLDYIMVDLFFL
Sbjct: 61  NSFLGCFDSLFYMHNESVNIYTHLLPGLCFFFVVLFDKVAIKVFDTTTFLDYIMVDLFFL 120

Query: 121 GAFTCLILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGF 180
           GAFTCLILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGF
Sbjct: 121 GAFTCLILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGF 180

Query: 181 STLTLVFGIACAIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKV 240
           STLTLVFGIACAIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKV
Sbjct: 181 STLTLVFGIACAIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKV 240

Query: 241 QVKWVLLGGVFYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNS 300
           QVKWVLLGGVFYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNS
Sbjct: 241 QVKWVLLGGVFYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNS 300

Query: 301 YELVHKKLASI 311
           YELVHKKLASI
Sbjct: 301 YELVHKKLASI 311

>NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON}
           Anc_6.27
          Length = 313

 Score =  432 bits (1110), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 205/297 (69%), Positives = 240/297 (80%), Gaps = 5/297 (1%)

Query: 12  IKRANIVKEETMSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLGCFDSLF 71
           I   N+  + T  T TI     R+LY+W+EIP+WQKDNEHI  GYVRETNSF  CFDSLF
Sbjct: 22  IDDDNVSIKHTKKTTTI-----RKLYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLF 76

Query: 72  YMHNESVNIYTHLLPGLCFFFVVLFDKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSST 131
           Y+HNE+ N+Y+HL+PG+ FF  +LFDK AI  F+TTTF DY++++LFFLGAFTCLILSST
Sbjct: 77  YIHNETGNVYSHLVPGVVFFLTMLFDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSST 136

Query: 132 FHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIAC 191
           FHC K+HSL+IA  GNKLDYLGIV LIV+SMISI++YGF+D+G FFYGFS LTL FG AC
Sbjct: 137 FHCFKSHSLKIATFGNKLDYLGIVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSAC 196

Query: 192 AIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKVQVKWVLLGGVF 251
           AI SL D FRSREWRPYRA LFVAFGLSAVLPI +GV  YG  ETW ++Q+KWV+L GVF
Sbjct: 197 AIVSLKDKFRSREWRPYRAGLFVAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVF 256

Query: 252 YIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNSYELVHKKL 308
           YI GA LY +R PE+   G FDIWGHSHQIFH+LVV+AA CHLKA+L SYELVH  L
Sbjct: 257 YIFGAFLYGIRFPEKYVNGTFDIWGHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313

>KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.27
           YOL002C
          Length = 314

 Score =  430 bits (1106), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 196/310 (63%), Positives = 244/310 (78%)

Query: 1   MEPEPNRRRLQIKRANIVKEETMSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHGYVRET 60
           M     R+ + I    + +++     T  KK  +R+Y+W EIP+WQKDNEHI  GYVRET
Sbjct: 1   MSSRVQRQTVTITEPVVYEDDGGEMKTATKKITKRIYTWNEIPEWQKDNEHIIDGYVRET 60

Query: 61  NSFLGCFDSLFYMHNESVNIYTHLLPGLCFFFVVLFDKVAIKVFDTTTFLDYIMVDLFFL 120
           NSFL C  SLFY+HNESVN+Y+HL+P LCFF V+  +K  +K F+TT+ +DY+ +DLFFL
Sbjct: 61  NSFLKCVHSLFYLHNESVNVYSHLIPALCFFSVLFLNKYCVKSFETTSLVDYLFIDLFFL 120

Query: 121 GAFTCLILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGF 180
           GAFTCLILSSTFHC K+HSL++A  GNKLDYLGIV LIV+SMISI+YYGF+DS   FY F
Sbjct: 121 GAFTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFF 180

Query: 181 STLTLVFGIACAIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKV 240
           S +TL FG AC + SL D FRSREWRPYRA LFVAFGLSA+LPI SG+  YG +E + ++
Sbjct: 181 SFVTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHRI 240

Query: 241 QVKWVLLGGVFYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNS 300
           Q+KW++L GVFYI+GA LY +R PE+ SPGK+DIWGHSHQ+FHILVV+AALCHLK ++ S
Sbjct: 241 QIKWIILEGVFYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVS 300

Query: 301 YELVHKKLAS 310
           YELVHK L+S
Sbjct: 301 YELVHKGLSS 310

>ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  419 bits (1076), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 191/292 (65%), Positives = 230/292 (78%), Gaps = 1/292 (0%)

Query: 19  KEETMSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLGCFDSLFYMHNESV 78
           ++ T+    +N ++ + LY+W EIPDWQKDNEHI  GYVRETNS   C  SL Y+HNES+
Sbjct: 26  EQTTIKIEPVNTQK-KLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNESI 84

Query: 79  NIYTHLLPGLCFFFVVLFDKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFHCLKTH 138
           NIYTH LPGLCF    +FDK AIK FDTTT++DY+ +D FF GAF+CLILSSTFHC K+H
Sbjct: 85  NIYTHFLPGLCFLATCIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSH 144

Query: 139 SLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSD 198
           S R+++ GNKLDYLGIV LIV SMISI+YY F DS K FY F+ +   FG++C IAS  D
Sbjct: 145 SSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDD 204

Query: 199 TFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKVQVKWVLLGGVFYIIGALL 258
           TFRSREWRPYRA LFVAFGLSA+LPI  G+  YGF ETW ++Q+KWV+L G+FYI GA L
Sbjct: 205 TFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAFL 264

Query: 259 YALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNSYELVHKKLAS 310
           Y++R PER++PG FD  GHSHQIFH+LVVIAALCHL A++NSYELVH  L S
Sbjct: 265 YSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNLLS 316

>Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C -
           Hypothetical ORF [contig 185] FULL
          Length = 315

 Score =  417 bits (1073), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 187/306 (61%), Positives = 245/306 (80%), Gaps = 3/306 (0%)

Query: 6   NRRRLQIKRANIVKEET---MSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNS 62
            R+ + I+   ++ EET   ++   I ++  RRLY W+EIP+WQKDNEHI +GY+ ET S
Sbjct: 8   KRKAVGIEPEGVMTEETTTLLNGSRIEERTRRRLYKWDEIPEWQKDNEHILNGYILETKS 67

Query: 63  FLGCFDSLFYMHNESVNIYTHLLPGLCFFFVVLFDKVAIKVFDTTTFLDYIMVDLFFLGA 122
              C  SL Y+HNESVNIYTHL+PG CF  + LF+++AI+ ++TT  +DYIM+DLFFLG 
Sbjct: 68  VGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIMIDLFFLGG 127

Query: 123 FTCLILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFST 182
           FTCL++SSTFHC K HSL +A+LGNKLDYLGIVAL+V+SM+SI++YGF D+  +FY FS 
Sbjct: 128 FTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSG 187

Query: 183 LTLVFGIACAIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKVQV 242
           LT++FG+AC I SLSD FRSR+WRPYRAALFVAFGLSA+ P+ +G+  YGFK TW ++Q+
Sbjct: 188 LTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQL 247

Query: 243 KWVLLGGVFYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNSYE 302
           KWV L GVFYI+GALLY +R PER++PG FDIWG SHQ+FH+LVVIAA CHL+A+L +Y+
Sbjct: 248 KWVFLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYK 307

Query: 303 LVHKKL 308
            VH ++
Sbjct: 308 WVHSQM 313

>YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}
           IZH2Plasma membrane protein involved in zinc homeostasis
           and osmotin-induced apoptosis; transcription regulated
           by Zap1p, zinc and fatty acid levels; similar to
           mammalian adiponectins; deletion increases sensitivity
           to elevated zinc
          Length = 317

 Score =  413 bits (1061), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 190/281 (67%), Positives = 234/281 (83%)

Query: 30  KKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLGCFDSLFYMHNESVNIYTHLLPGLC 89
           KK +RRLYSW+EIP+WQ+DN+ I HGYV+ET+SF+  F SLFY+HNESVNIY+HL+P L 
Sbjct: 33  KKVLRRLYSWDEIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHNESVNIYSHLIPALG 92

Query: 90  FFFVVLFDKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFHCLKTHSLRIAILGNKL 149
           FF V+L DK  IKVF TTT+LD++++DLF+ GAF CLILSS+FHCLK+HSLRIA LGNKL
Sbjct: 93  FFTVLLLDKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKL 152

Query: 150 DYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYR 209
           DYLGI  LIV+SM+SI+YYG+F+    F  F+ +T+ FGIAC+I SL D FR REWRPYR
Sbjct: 153 DYLGICILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWRPYR 212

Query: 210 AALFVAFGLSAVLPIFSGVAVYGFKETWVKVQVKWVLLGGVFYIIGALLYALRLPERISP 269
           A LFV FGLS+++PIFSG+  Y F E W ++Q+ WVLLGGV YIIGA+LY +R PE+I P
Sbjct: 213 AGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICP 272

Query: 270 GKFDIWGHSHQIFHILVVIAALCHLKAVLNSYELVHKKLAS 310
           GKFDIWGHSHQ+FH LVVIAALCHL+ +LNSYELVH K+ +
Sbjct: 273 GKFDIWGHSHQLFHFLVVIAALCHLRGLLNSYELVHIKMEN 313

>CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002c
          Length = 315

 Score =  412 bits (1059), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 193/304 (63%), Positives = 240/304 (78%), Gaps = 7/304 (2%)

Query: 11  QIKRANIVKEETM----STGTINKKR---VRRLYSWEEIPDWQKDNEHIRHGYVRETNSF 63
           Q K A +V  E      + G I  ++   VR+LY+WEEIP+WQKDNEHI  GYVRET+S 
Sbjct: 6   QRKVATMVTTEEQPLIGTDGQIKLRKKTVVRKLYTWEEIPEWQKDNEHIHTGYVRETSSV 65

Query: 64  LGCFDSLFYMHNESVNIYTHLLPGLCFFFVVLFDKVAIKVFDTTTFLDYIMVDLFFLGAF 123
           + C  SLFY+HNE+VNIY+HL+P + FF  + F+K  +  + TTT +DY+++D+FFLGAF
Sbjct: 66  MECIRSLFYLHNETVNIYSHLIPAIAFFSTIFFNKYVVPTYSTTTLIDYLIIDIFFLGAF 125

Query: 124 TCLILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTL 183
           +CLILSSTFHCLK+HSLR+A+ GNKLDYLGIV LIV+SM+SI+YYGF  +  FF  FS +
Sbjct: 126 SCLILSSTFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLI 185

Query: 184 TLVFGIACAIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKVQVK 243
           T+ FG ACA+ SL DTFRSREWRPYRAALFV FGLSAVLPI +G+  YG  ETW ++Q+K
Sbjct: 186 TMTFGAACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTRIQLK 245

Query: 244 WVLLGGVFYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNSYEL 303
           WV+L GVFYI GA LY +R PE++SPG FD+WGHSHQIFHILVV+AALCHLKA+L SY L
Sbjct: 246 WVILEGVFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLGSYSL 305

Query: 304 VHKK 307
           VH +
Sbjct: 306 VHYR 309

>TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON}
           Anc_6.27 YOL002C
          Length = 322

 Score =  412 bits (1059), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 190/303 (62%), Positives = 238/303 (78%), Gaps = 7/303 (2%)

Query: 13  KRANIVKEET------MSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLGC 66
           + + + KEET        T  ++KK+ R+LY+W+EIP WQ+DNEHI  GYV ET S   C
Sbjct: 17  QTSTVTKEETSGPVKGQKTDKMSKKK-RKLYTWDEIPHWQRDNEHILSGYVGETRSMFQC 75

Query: 67  FDSLFYMHNESVNIYTHLLPGLCFFFVVLFDKVAIKVFDTTTFLDYIMVDLFFLGAFTCL 126
           F SLFY+HNESVNIYTHLLPG+ F FV+ FDK A+  F+TTT +DY+M+DLF L +FTCL
Sbjct: 76  FLSLFYLHNESVNIYTHLLPGIAFLFVLCFDKFAVTQFETTTLIDYVMIDLFSLVSFTCL 135

Query: 127 ILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLV 186
            LSS FHCLK HS  +A  GNKLDYLGIV L+V+SM+SIMYYGFF++   FY FS +T  
Sbjct: 136 TLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFETPALFYLFSFITCT 195

Query: 187 FGIACAIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKVQVKWVL 246
           FG ACA+ SL + FR+REWRPYRAA+FVAFGLSAVLPI +G+  YGF E ++++QVKWVL
Sbjct: 196 FGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYGFSEIYLRIQVKWVL 255

Query: 247 LGGVFYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNSYELVHK 306
           LGG+FYI GA+LY +R PE+ +PGK+DIWGHSHQ+FH+LVV+AALCHL  ++ SY LVH 
Sbjct: 256 LGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHVLVVVAALCHLYGLIKSYNLVHL 315

Query: 307 KLA 309
           K+A
Sbjct: 316 KMA 318

>NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27
          Length = 313

 Score =  411 bits (1056), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 190/312 (60%), Positives = 240/312 (76%), Gaps = 6/312 (1%)

Query: 3   PEPNRRRLQIKRANIVK------EETMSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHGY 56
           P+  ++R       +V+      +   S   + +K V +LY W+EIP+WQKDNEHI  GY
Sbjct: 2   PKTIQKRGNTSTTTVVEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGY 61

Query: 57  VRETNSFLGCFDSLFYMHNESVNIYTHLLPGLCFFFVVLFDKVAIKVFDTTTFLDYIMVD 116
           VRETNSF GC  SLFY+HNES N+Y+HLLPG+ FFF ++ +K  I ++ TT+ +DY+M+D
Sbjct: 62  VRETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMID 121

Query: 117 LFFLGAFTCLILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKF 176
           LFF GAF CLILSS FHC K+HSL++A LGNKLDYLGIV LIV+SMISIMY+GFFD+  F
Sbjct: 122 LFFFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPLF 181

Query: 177 FYGFSTLTLVFGIACAIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKET 236
           FY FS+LT +FG ACA  SL D FRSREWRPYRA LFVAFGLSA+LPI +G   YG +ET
Sbjct: 182 FYFFSSLTFLFGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEET 241

Query: 237 WVKVQVKWVLLGGVFYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKA 296
           ++++Q+KW++L G FYI GA LY +R PE+  PG FDIWGHSHQIFHILVV+AA CHL+ 
Sbjct: 242 FIRIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRG 301

Query: 297 VLNSYELVHKKL 308
           +L+SYE+VH +L
Sbjct: 302 LLSSYEIVHSRL 313

>KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  409 bits (1051), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 185/303 (61%), Positives = 242/303 (79%), Gaps = 3/303 (0%)

Query: 6   NRRRLQIKRANIVKEETMS---TGTINKKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNS 62
            R+ ++++  + + EE  S      + ++  RRLY+W+EIP+WQ+DNEHI  GY+ ET S
Sbjct: 8   QRKPVEVELHHRMVEENSSLLKDSNLKQRTKRRLYTWDEIPEWQRDNEHIVGGYILETKS 67

Query: 63  FLGCFDSLFYMHNESVNIYTHLLPGLCFFFVVLFDKVAIKVFDTTTFLDYIMVDLFFLGA 122
              C  SL Y+HNESVNIYTHLLPG CF  V +F++V I+ F+TT  +DY+M+DLFFLG 
Sbjct: 68  TWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMIDLFFLGG 127

Query: 123 FTCLILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFST 182
           FTCL++SS FHC K HSL +AILGNKLDYLGIVAL+V+S++SI++YGF D   +F+ FS 
Sbjct: 128 FTCLMMSSVFHCFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSG 187

Query: 183 LTLVFGIACAIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKVQV 242
           LT+ FG+ACA  SLS+ FRSREWRPYRA+LFVAFGLSA+LP+ +G   YG KETW ++Q+
Sbjct: 188 LTMAFGLACATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQL 247

Query: 243 KWVLLGGVFYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNSYE 302
           +WVLLGGVFYI+GA+LY +R PER++PG FDIWGHSHQ+FHILVV+AALCHL+A+L +Y+
Sbjct: 248 EWVLLGGVFYILGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGAYK 307

Query: 303 LVH 305
           L H
Sbjct: 308 LFH 310

>Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  409 bits (1050), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 185/281 (65%), Positives = 234/281 (83%)

Query: 30  KKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLGCFDSLFYMHNESVNIYTHLLPGLC 89
           KK ++RLYSW+EIP+WQ+DN+ I HGYVRET+SF+  F SLFY+HNESVNIY+HL+P L 
Sbjct: 43  KKVLKRLYSWDEIPEWQRDNDFILHGYVRETSSFIETFKSLFYLHNESVNIYSHLVPALG 102

Query: 90  FFFVVLFDKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFHCLKTHSLRIAILGNKL 149
           FF V+L DK  IKVF+TTT+ D++++DLF+ GAF CLILSS+FHCLK+HSLRIA LGNKL
Sbjct: 103 FFTVLLLDKSTIKVFETTTWKDHVVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKL 162

Query: 150 DYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYR 209
           DYLGI  LIV+SM+SI++YG+++    F  F+ +T+ FG+AC+I SL D FR REWRPYR
Sbjct: 163 DYLGICILIVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYR 222

Query: 210 AALFVAFGLSAVLPIFSGVAVYGFKETWVKVQVKWVLLGGVFYIIGALLYALRLPERISP 269
           A LFV FGLS+++PIFSG+  Y F E W ++Q+ WVLLGGV YIIGA+LY +R PE++ P
Sbjct: 223 AGLFVCFGLSSIVPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCP 282

Query: 270 GKFDIWGHSHQIFHILVVIAALCHLKAVLNSYELVHKKLAS 310
           GKFDIWGHSHQ+FH LVVIA+LCHL+ +LNSYELVH K+ S
Sbjct: 283 GKFDIWGHSHQLFHFLVVIASLCHLRGLLNSYELVHIKMES 323

>Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  406 bits (1044), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 185/279 (66%), Positives = 231/279 (82%)

Query: 30  KKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLGCFDSLFYMHNESVNIYTHLLPGLC 89
           KK ++RLYSW+EIP+WQ+DN++I HGYVRET SF+  F SLFYMHNESVNIY+HL+P L 
Sbjct: 43  KKVLKRLYSWDEIPEWQRDNDYILHGYVRETCSFVETFKSLFYMHNESVNIYSHLIPALG 102

Query: 90  FFFVVLFDKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFHCLKTHSLRIAILGNKL 149
           FF V+L DK  IKVF+TTT+ D++++DLF+ GAF CLILSS+FHCLK+HSLRIA LGNKL
Sbjct: 103 FFTVLLLDKSTIKVFETTTWKDHMIIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKL 162

Query: 150 DYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYR 209
           DYLGI  LIV+SM SI+YYG+++    F  F+ +T+ FGIAC+I +L D FR REWRPYR
Sbjct: 163 DYLGICILIVTSMTSILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYR 222

Query: 210 AALFVAFGLSAVLPIFSGVAVYGFKETWVKVQVKWVLLGGVFYIIGALLYALRLPERISP 269
           A LFV FGLS+++PIFSG+  Y F E W ++Q+ WVLLGGV YIIGA+LY +R PE++ P
Sbjct: 223 AGLFVCFGLSSIVPIFSGLYCYTFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCP 282

Query: 270 GKFDIWGHSHQIFHILVVIAALCHLKAVLNSYELVHKKL 308
           GKFDIWGHSHQ+FH LVVIA+ CHL+ +LNSYELVH K+
Sbjct: 283 GKFDIWGHSHQLFHFLVVIASFCHLRGLLNSYELVHLKM 321

>KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON}
           Anc_6.27 YOL002C
          Length = 321

 Score =  404 bits (1037), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 189/305 (61%), Positives = 232/305 (76%), Gaps = 1/305 (0%)

Query: 2   EPEPNRRRLQIKRA-NIVKEETMSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHGYVRET 60
            P+ + R++ I  A   V E+       + +++ +LY+W EIPDWQKDNEHI  GYV+ET
Sbjct: 5   RPKRSTRKVTIDTAFQDVVEQNKGETIRSLEKIIQLYNWNEIPDWQKDNEHIISGYVKET 64

Query: 61  NSFLGCFDSLFYMHNESVNIYTHLLPGLCFFFVVLFDKVAIKVFDTTTFLDYIMVDLFFL 120
           NSF  C +SLFY+HNESVN+Y+HL+P +CF    L +K  +  F TTT LDY+ +DLFFL
Sbjct: 65  NSFFSCIESLFYLHNESVNVYSHLIPAVCFLMTSLLNKTIVPKFRTTTVLDYLYIDLFFL 124

Query: 121 GAFTCLILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGF 180
           GAFTCLILSSTFHC K+HSLRIA  GNKLDYLGIV LI +SMIS++YYGF+D+   FY F
Sbjct: 125 GAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLFYVF 184

Query: 181 STLTLVFGIACAIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKV 240
           + +TL FG+ACA  SL D FRSRE R YRA LFV FGLSAVLP+  G+  YGF  TW ++
Sbjct: 185 AFITLSFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNTWHRI 244

Query: 241 QVKWVLLGGVFYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNS 300
           Q+KWVLL GVFYI GA LY +R PE+ +PGK+DIWGHSHQ+FHILVVIAALCH KA++ S
Sbjct: 245 QLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKALMCS 304

Query: 301 YELVH 305
           YE VH
Sbjct: 305 YEHVH 309

>Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON}
           (22700..23656) [957 nt, 319 aa]
          Length = 318

 Score =  390 bits (1001), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 174/281 (61%), Positives = 223/281 (79%)

Query: 31  KRVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLGCFDSLFYMHNESVNIYTHLLPGLCF 90
           KR  +L +WE +PDWQKDNEHI  GYV+ETNS   C  SL ++HNESVNI++HL+P  CF
Sbjct: 36  KRGVQLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCF 95

Query: 91  FFVVLFDKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFHCLKTHSLRIAILGNKLD 150
              ++FDK  ++ + TTT  DY+M+DLF  GAFTCL++SS FHCLK HS  ++  GNKLD
Sbjct: 96  MTTIIFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLD 155

Query: 151 YLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYRA 210
           YLGIV LIVSSM SI+YYGF+D+   ++ FS +T  FG++CA+ SL + FR+REWRPYRA
Sbjct: 156 YLGIVVLIVSSMSSILYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRA 215

Query: 211 ALFVAFGLSAVLPIFSGVAVYGFKETWVKVQVKWVLLGGVFYIIGALLYALRLPERISPG 270
           A+FVAFGLSA+LPIF+G   YG +ET ++VQ+KWV+L GVFYI GALLY +R PER+ PG
Sbjct: 216 AMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPG 275

Query: 271 KFDIWGHSHQIFHILVVIAALCHLKAVLNSYELVHKKLASI 311
            FDIWGHSHQ+FHILVV+AALCHL+ +L SY +VH +L+S+
Sbjct: 276 MFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRLSSL 316

>Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  389 bits (999), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 182/281 (64%), Positives = 232/281 (82%)

Query: 30  KKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLGCFDSLFYMHNESVNIYTHLLPGLC 89
           KK ++R+YSW+EIP+WQ+DN++I HGYV+ET+SF+  F SLFYMHNESVNIY+HL+P + 
Sbjct: 43  KKVLKRVYSWDEIPEWQRDNDYILHGYVKETSSFVDTFKSLFYMHNESVNIYSHLIPAVG 102

Query: 90  FFFVVLFDKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFHCLKTHSLRIAILGNKL 149
           F  V+L DK  I VF+TTT+LD++M+DLFF GAF CLILSS+FHC K+HSL+IA LGNKL
Sbjct: 103 FLTVLLLDKTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKSHSLKIATLGNKL 162

Query: 150 DYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYR 209
           DYLGI  LIV+SM+SI+YYG++D    F  F+ +T+ FGIAC+I SL D FR REWRPYR
Sbjct: 163 DYLGICILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYR 222

Query: 210 AALFVAFGLSAVLPIFSGVAVYGFKETWVKVQVKWVLLGGVFYIIGALLYALRLPERISP 269
           A LFV FGLS+++PIFSG+  Y F E W ++Q+ WVLLGG  YIIGA+LY +R PE++ P
Sbjct: 223 AGLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYP 282

Query: 270 GKFDIWGHSHQIFHILVVIAALCHLKAVLNSYELVHKKLAS 310
           G+FDIWGHSHQ+FH LVVIA+LCH++ VLNSYELVH K+ +
Sbjct: 283 GRFDIWGHSHQLFHFLVVIASLCHMRGVLNSYELVHIKMQN 323

>TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27
           YOL002C
          Length = 327

 Score =  385 bits (988), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 173/270 (64%), Positives = 219/270 (81%)

Query: 39  WEEIPDWQKDNEHIRHGYVRETNSFLGCFDSLFYMHNESVNIYTHLLPGLCFFFVVLFDK 98
           W+++PDWQKDNEHI  GYV+ETNSF+ CF+SLF++HNESVNIY+H++PGLC  F++L D 
Sbjct: 56  WDDLPDWQKDNEHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLIDI 115

Query: 99  VAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFHCLKTHSLRIAILGNKLDYLGIVALI 158
             IK F TTTF+DY M+DLF  GAF+CLILSS FH LK+HSL +AI GNKLDYLGIV LI
Sbjct: 116 NIIKKFPTTTFVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILI 175

Query: 159 VSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYRAALFVAFGL 218
           V+SMISI+YYGF+D+  FF+ FST+T++FGIAC   SL++ FRSREWRPYRA LFV FGL
Sbjct: 176 VTSMISILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGL 235

Query: 219 SAVLPIFSGVAVYGFKETWVKVQVKWVLLGGVFYIIGALLYALRLPERISPGKFDIWGHS 278
           SAV P+ +G+  YG ++T+ ++Q+KW++  G FYI GA LYA+R PERI PG FD+WGHS
Sbjct: 236 SAVFPVLTGIWYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHS 295

Query: 279 HQIFHILVVIAALCHLKAVLNSYELVHKKL 308
           HQIFH+ VVIAA  H   +L++YE  H+ L
Sbjct: 296 HQIFHVFVVIAAYSHFHGLLSAYEYAHEML 325

>KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 308

 Score =  382 bits (982), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 183/306 (59%), Positives = 223/306 (72%), Gaps = 1/306 (0%)

Query: 6   NRRRLQIKRANIVKEETMSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLG 65
            R+R  +     + EET  T    +   RR+YSW+EIPDWQKDNEHI HGYVRET S+  
Sbjct: 3   TRKRSVVTEETALIEETPGTKKTVRVYERRVYSWDEIPDWQKDNEHILHGYVRETQSWKE 62

Query: 66  CFDSLFYMHNESVNIYTHLLPGLCFFFVVLF-DKVAIKVFDTTTFLDYIMVDLFFLGAFT 124
            F SLFY+HNESVNIYTHL+P +  FF++LF     I  + TT+ +DY M++LFF G  T
Sbjct: 63  LFHSLFYLHNESVNIYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYFMINLFFFGCAT 122

Query: 125 CLILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLT 184
           CL +SS FH +K HSL IA  GNKLDYLGIV LI +SMISI++YGF DS   FY F+ LT
Sbjct: 123 CLTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAGLT 182

Query: 185 LVFGIACAIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKVQVKW 244
            +FG+ C   SL D FRSREWRPYRA +FV FGLSAV PI +G  VYG  ETW +VQ+ W
Sbjct: 183 SLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQLTW 242

Query: 245 VLLGGVFYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNSYELV 304
           V+  GV YI GA LY +R PER++PGKFDIWGHSHQ+FH+LVV+AALCHLKA++ SY LV
Sbjct: 243 VIWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHSHQLFHVLVVVAALCHLKALVVSYGLV 302

Query: 305 HKKLAS 310
           H+ L+ 
Sbjct: 303 HQALSQ 308

>Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to
           Ashbya gossypii ACL002C
          Length = 328

 Score =  382 bits (980), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 170/295 (57%), Positives = 223/295 (75%)

Query: 14  RANIVKEETMSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLGCFDSLFYM 73
             +++ E+     TI  K   +L+SW EIP+WQ+DNEHI  GYV+ETNSF     SL Y+
Sbjct: 26  ETSVIFEDLNQATTIPLKPASKLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYL 85

Query: 74  HNESVNIYTHLLPGLCFFFVVLFDKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFH 133
           HNESVNIYTHL+PG+CFF V+  +K  I  F TTT+ DY ++D FF+GAF CL++S T+H
Sbjct: 86  HNESVNIYTHLIPGVCFFCVLFLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYH 145

Query: 134 CLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAI 193
           CLK+HS  ++I+GN+LDY+GIV LI +SM S++YYGF++S K FYGFS +TL+ G  C +
Sbjct: 146 CLKSHSYPVSIVGNQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTV 205

Query: 194 ASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKVQVKWVLLGGVFYI 253
            +L   FRSR WRPYRA++FVAFGLS++LPI + +  YG +ETW  VQ+ W++L GV YI
Sbjct: 206 VTLDSRFRSRLWRPYRASIFVAFGLSSILPILASILYYGSEETWNSVQLGWIILEGVLYI 265

Query: 254 IGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNSYELVHKKL 308
            GA +Y +R PE ++PG FDIWGHSHQ+FH+LVVIAALCH KAV  SYELVH +L
Sbjct: 266 FGAFIYGIRFPESMAPGSFDIWGHSHQLFHVLVVIAALCHFKAVTQSYELVHFRL 320

>TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27
           YOL002C
          Length = 319

 Score =  380 bits (977), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 184/317 (58%), Positives = 231/317 (72%), Gaps = 11/317 (3%)

Query: 1   MEPEPNRRRLQIKRANIV-------KEETMSTGTINKKRVRRLYSWEEIPDWQKDNEHIR 53
           M  E  RR+L       V       +++  ++G+  K    RLY+W+EIP WQ DNE+I 
Sbjct: 1   MVTEVQRRKLTSSTEEGVELLYGDNQQQLNTSGSSGK----RLYTWDEIPVWQHDNEYIY 56

Query: 54  HGYVRETNSFLGCFDSLFYMHNESVNIYTHLLPGLCFFFVVLFDKVAIKVFDTTTFLDYI 113
            GYVRETNS    F SLFY+HNESVNIYTHL+P  CF  ++LF+   +K   TTT+ DY+
Sbjct: 57  TGYVRETNSMKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLFNTYGVKPHPTTTYGDYV 116

Query: 114 MVDLFFLGAFTCLILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDS 173
            +DLFF+GAFTCL LSSTFHC K+HSL+I++ GNKLDYLGIV LI +S+IS++Y+G+ D 
Sbjct: 117 AIDLFFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYLGIVILISTSLISVLYFGYHDD 176

Query: 174 GKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGF 233
              FY FS +TL FGIAC IASL D FR+REWRPYRAALFV FGLS VLPI +G+  YG 
Sbjct: 177 PFIFYIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGI 236

Query: 234 KETWVKVQVKWVLLGGVFYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCH 293
           +E + +VQ+KW++  GV YI GA LY  R PE+  PGK DIWG SHQIFH+LVVIAALCH
Sbjct: 237 REVFERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCH 296

Query: 294 LKAVLNSYELVHKKLAS 310
           L+ ++ SYELVH+KL +
Sbjct: 297 LRGLIGSYELVHQKLDA 313

>ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL002C
          Length = 329

 Score =  369 bits (946), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 166/276 (60%), Positives = 212/276 (76%)

Query: 32  RVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLGCFDSLFYMHNESVNIYTHLLPGLCFF 91
            V  L SW+++PDWQKDNEHI  GYVRETNS+   F SLFY+HNESVNIY+HL+PG+CF 
Sbjct: 48  EVSSLCSWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFL 107

Query: 92  FVVLFDKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFHCLKTHSLRIAILGNKLDY 151
           F+ LF+K  +  + TTT+ DY+M+D+F LGA  CL LS  +HC+K+HSL +++ GNKLDY
Sbjct: 108 FIALFNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDY 167

Query: 152 LGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYRAA 211
           +GIVALI  SMIS MYYGF+DS   F  FST+TL   +ACA+ SLS  FRSREWR YRAA
Sbjct: 168 IGIVALISCSMISQMYYGFYDSTAMFSLFSTVTLSLALACAVVSLSPHFRSREWRKYRAA 227

Query: 212 LFVAFGLSAVLPIFSGVAVYGFKETWVKVQVKWVLLGGVFYIIGALLYALRLPERISPGK 271
           +F AFGLS +LP+ +    YG  E + ++Q+KW+ L GV YI GA+LY +R PE++ PG 
Sbjct: 228 IFTAFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGS 287

Query: 272 FDIWGHSHQIFHILVVIAALCHLKAVLNSYELVHKK 307
           FDIWGHSHQ+FH+LVVIAALCHL+A+L+ Y+ VH  
Sbjct: 288 FDIWGHSHQLFHVLVVIAALCHLRALLSCYKNVHTN 323

>TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON}
           Anc_3.90 YOL101C
          Length = 327

 Score =  299 bits (766), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 148/309 (47%), Positives = 209/309 (67%), Gaps = 7/309 (2%)

Query: 6   NRRRLQI-KRANIVKEETMSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFL 64
           +RRR  + K   ++ E T    T +KK    LYS+ E+P+WQKDNE I  GYVRETNS+ 
Sbjct: 18  SRRRFSVSKNGTVLLESTEIVETYSKK----LYSFHELPEWQKDNELIIQGYVRETNSWF 73

Query: 65  GCFDSLFYMHNESVNIYTHLLPGLCFFFVVLF--DKVAIKVFDTTTFLDYIMVDLFFLGA 122
            CF SL Y HNES+NIYTHL+PGL +F ++LF  D + +  F +TT +DYI++D + LGA
Sbjct: 74  KCFHSLSYFHNESINIYTHLIPGLVYFIMLLFYTDLLVVPSFPSTTIMDYIVIDFYLLGA 133

Query: 123 FTCLILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFST 182
           F CL+ SS FHCLK HS   +   +K+DY+GI+ LI  S+IS++YYG+FD   +F  F+ 
Sbjct: 134 FICLVGSSCFHCLKQHSEDQSNFWSKIDYVGIICLISCSLISLLYYGYFDHFIYFKVFTL 193

Query: 183 LTLVFGIACAIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKVQV 242
           +TL+    C +  L + F ++ +RP RA  FV F  SAV+PI +G+  + + E   ++Q+
Sbjct: 194 ITLILATICTVCVLDERFNAKNFRPIRAGFFVVFATSAVIPICTGLIKFDYVEVINRIQL 253

Query: 243 KWVLLGGVFYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNSYE 302
           ++V     FY++GALLY  R+PE  +PG+FD+ G SHQIFH++VVI +L HLKAV+ SYE
Sbjct: 254 RFVGWETFFYVVGALLYGYRIPEIFAPGRFDLVGSSHQIFHVMVVIGSLFHLKAVIGSYE 313

Query: 303 LVHKKLASI 311
            +HK L  I
Sbjct: 314 FMHKSLNVI 322

>SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 314

 Score =  293 bits (750), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 145/301 (48%), Positives = 206/301 (68%), Gaps = 9/301 (2%)

Query: 7   RRRLQIKRANIVKEETMSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLGC 66
           +RR   ++A+    E+++T     K  +RL ++EE+PDWQKDNE I  GYVRET S   C
Sbjct: 9   QRRKTTQKAS---AESIATA----KGRKRLCTFEELPDWQKDNELILDGYVRETRSVSEC 61

Query: 67  FDSLFYMHNESVNIYTHLLPGLCFFFVVLF--DKVAIKVFDTTTFLDYIMVDLFFLGAFT 124
           F SL Y HNE+VNIYTHL+PG+ +  +++F  D + I  F ++T  DYI+++ F LGAF 
Sbjct: 62  FKSLLYFHNETVNIYTHLVPGVTYLLMLMFLTDFILIPKFPSSTMTDYIIINFFLLGAFV 121

Query: 125 CLILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLT 184
           CL+ SS FHCLK HS   + + +K+DY+GI+ LI  SM+SI+YYGF D    F  F+ +T
Sbjct: 122 CLMCSSCFHCLKQHSEEHSDIWSKVDYMGIIVLISCSMVSILYYGFHDHLFHFKIFTVVT 181

Query: 185 LVFGIACAIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKVQVKW 244
           ++ G  CA   L+D F S+ +R +RA+ FV+FG S ++PI  G+  +G  E+  +VQ+K+
Sbjct: 182 VILGSCCAAFVLNDRFNSKNFRVFRASFFVSFGFSGLVPIIFGLVKFGISESVHRVQLKY 241

Query: 245 VLLGGVFYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNSYELV 304
           V L  VFYI GA+ Y  R+PE   PGKFD+ GHSHQIFH++VV+ +LCHL+AV+ SY  +
Sbjct: 242 VGLEAVFYIGGAVFYGFRIPENFGPGKFDLVGHSHQIFHVMVVLGSLCHLRAVVGSYIFM 301

Query: 305 H 305
           H
Sbjct: 302 H 302

>KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {ON}
           similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  286 bits (733), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 144/306 (47%), Positives = 196/306 (64%), Gaps = 5/306 (1%)

Query: 7   RRRLQIKRANIVKEETMSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLGC 66
           R+R Q    N  K  T       K     L  +EE+PDWQ+DN+ I  GYVRETNS   C
Sbjct: 8   RQRRQQCAPNKGKAGTSGATAPGKNG---LCCFEELPDWQRDNDKILAGYVRETNSMKKC 64

Query: 67  FDSLFYMHNESVNIYTHLLPGLCFFFVVLF--DKVAIKVFDTTTFLDYIMVDLFFLGAFT 124
           F+SL Y HNE+VNIYTHL+P   +  +++F  D   I  F TTT  DYIM++ F LGAF 
Sbjct: 65  FESLTYFHNETVNIYTHLIPSGTYLVMLMFFTDLFLIPQFPTTTMSDYIMINFFLLGAFL 124

Query: 125 CLILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLT 184
           CL+ S+ FHCLK HS   + + +K+DY+GI+ LI  S +S++YYGF+D    F  F+   
Sbjct: 125 CLMCSTCFHCLKQHSEAQSNIWSKVDYMGIIVLISCSTVSLLYYGFYDYLFHFKMFTIAV 184

Query: 185 LVFGIACAIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKVQVKW 244
           +V G  CA   L+D F ++ WR  RA  FV FG S ++PI  G+  +G  E+  +VQ+++
Sbjct: 185 VVLGSCCAAFVLNDRFNAKNWRACRAGFFVTFGFSGIVPIVVGLVKFGIAESSKRVQLRF 244

Query: 245 VLLGGVFYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNSYELV 304
           VLL  +FYI GA++Y  R+PE + PGKFD  GHSHQIFHILVV+ +LCH +A+L SY  +
Sbjct: 245 VLLEALFYISGAVIYGFRIPETLLPGKFDFVGHSHQIFHILVVLGSLCHFRALLGSYFFM 304

Query: 305 HKKLAS 310
           H  ++S
Sbjct: 305 HTGISS 310

>AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR492W (IZH1) and
           YOL101C (IZH4)
          Length = 317

 Score =  286 bits (732), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 141/289 (48%), Positives = 195/289 (67%), Gaps = 2/289 (0%)

Query: 15  ANIVKEETMSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLGCFDSLFYMH 74
           + + +E   +T    KKR+R+LY+++E+P WQKDNE I  GYVRETNS   C  ++ Y +
Sbjct: 13  SEMAQEMAHTTSEGLKKRIRKLYTFDELPAWQKDNELILSGYVRETNSVKECLRAMTYFN 72

Query: 75  NESVNIYTHLLPGLCFF--FVVLFDKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTF 132
           NES+NIYTHL+PG+ +   F++  D V  ++       ++ M+  + LGAFTCL  SS F
Sbjct: 73  NESINIYTHLIPGVAYLVLFLIFADLVLAQLLPGLDAGEHRMLRFYLLGAFTCLACSSCF 132

Query: 133 HCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACA 192
           HCLK HS   + L +K+DYLGI+A I  S IS++YYG+      F  FSTLT+    ACA
Sbjct: 133 HCLKQHSEPHSRLWSKVDYLGILAQITCSTISLLYYGYHSYPSHFVFFSTLTVALCSACA 192

Query: 193 IASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKVQVKWVLLGGVFY 252
           +  L+D+F +  +RP RA LF+AFGLS V+P+ +G   +GF E   ++Q+K+VL   VFY
Sbjct: 193 VLVLNDSFNTVAFRPLRAFLFMAFGLSGVIPVLAGSYQFGFAEWAARIQLKYVLYEAVFY 252

Query: 253 IIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNSY 301
           I GAL+Y  R+PER +PGKFD+ GHSHQIFH+LVV+  LCH +AV  SY
Sbjct: 253 ITGALVYGFRIPERFAPGKFDMVGHSHQIFHLLVVLGTLCHFRAVTGSY 301

>ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 318

 Score =  285 bits (728), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 143/310 (46%), Positives = 200/310 (64%), Gaps = 8/310 (2%)

Query: 4   EPNRRRLQIKRANIVKEETMSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNSF 63
           E  RRR+ I   N    E +    + +K    LY + E+P+WQ+DN+ I  GY+RET S 
Sbjct: 6   EVKRRRVPIGNGN---GEGLYKEVLEEKT---LYDFHELPEWQQDNDKILTGYIRETKSV 59

Query: 64  LGCFDSLFYMHNESVNIYTHLLPGLCFFFVVL--FDKVAIKVFDTTTFLDYIMVDLFFLG 121
           L C  SLF  +NE+VNIYTHL+  + +F ++L   D V +  F T+TF DY +++ + LG
Sbjct: 60  LKCVRSLFIWNNETVNIYTHLVSAVSYFLLMLGITDLVMVPHFPTSTFTDYSVINFYLLG 119

Query: 122 AFTCLILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFS 181
           AF CL+ SS FH  K HS   +   +K+DY+GI+ LI  SMIS++YYGFFD  ++F  F+
Sbjct: 120 AFGCLMCSSCFHTFKQHSGPHSDAWSKVDYMGIIVLITCSMISLIYYGFFDHMEYFRLFT 179

Query: 182 TLTLVFGIACAIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKVQ 241
            LTL    AC +  LSD F  +++RP RA  F+AFGLS V P+ +G+  +G +    +VQ
Sbjct: 180 VLTLTLATACTVCVLSDKFNHKDFRPLRAGFFIAFGLSGVFPVAAGIIKFGIQGGVQRVQ 239

Query: 242 VKWVLLGGVFYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNSY 301
           +K++ L  +FYI GAL+Y  R+PE + PG+FD WGHSHQIFH+LVVIA+  HLKAV+ SY
Sbjct: 240 LKYLGLEAIFYIAGALIYGFRIPETMFPGRFDFWGHSHQIFHVLVVIASFLHLKAVMGSY 299

Query: 302 ELVHKKLASI 311
              H  L  +
Sbjct: 300 IFKHSHLNGV 309

>Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W
           (REAL)
          Length = 315

 Score =  284 bits (726), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 140/316 (44%), Positives = 207/316 (65%), Gaps = 7/316 (2%)

Query: 1   MEPEPNRRRLQ----IKRANIVKEETMSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHGY 56
           M     RRR Q     K +  +K E + +    +K  + L+ + E+PDWQ+DN+ I  GY
Sbjct: 1   MSITATRRRNQENVCCKTSTSIKVEALKSKVTLRKE-KLLHDFHELPDWQRDNDKILTGY 59

Query: 57  VRETNSFLGCFDSLFYMHNESVNIYTHLLPGLCFFF--VVLFDKVAIKVFDTTTFLDYIM 114
           VRET S+  C  SLFY +NE+VNIYTHL+P + +F   V L +   I VF +TT+ DY +
Sbjct: 60  VRETLSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFGVTLTNYFLIPVFPSTTWSDYTV 119

Query: 115 VDLFFLGAFTCLILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSG 174
           +++F +GAF CL+ SS FHC+K HS + +   +KLDYLGI++LI  SMI I+Y+G+FD  
Sbjct: 120 INIFLMGAFLCLMCSSCFHCMKQHSEKQSDFWSKLDYLGIISLISCSMIPIIYFGYFDHA 179

Query: 175 KFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFK 234
            +F  F+ +TLV    C I  L D F +  +RP+RA  F+ FG S +LP+ +G+  +G +
Sbjct: 180 SYFSLFTIVTLVLATFCTICVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGLFKFGLQ 239

Query: 235 ETWVKVQVKWVLLGGVFYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHL 294
               +++V +V    +FYI GAL+Y  R+PE ++PGKFD +G SHQIFHI+VV+ ++CHL
Sbjct: 240 GVLNRIRVSFVFWEALFYISGALIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHL 299

Query: 295 KAVLNSYELVHKKLAS 310
           KA+++SY+L+H    S
Sbjct: 300 KAIIDSYKLMHSHFHS 315

>TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90
           YOL101C
          Length = 316

 Score =  283 bits (725), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 136/298 (45%), Positives = 201/298 (67%), Gaps = 2/298 (0%)

Query: 13  KRANIVKEETMSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLGCFDSLFY 72
           +R   V+E   +  + +    ++LY + E+P+WQ+DN+ I  GYVRET S L C DSL Y
Sbjct: 9   QRKTTVQETQKARDSKDGIMGKKLYHFNELPEWQQDNDKILTGYVRETKSVLRCLDSLSY 68

Query: 73  MHNESVNIYTHLLPGLCFFFVVLF--DKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSS 130
            +NESVNIYTHLL  + +F ++LF  D + I  F +TT  DYI+++ + LGAF CL+ SS
Sbjct: 69  WNNESVNIYTHLLSAVAYFVLLLFFTDILLIPSFPSTTMTDYIIINFYLLGAFVCLMCSS 128

Query: 131 TFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIA 190
            FHC K HS   +   +K+DY+GI+ LI  S+IS++YYG+FD   +F  FS +T+V  +A
Sbjct: 129 CFHCFKQHSNSQSDAWSKVDYMGIIGLISCSVISLLYYGYFDHVFYFKLFSVITVVLAMA 188

Query: 191 CAIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKVQVKWVLLGGV 250
           C++  LSD F + + RP RA+ F+ F  S+V+PI +G+  +G+ E + +VQ+++V     
Sbjct: 189 CSVCVLSDRFNTSDMRPLRASFFITFAFSSVIPIATGMFKFGWTEVFHRVQLRFVGWEAF 248

Query: 251 FYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNSYELVHKKL 308
           FY+ GALLY  R+PE I+PGKFD  G SHQ+FH+LVV+ + CHL+AV+ SY  +H  +
Sbjct: 249 FYLSGALLYGYRIPETIAPGKFDFIGSSHQLFHVLVVLGSFCHLRAVMGSYMFMHAHI 306

>Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  280 bits (717), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 138/315 (43%), Positives = 208/315 (66%), Gaps = 8/315 (2%)

Query: 1   MEPEPNRRRLQIK-----RANIVKEETMSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHG 55
           M     RRR Q           +K E + + T ++K  + L++++E+P+WQKDN+ I  G
Sbjct: 1   MSITTTRRRNQESVCCKATTASIKVEAVQSKTASEKE-KLLHNFDELPEWQKDNDKILTG 59

Query: 56  YVRETNSFLGCFDSLFYMHNESVNIYTHLLPGLCFFF--VVLFDKVAIKVFDTTTFLDYI 113
           YVRET S+  C  SLFY +NE+VNIYTHL+P + +F   + L +   I VF +T++ DY 
Sbjct: 60  YVRETLSWKKCLRSLFYWNNETVNIYTHLVPAIIYFLFAITLTNYFLIPVFPSTSWSDYT 119

Query: 114 MVDLFFLGAFTCLILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDS 173
           ++++F +GAF+CL+ SS FHCLK HS   +   +KLDYLGI++LI  SMI I+Y+G+FD 
Sbjct: 120 VINIFLMGAFSCLMCSSCFHCLKQHSEEQSNFWSKLDYLGIISLISCSMIPIIYFGYFDH 179

Query: 174 GKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGF 233
             +F  F+T+TLV    C +  L + F +  +RP+RA  F+ FG S +LP+ +G   +G 
Sbjct: 180 VSYFSLFTTVTLVLATFCTVCVLHEKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGI 239

Query: 234 KETWVKVQVKWVLLGGVFYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCH 293
           +    +++V +V    +FYI GA++Y  R+PE I+PGKFD  G SHQIFHI+VV+ +LCH
Sbjct: 240 QGVLNRIKVSFVFWEALFYISGAVIYGFRIPETIAPGKFDFLGSSHQIFHIMVVLGSLCH 299

Query: 294 LKAVLNSYELVHKKL 308
           LKA+++SY+L+H  +
Sbjct: 300 LKAIIDSYKLMHSHI 314

>YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membrane
           protein involved in zinc ion homeostasis, member of the
           four-protein IZH family; transcription is regulated
           directly by Zap1p, expression induced by zinc deficiency
           and fatty acids; deletion increases sensitivity to
           elevated zinc
          Length = 316

 Score =  280 bits (716), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 139/316 (43%), Positives = 213/316 (67%), Gaps = 10/316 (3%)

Query: 1   MEPEPNRRRLQ------IKRANIVKEETMSTGTINKKRVRRLYSWEEIPDWQKDNEHIRH 54
           M     RRR Q        RA+I K E +S  T+ +K+ + L++++E+P+WQKDN+ I  
Sbjct: 1   MSITTTRRRNQDSVCCKATRASI-KVEAVSGQTVFEKQ-KLLHNFDELPEWQKDNDKILT 58

Query: 55  GYVRETNSFLGCFDSLFYMHNESVNIYTHLLPGLCFFF--VVLFDKVAIKVFDTTTFLDY 112
           GYVRET S+  C  SLFY +NE+VNIYTHL+P + +F   + L +   I VF +T++ DY
Sbjct: 59  GYVRETLSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFAITLTNYFLIPVFPSTSWSDY 118

Query: 113 IMVDLFFLGAFTCLILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFD 172
            ++++F +GAF+CL+ SS FHC+K HS + +   +KLDYLGI++LI  SMI I+Y+G+FD
Sbjct: 119 TVINIFLMGAFSCLMCSSCFHCMKQHSEKQSNFWSKLDYLGIISLISCSMIPIIYFGYFD 178

Query: 173 SGKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYG 232
              +F  F+ +TLV    C +  L D F +  +RP+RA  F+ FG S +LP+ +G   +G
Sbjct: 179 HISYFSLFTIVTLVLATFCTVCVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFG 238

Query: 233 FKETWVKVQVKWVLLGGVFYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALC 292
            +    +++V +V    +FYI GA++Y  R+PE ++PGKFD +G SHQIFHI+VV+ ++C
Sbjct: 239 IQGVLNRIKVSFVFWEALFYISGAVIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVC 298

Query: 293 HLKAVLNSYELVHKKL 308
           HLKA+++SY+L+H  +
Sbjct: 299 HLKAIIDSYKLMHSHI 314

>Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON}
           complement(40099..41073) [975 nt, 325 aa]
          Length = 324

 Score =  280 bits (716), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 134/278 (48%), Positives = 191/278 (68%), Gaps = 2/278 (0%)

Query: 35  RLYSWEEIPDWQKDNEHIRHGYVRETNSFLGCFDSLFYMHNESVNIYTHLLPGLCFFFVV 94
           +L  + E+PDWQKDNE I  GYVRETNS   C  SL   +NES+NIY+HL+  + +F V+
Sbjct: 40  KLCHFHELPDWQKDNEFILTGYVRETNSIKKCLRSLGCFNNESINIYSHLIAAISYFVVL 99

Query: 95  LF--DKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFHCLKTHSLRIAILGNKLDYL 152
           LF  D + I  F +TTF+DY+++DL+ LGAFTCLI SS FHC+K HS   + + +K+DY+
Sbjct: 100 LFYTDILCIPSFPSTTFVDYMVIDLYLLGAFTCLIGSSLFHCMKQHSESHSDMWSKVDYI 159

Query: 153 GIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYRAAL 212
           GI+ LI  S+IS++YYG+ D   +F  F+ +TLV    C I  L   F S+ +RP RA  
Sbjct: 160 GIICLITCSLISLLYYGYMDHFIYFKVFTVITLVLATICTICVLDQRFNSKNFRPIRAGF 219

Query: 213 FVAFGLSAVLPIFSGVAVYGFKETWVKVQVKWVLLGGVFYIIGALLYALRLPERISPGKF 272
           F+ F +SAV+PI +G + +GF E   ++Q+++V     FY++GALLY  R+PE + PG F
Sbjct: 220 FILFSMSAVIPIGAGFSKFGFTEVLQRIQLRFVAWETFFYVVGALLYGFRIPETLYPGNF 279

Query: 273 DIWGHSHQIFHILVVIAALCHLKAVLNSYELVHKKLAS 310
           D+ G SHQIFHI+V++ ++ HLKAVL SY  +H  ++S
Sbjct: 280 DLVGSSHQIFHIMVILGSVFHLKAVLGSYTFMHSNISS 317

>Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  278 bits (711), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 135/315 (42%), Positives = 210/315 (66%), Gaps = 8/315 (2%)

Query: 1   MEPEPNRRRLQIK-----RANIVKEETMSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHG 55
           M     RRR Q           +K E +S+ T+++K+ + L++++E+P+WQKDN+ I  G
Sbjct: 1   MSLTTTRRRNQESVCCSVTTGSIKVEAVSSTTVSEKK-KLLHNFDELPEWQKDNDKILTG 59

Query: 56  YVRETNSFLGCFDSLFYMHNESVNIYTHLLPGLCFFF--VVLFDKVAIKVFDTTTFLDYI 113
           YVRET S+  C  SLFY +NE+VNIYTHL+P + +F   + L +   I VF +T++ DY 
Sbjct: 60  YVRETLSWKKCLYSLFYWNNETVNIYTHLVPAVIYFVFAITLTNYFLIPVFPSTSWSDYT 119

Query: 114 MVDLFFLGAFTCLILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDS 173
           ++++F +GAF+CL+ SS FHC+K HS + +   +KLDYLGI++LI  SMI I+Y+G+FD 
Sbjct: 120 VINIFLMGAFSCLMCSSCFHCMKQHSEKQSNFWSKLDYLGIISLISCSMIPIIYFGYFDH 179

Query: 174 GKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGF 233
             +F  F+ +TLV    C +  L + F +  +RP+RA  F+ FG S +LP+ +G   +G 
Sbjct: 180 ISYFSLFTIVTLVLATFCTVCVLHEKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGI 239

Query: 234 KETWVKVQVKWVLLGGVFYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCH 293
           +    +++V +V    +FYI GA++Y  R+PE ++PGKFD  G SHQIFHI+VV+ ++CH
Sbjct: 240 QGVLNRIKVSFVFWEALFYISGAVIYGFRIPETLAPGKFDFLGSSHQIFHIMVVLGSICH 299

Query: 294 LKAVLNSYELVHKKL 308
           LKA++ SY+L+H  +
Sbjct: 300 LKAIIGSYKLMHSHI 314

>Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR337W
          Length = 305

 Score =  276 bits (707), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 133/270 (49%), Positives = 183/270 (67%), Gaps = 2/270 (0%)

Query: 34  RRLYSWEEIPDWQKDNEHIRHGYVRETNSFLGCFDSLFYMHNESVNIYTHLLPGLCFFFV 93
           RRLYS++E+P+WQKDNE IR GYVRETNSFL C  S+ Y +NESVNIYTHL+P + +F +
Sbjct: 20  RRLYSFDELPEWQKDNELIRMGYVRETNSFLECLKSMTYFNNESVNIYTHLVPSVTYFIL 79

Query: 94  VLFDKVA--IKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFHCLKTHSLRIAILGNKLDY 151
           +L         +F  TT  +YIM+D +  G F CL+ S+ FHCLK HS     + +K+DY
Sbjct: 80  LLLFVDLVVTPMFPGTTMREYIMIDFYLFGVFVCLMCSTCFHCLKQHSESHNRIWSKVDY 139

Query: 152 LGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYRAA 211
           +GI+  I SS++SI+YYGF+D        S LTL  G+ C    L+D F + ++R  RA 
Sbjct: 140 IGIIVQITSSIVSILYYGFYDHISHIKWLSVLTLTLGVCCVTFVLNDRFNAIDYRLLRAI 199

Query: 212 LFVAFGLSAVLPIFSGVAVYGFKETWVKVQVKWVLLGGVFYIIGALLYALRLPERISPGK 271
            F  FG S V+P+  G+  +G  E   ++Q+K+VL G +FYI GAL+Y  R+PE ++PGK
Sbjct: 200 FFTVFGFSGVVPVLIGIYQFGLIEWLARIQLKFVLAGTIFYIFGALIYGFRIPEALAPGK 259

Query: 272 FDIWGHSHQIFHILVVIAALCHLKAVLNSY 301
           FD  GHSHQIFH+LVV+ ++CH +AV+ SY
Sbjct: 260 FDFIGHSHQIFHLLVVLGSICHFRAVIGSY 289

>NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {ON}
           Anc_3.90
          Length = 330

 Score =  277 bits (708), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 136/291 (46%), Positives = 198/291 (68%), Gaps = 4/291 (1%)

Query: 19  KEETMSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLGCFDSLFYMHNESV 78
            + +    T  +KR   L  ++E+P+WQKDN+ I  GYVRETNSF+ CF SLFY++NE++
Sbjct: 36  NDTSQKPKTNRRKRKIHLSKFDELPEWQKDNDKILTGYVRETNSFIHCFQSLFYLNNETI 95

Query: 79  NIYTHLLPGLCFFFV----VLFDKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFHC 134
           NIYTHL+P + +  V    +  + +AI  F TT+ +DYI++++F LGAFTCL+LSS FHC
Sbjct: 96  NIYTHLIPSIIYLIVSLTFIFINFIAIPKFPTTSVIDYIVINIFILGAFTCLLLSSCFHC 155

Query: 135 LKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIA 194
           LK HS +   L +KLDY+GI+ LI  S+I I+Y+G+FD   +F  F+ LT  F I C+I 
Sbjct: 156 LKQHSFKQCTLWSKLDYIGIIILISCSIIPILYFGYFDRLSYFKFFTILTFSFAIVCSII 215

Query: 195 SLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKVQVKWVLLGGVFYII 254
            L++ F    +RP RA LF+ F  + ++P+ +G  ++G+K    ++ + +VLL  +FYII
Sbjct: 216 VLNEKFDLPSYRPLRAGLFMLFSFTGLIPMITGFYIFGYKGVMERISLNFVLLEAIFYII 275

Query: 255 GALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNSYELVH 305
           G LLY  R+PE   PG FD++G SHQIFHI VV+ ++CH  AV+ SY L+H
Sbjct: 276 GTLLYGFRIPETFKPGNFDMFGSSHQIFHIFVVLGSICHFGAVIKSYCLMH 326

>Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W -
           Hypothetical ORF [contig 184] FULL
          Length = 320

 Score =  273 bits (697), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 134/305 (43%), Positives = 196/305 (64%), Gaps = 4/305 (1%)

Query: 10  LQIKRANIVKEETMSTGTINKKRVRR--LYSWEEIPDWQKDNEHIRHGYVRETNSFLGCF 67
           L+ +R+    E      + + ++ ++  L  +EE+P+WQ+DNE I  GYVRET S   C 
Sbjct: 7   LKQRRSACKNELKNGKNSKSAEQTKKSALCRFEELPEWQRDNEKILAGYVRETRSMRKCL 66

Query: 68  DSLFYMHNESVNIYTHLLPGLCFFFVVLF--DKVAIKVFDTTTFLDYIMVDLFFLGAFTC 125
           +SL Y HNE++NIYTHL+P   +  +++F  D   I  F +TT  DYIM++ + LGAF C
Sbjct: 67  ESLTYFHNETLNIYTHLIPSGTYLVLLMFFTDVFLIPHFPSTTMSDYIMINFYLLGAFLC 126

Query: 126 LILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTL 185
           L+ S+ FHCLK HS   + + +K+DY+GI+ LI  S +S++YYGF D    F  F+   +
Sbjct: 127 LLCSTCFHCLKQHSEAQSNIWSKVDYMGIIVLISCSTVSLLYYGFHDYLFHFKIFTIAVV 186

Query: 186 VFGIACAIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKVQVKWV 245
           V G  CA   L+D F ++ WR  RA  FV FG S ++PI  G+  +G  E+  +VQ+++V
Sbjct: 187 VLGSCCAAFVLNDRFNAKNWRACRAGFFVTFGFSGIVPIIMGLVKFGVAESSKRVQLRFV 246

Query: 246 LLGGVFYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNSYELVH 305
           LL   FYI GA++Y  R+PE + PGKFD  GHSHQIFHILVV+ +LCH +A++ SY  +H
Sbjct: 247 LLEAFFYIGGAIIYGFRIPETLIPGKFDFVGHSHQIFHILVVLGSLCHFRALIGSYFFMH 306

Query: 306 KKLAS 310
             ++S
Sbjct: 307 TGISS 311

>CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar to
           uniprot|Q03419 Saccharomyces cerevisiae YDR492w
          Length = 316

 Score =  270 bits (689), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 126/281 (44%), Positives = 191/281 (67%), Gaps = 2/281 (0%)

Query: 29  NKKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLGCFDSLFYMHNESVNIYTHLLPGL 88
            +K  + L+ + E+P+WQKDN+ I  GYVRETNSF  C  SL Y++NESVNIYTHL+P +
Sbjct: 31  EEKSEKLLWHFNELPEWQKDNDKILRGYVRETNSFKRCLQSLLYLNNESVNIYTHLIPAV 90

Query: 89  CFFFVVLF--DKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFHCLKTHSLRIAILG 146
            +  + L+  +   I V+ +T+ +DY+++++FFLGAF CL+ SS FHC+K HS     + 
Sbjct: 91  FYISLSLYLANVFLIPVYPSTSSVDYVIINVFFLGAFFCLLCSSCFHCMKQHSESQCNVW 150

Query: 147 NKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSREWR 206
           +KLDYLGI+ LI  S + ++YYG+FD    F  F+ +TL+  I C++  L+D F + E+R
Sbjct: 151 SKLDYLGIICLISCSTVPMIYYGYFDHISEFTIFTGITLLLAIGCSVFVLTDKFNTTEYR 210

Query: 207 PYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKVQVKWVLLGGVFYIIGALLYALRLPER 266
           P RA+ F  FG S ++P+ +G   +G +    ++ + ++ L  +FYI GA++Y  R PE 
Sbjct: 211 PIRASFFTLFGFSGIIPLGAGFLKFGAEGVLQRISLPFIGLEALFYISGAIIYGFRFPET 270

Query: 267 ISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNSYELVHKK 307
           I+PGKFD +G SHQIFHI+VV+ ++CHL A++ SY L+H  
Sbjct: 271 IAPGKFDFFGSSHQIFHIMVVLGSICHLFAMVESYHLIHSN 311

>KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3.90
           YOL101C
          Length = 319

 Score =  264 bits (675), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 131/307 (42%), Positives = 195/307 (63%), Gaps = 7/307 (2%)

Query: 7   RRRLQIKRANIVKEETMSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLGC 66
           +R    + A      T S  +I  ++ R LY + E+P WQ+DN+ I  GYVRETNSF  C
Sbjct: 11  KRSKSFRSAKSTITRTRSDSSIKIEK-RILYHFHELPTWQQDNDKILGGYVRETNSFTKC 69

Query: 67  FDSLFYMHNESVNIYTHLLPGLCFFFVVLF-----DK-VAIKVFDTTTFLDYIMVDLFFL 120
            +SLFY++NES+NIY+HL+P L +  + +      D+ + I ++ TTT  D+I +++F +
Sbjct: 70  IESLFYLNNESINIYSHLIPSLIYLTIAVMLLIEIDQFLNIPIYPTTTKYDFIFINIFLV 129

Query: 121 GAFTCLILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGF 180
           GAF CL+ S  FH LK HS       +++DY+GI+ LI  SM+ ++YYGFFD    FY F
Sbjct: 130 GAFLCLLGSGCFHLLKQHSELQCNFWSRIDYMGIIVLISCSMMPVLYYGFFDHIVLFYCF 189

Query: 181 STLTLVFGIACAIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKV 240
            TLTL F   C+I  +S+TF   ++R  RA +F AFG S ++P+  G + +G    + ++
Sbjct: 190 ITLTLAFASVCSIIVMSETFNLSKYRLLRACVFAAFGFSGLIPMIVGFSKFGLSGVFQRI 249

Query: 241 QVKWVLLGGVFYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNS 300
            +K++    VFY++GA LY  R+PE I PGKFD++G SHQ+FH  VVI ++ H KAV+ S
Sbjct: 250 SLKFIFWESVFYLVGATLYGFRIPESILPGKFDLFGSSHQLFHCFVVIGSVLHFKAVIES 309

Query: 301 YELVHKK 307
           Y L+H +
Sbjct: 310 YILMHSR 316

>NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON}
           Anc_3.90 YDR492W
          Length = 314

 Score =  261 bits (668), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 137/311 (44%), Positives = 196/311 (63%), Gaps = 11/311 (3%)

Query: 9   RLQIKRANIVKEETMSTGTINK-------KR--VRRLYSWEEIPDWQKDNEHIRHGYVRE 59
           R+   R    K + ++ G+ NK       KR   RRL+++ E+P+WQ+DN+ I  GYVRE
Sbjct: 3   RVTTTRRKPTKVQAVAVGSSNKHADGDKTKRNWKRRLFNFNELPEWQRDNDKILTGYVRE 62

Query: 60  TNSFLGCFDSLFYMHNESVNIYTHLLPGLCFFF--VVLFDKVAIKVFDTTTFLDYIMVDL 117
           T SF  C  SL Y +NE++NIYTHL+P L +    V L + V +  F TT+ +DY ++++
Sbjct: 63  TKSFKQCLQSLLYWNNETINIYTHLIPALFYLTISVTLINYVVVPHFPTTSIMDYFVINV 122

Query: 118 FFLGAFTCLILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFF 177
           F +GAF CLILSS FHCLK HS R   L +KLDY+GI+ LI  S+I ++Y+G+FD   + 
Sbjct: 123 FLMGAFVCLILSSCFHCLKQHSSRQCTLWSKLDYMGIIILISCSLIPMIYFGYFDHLYYV 182

Query: 178 YGFSTLTLVFGIACAIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETW 237
             F  LT  F   C+I  L++ F    +RP+RA +F+ F  S  +PI +G  ++GF   +
Sbjct: 183 NFFIILTFSFATLCSICVLNEKFNVPHYRPFRAIVFMLFSFSGFIPILTGFYLFGFHGVF 242

Query: 238 VKVQVKWVLLGGVFYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAV 297
            +V +K+V    +FYI GA LY  R+PE   PG FD  G SHQIFHILVV+ ++CH +AV
Sbjct: 243 ERVALKFVAWEALFYITGATLYGFRIPECFKPGDFDFLGSSHQIFHILVVLGSICHFRAV 302

Query: 298 LNSYELVHKKL 308
           + SY L+H  +
Sbjct: 303 IKSYILMHSSM 313

>KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa]
           {ON} similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  256 bits (654), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 128/297 (43%), Positives = 188/297 (63%), Gaps = 2/297 (0%)

Query: 14  RANIVKEETMSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLGCFDSLFYM 73
           R +I ++    T       ++RLY + E+P+WQ+DN+ I  GY+RET S   C  SLF  
Sbjct: 10  RRSISEKLEQLTPVAISSTIKRLYRYSELPEWQQDNDKIITGYIRETKSVKECVKSLFLF 69

Query: 74  HNESVNIYTHLLPGLCFF--FVVLFDKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSST 131
           HNES+NIY+HL+P + +    V L D   +  F  +T +  +M+  F LG+  CL  SS 
Sbjct: 70  HNESINIYSHLVPTITYLVLLVGLADMFLVPQFPNSTMMQSVMIHFFLLGSVLCLGCSSF 129

Query: 132 FHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIAC 191
           FHCLK HS     + +K+DY+GI+ +I  S+IS++YYGF D    F  F+  T++ G  C
Sbjct: 130 FHCLKQHSESHCHIWSKVDYMGIIIMITCSIISLLYYGFHDHIFHFKCFTVFTVILGTIC 189

Query: 192 AIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKVQVKWVLLGGVF 251
            + +L D F S+ +RP+RA  +V FGLS ++PI +G   +G  E   +VQ+K+VLL  +F
Sbjct: 190 TVFALHDKFNSKTFRPFRAMFYVTFGLSGIVPIVTGFWKFGAYEAIRRVQLKYVLLEAMF 249

Query: 252 YIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNSYELVHKKL 308
           YI GA++Y  R PE ++PGKFD  GHSHQIFHI+VV+ ++CH +A+L SY  +H  +
Sbjct: 250 YIAGAVIYGFRFPEVLAPGKFDFVGHSHQIFHIMVVLGSICHFRAILGSYVFMHTGM 306

>TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON}
           Anc_3.90 YOL101C
          Length = 326

 Score =  254 bits (650), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 120/276 (43%), Positives = 183/276 (66%), Gaps = 3/276 (1%)

Query: 36  LYSWEEIPDWQKDNEHIRHGYVRETNSFLGCFDSLFYMHNESVNIYTHLLPGLCFFFVVL 95
           LY++EE+P WQ+DNE I  GY+RETNS+  C  SL + HNE++NIY+H +    +  +++
Sbjct: 43  LYTYEELPSWQQDNEMILTGYIRETNSWKLCLRSLTFFHNETINIYSHGISAAIYLLLLV 102

Query: 96  F---DKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFHCLKTHSLRIAILGNKLDYL 152
           F   + + +  F TTT  DY+++D++ LGA TCL LSS FHCLK HS   + + +K+DY+
Sbjct: 103 FFFTNLIYLPSFPTTTLHDYLVLDIYLLGAATCLTLSSCFHCLKQHSQSQSDIWSKMDYI 162

Query: 153 GIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYRAAL 212
           GI+ LI  S IS++Y+G+ D   +F  F+  T +  I C +    + F +R+W+  RA  
Sbjct: 163 GIICLITCSTISLLYFGYRDHFNYFKFFAISTFILAITCTVFVTMEKFNTRDWKHVRALF 222

Query: 213 FVAFGLSAVLPIFSGVAVYGFKETWVKVQVKWVLLGGVFYIIGALLYALRLPERISPGKF 272
           F+AF  S ++P+ +G+ ++GF E W +VQ+  + L  + Y+IGALLY  R+PE  +PGKF
Sbjct: 223 FIAFAGSGLIPLITGINIFGFPEVWQRVQLPSLTLELICYVIGALLYGYRIPEVFAPGKF 282

Query: 273 DIWGHSHQIFHILVVIAALCHLKAVLNSYELVHKKL 308
           D  G+SHQ FHI VV+ +L HL+A++ SY  +H  L
Sbjct: 283 DNIGNSHQWFHIFVVLGSLLHLRALVGSYYFMHSFL 318

>KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.90
           YOL101C
          Length = 323

 Score =  235 bits (600), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 123/289 (42%), Positives = 185/289 (64%), Gaps = 4/289 (1%)

Query: 24  STGTINKKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLGCFDSLFYMHNESVNIYTH 83
           S+G  + +R  RL  +EE+P WQ+DN+ IR GYVRET S   C  SL Y +NESVN+Y+H
Sbjct: 36  SSGAPSGQR-GRLCRYEELPAWQQDNDCIRTGYVRETLSVRRCLGSLLYWNNESVNMYSH 94

Query: 84  LLPGLCFFF--VVLFDKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFHCLKTHSLR 141
           L+P + +     +   +  +  F TTT+ DY++++ F +GA  CL+ SS FHCLK HS R
Sbjct: 95  LVPAVLYIAGATLALSQWGVPRFPTTTWSDYLIINTFLVGAGACLLCSSLFHCLKQHSER 154

Query: 142 IAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACA-IASLSDTF 200
                +++DY+GI+ LI  S I ++Y+G+FD       F+ +T+  G+AC+ +   +  F
Sbjct: 155 HCEAWSRMDYMGIILLIACSTIPMIYFGYFDYMGHCLLFTAVTVALGVACSGVVLFNKQF 214

Query: 201 RSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKVQVKWVLLGGVFYIIGALLYA 260
            S  ++  RAA F+AF  + ++P+ +G   +G      ++ +K+V    VFYI GA+LY 
Sbjct: 215 NSSSFKLVRAAFFIAFAFNGLIPMATGFVKFGIPGVLDRISLKYVWFEAVFYIAGAMLYG 274

Query: 261 LRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNSYELVHKKLA 309
            R+PE   PGK D+WG+SHQ+FH++VV  +LCHLKAVL SY L+H+ LA
Sbjct: 275 FRVPEIWIPGKVDLWGNSHQMFHVMVVFGSLCHLKAVLESYSLMHRHLA 323

>TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}
          Length = 296

 Score =  164 bits (416), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 98/290 (33%), Positives = 151/290 (52%), Gaps = 30/290 (10%)

Query: 30  KKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLGCFDSLFYMHNESVNIYTHLLPGLC 89
            K   +L ++ ++PDWQKDN  I + YVRETNS      S+F  H+ES+NI+THL+P L 
Sbjct: 2   SKHSLQLCNFNDLPDWQKDNPLIVNYYVRETNSLFKSLCSIFLFHSESMNIFTHLIPAL- 60

Query: 90  FFFVVLFDKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFHCLKTHSLRIAILGNKL 149
                L+ K       T   + Y +V  + +    C +LSS FH  K  S++      KL
Sbjct: 61  -----LYAKFTYNAITTLEQVSYPIV-FYLISVIICFLLSSLFHLFKCTSVQSNEFWGKL 114

Query: 150 DYLGIVALIVSSMISIMYYGFFDS------GKFFYGFSTLTLVFGIACAIASLSDTFRSR 203
           DY+GI  LI ++++S+   GF +S        F    S LT  + I  AI S      + 
Sbjct: 115 DYVGISLLINATIVSMALLGFNESRYTIMKNTFVTQTSCLT-AYVIILAIKSHPKQGENE 173

Query: 204 E----------------WRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKVQVKWVLL 247
           +                 +  RA LF + GLS ++P+ +G+ +YG K  + K+ +  V+ 
Sbjct: 174 DDNDGTLSEDDDCCCDDHKGTRAKLFASLGLSGLIPVITGLYIYGPKVVYYKINIPMVIA 233

Query: 248 GGVFYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAV 297
             + YI+G L+Y  ++PE+  PG+FD+ G SHQ+FHI +V   +CH  A+
Sbjct: 234 SVLCYIVGTLIYVFKIPEKFYPGRFDLVGSSHQLFHIFIVFGTVCHYHAI 283

>NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {ON}
           Anc_3.90
          Length = 326

 Score =  150 bits (378), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 100/283 (35%), Positives = 156/283 (55%), Gaps = 7/283 (2%)

Query: 31  KRVRRLYSWEEIPDWQKD--NEHIRHGYVRETNSFLGCFDSLFYMHNESVNIYTHLLPGL 88
           +R + L   +E+P WQK   N  I +GYVRETNS + C  ++ Y +N++VNI  + +   
Sbjct: 36  RRPKVLPILKELPQWQKQYSNSKIINGYVRETNSLIKCLHTVTYWNNQTVNIILNTVFST 95

Query: 89  CFFFVVLF--DKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFHCLKTHSLRIAILG 146
            +F ++LF  D   I     TT  DYIMV+ +  GAF    L+S F+ L++HSL    L 
Sbjct: 96  VYFTLLLFFTDLYLIPSSPATTMSDYIMVNFYLFGAFQYFALNSIFYLLESHSLAKCHLW 155

Query: 147 NKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSREWR 206
            KL +L  +  I +S+I+ +YY FFD+  +F   +  TL+     AI +LS+ F  R+ R
Sbjct: 156 FKLSHLAFINYISTSIITQLYYTFFDNVFYFKFLTISTLLISSIFAIFTLSEQFL-RKNR 214

Query: 207 PYRAALFVAFGLS-AVLPIFSGVAVYGFKETWVKVQVKWVLLGGVFYIIGALLYALRLPE 265
             R  + + F +S  +LP  S +  +       +V+ K +LL    Y+    L A+++PE
Sbjct: 215 SQRNMVSITFIVSLLILPTASLMFKFNTFRILRRVEGKAILLELSLYLFSMTLKAVQVPE 274

Query: 266 RISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNSYELVHKKL 308
           R S   FD  G+S  I+HI +++ +L H K +LNSY  +H  L
Sbjct: 275 RFSEN-FDFIGNSENIYHICIILGSLLHFKMLLNSYFFMHSGL 316

>NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90
          Length = 318

 Score =  135 bits (339), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 82/284 (28%), Positives = 156/284 (54%), Gaps = 7/284 (2%)

Query: 28  INKKRVRRLYSWEEIPDWQKD--NEHIRHGYVRETNSFLGCFDSLFYMHNESVNIYTHLL 85
           I+K   R  Y  +E+P+WQ++  +  +  G+++ETNSF  C  S  Y HN S+NI  + +
Sbjct: 25  ISKLSTRNHYKLKELPEWQREFNSGKVITGFLKETNSFKKCLWSTMYWHNSSINISLNGI 84

Query: 86  PGLCFFFVVLF--DKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFHCLKTHSLRIA 143
               +F ++ F  D   I  F +TT  DYI+++L+ L A    ++ + F+ +K+HS + A
Sbjct: 85  AATVYFMLLFFFTDCYLIPSFPSTTMSDYIVLNLYLLTATQNFMVGTIFYIMKSHSKQQA 144

Query: 144 ILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSR 203
            L  KL+ +G++  I SS+++++YY +FD   +F  F+ +TL+       + +SD+F ++
Sbjct: 145 FLWYKLNNIGLINHIASSVVTLLYYHYFDYVFYFKFFTIVTLLLITLFTCSIISDSF-NK 203

Query: 204 EWRPYRAALFVAF-GLSAVLPIFSGVAVYGFKETWVKVQVKWVLLGGVFYIIGALLYALR 262
             R  +  L +A+  L  ++P    +  +G  +   ++ +  ++L    Y  G  +   +
Sbjct: 204 MTRIRKNFLLLAYIILLTLMPSLFAILRFGLAKVLERISLNLIILEIFIYAFGLTIRTSQ 263

Query: 263 LPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNSYELVHK 306
           LPER     FD  G+S  ++ + +++ +  H K ++NSY L+H 
Sbjct: 264 LPERFF-NSFDFLGNSENVYQLSIIVCSFIHFKILMNSYCLMHS 306

>CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {ON}
           similar to uniprot|Q03419 Saccharomyces cerevisiae
           YDR492w
          Length = 301

 Score =  110 bits (274), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 86/296 (29%), Positives = 150/296 (50%), Gaps = 19/296 (6%)

Query: 28  INKKRVR-RLYSWEEIPDWQK--DNEHIRHGYVRETN-SFLGCFDSLFYMHNESVNIYTH 83
           + KK V+ ++ + E++P W +   N  I+ GY   TN ++LGC   L   +N+S++IY +
Sbjct: 1   MEKKTVQSKIVTLEKLPVWYRRYGNSRIKTGYFYYTNATYLGCLQKLVKFNNDSISIYMN 60

Query: 84  LLPGLCFFFVVLF--DKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFHCLKTHSLR 141
           L+ GL    ++LF  D   I    +TT  DYI+++LF +   T     +    LK HS  
Sbjct: 61  LVCGLISGVMLLFYTDVRLIPSHPSTTMTDYIIINLFLMATTTYFATMTLGQLLKGHSEY 120

Query: 142 IAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFR 201
              L N+   L +V L+  S+++++YY FFD    F  F   T +     +I  ++D ++
Sbjct: 121 QGKLWNQAKQLALVLLLTCSIVTLLYYAFFDHVFLFKLFVIWTCLLMSITSIVIINDQYK 180

Query: 202 SREWRPYRAALFVAFG-LSAVLPIFSGVAVYGFKETWVKVQVKWVLLGG--VFYIIGALL 258
               R  + +  V FG LS  LPI   +  +G  +++ K ++ + +L    V Y + A+L
Sbjct: 181 ----RVQKLSCVVIFGVLSISLPIAVSIIKFGLFDSYKKQRIPFQVLTWEIVLYSLSAML 236

Query: 259 YALRLPE-RISPGKFDIW-----GHSHQIFHILVVIAALCHLKAVLNSYELVHKKL 308
              RLPE  +S      W     G+S Q+  ++ + A + H   ++ +YE+VH  +
Sbjct: 237 QLTRLPELTLSTLGDSFWIVDYLGNSDQVSQLVTIFAIIVHFNTIIFAYEVVHASI 292

>Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 93.2 bits (230), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 78/316 (24%), Positives = 145/316 (45%), Gaps = 28/316 (8%)

Query: 1   MEPEPNRRRLQIKRANIVKEETMSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHGYVRET 60
           +E  P + +   ++ N   E T S      K +++ + + ++  WQ   +  R+   R  
Sbjct: 7   VEQSPAKCKTTTEKGNGTGETTNSNVDAETKEIKKGFPFHDLAKWQ---QQYRNKSSR-- 61

Query: 61  NSFLGCFDSLFYMHNESVNIYTHLLPGLCFFFVVLF--DKVAIKVFDTTTFL-DYIMVDL 117
                         NES+    +LL  +  F +++F  D   I +F TTT + DYI+ + 
Sbjct: 62  --------------NESLVALIYLLGSMSSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNF 107

Query: 118 FFLGAFTCLILSSTFHCLKTHSLRIAILG-NKLDYLGIVALIVSSMISIMYYGFFDSGKF 176
           + L  F   ++   +H +K  SL+  +    K  YL  + L++SS I+I+YY F+D   F
Sbjct: 108 YLLNVFVFCMVHFVYHFIKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFF 167

Query: 177 FYGFSTLTLVFGIACAIASLSDTFRSREWRPYRAALFVAFG-LSAVLPIFSGVAVY-GFK 234
           F  F+ L    G+      L+D   S + R  +   F++   +   LP+ + +  + G +
Sbjct: 168 FKIFTLLMNFIGLVAYFFILTDKLNSSK-RFNKTVFFISVSVVCCSLPLLTAIITFDGLE 226

Query: 235 ETWVKVQVKWVLLGGVFYIIGALLYALRLPERI--SPGKFDIWGHSHQIFHILVVIAALC 292
               +++VK +    V  +  +++Y  R PE +     K + W HS  +FH+++   A  
Sbjct: 227 NLKERIKVKAITCELVALVAASIIYVTRFPESLFRRNKKEESWNHSEYLFHLVISGTAFY 286

Query: 293 HLKAVLNSYELVHKKL 308
           H   ++ SY L+H  L
Sbjct: 287 HFFILIQSYILMHSSL 302

>Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 89.4 bits (220), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 75/316 (23%), Positives = 144/316 (45%), Gaps = 28/316 (8%)

Query: 1   MEPEPNRRRLQIKRANIVKEETMSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHGYVRET 60
           +E  P   +   ++ +       S   +  K  ++ + + ++  WQK        Y  ++
Sbjct: 7   VEQSPVEPKTATEKYSDATGAVTSNADVETKETKKGFPFHDLAKWQKQ-------YKNKS 59

Query: 61  NSFLGCFDSLFYMHNESVNIYTHLLPGLCFFFVVLF--DKVAIKVFDTTTFL-DYIMVDL 117
           +             +ES+    +LL  +  F +++F  D   I +F TTT + DYI+ + 
Sbjct: 60  S------------RSESLVALIYLLGSMSSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNF 107

Query: 118 FFLGAFTCLILSSTFHCLKTHSLRIAI-LGNKLDYLGIVALIVSSMISIMYYGFFDSGKF 176
           + L  F   ++   +H +K  SL+  I +  K  YL  + L++SS I+I+YY F+D   F
Sbjct: 108 YLLNVFVFCMIHFIYHFIKNISLQQHIEIWQKFSYLANINLLISSQITILYYLFYDYVFF 167

Query: 177 FYGFSTLTLVFGIACAIASLSDTFRSREWRPYRAALFVAFG-LSAVLPIFSGVAVY-GFK 234
           F  F+ L    G+A     L+D   S + R  +   F++   +   LP+ + +  + G +
Sbjct: 168 FKIFTLLMTFIGLAAYFVILTDKLNSYK-RFNKTVFFISVSVVCCSLPLLTAIITFDGLE 226

Query: 235 ETWVKVQVKWVLLGGVFYIIGALLYALRLPERIS--PGKFDIWGHSHQIFHILVVIAALC 292
               ++++  +    V  ++ +++Y  R PE +     K + W HS   FH+L+   A  
Sbjct: 227 NLKDRIKLNAITWELVTLVVASMIYVTRFPESLCRRNEKEEGWNHSEYFFHLLISGTAFY 286

Query: 293 HLKAVLNSYELVHKKL 308
           H   ++ SY L+H  L
Sbjct: 287 HFFILIQSYILMHSSL 302

>Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 89.0 bits (219), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 80/316 (25%), Positives = 143/316 (45%), Gaps = 28/316 (8%)

Query: 1   MEPEPNRRRLQIKRANIVKEETMSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHGYVRET 60
           +E  P +     ++ N    E  ST     K  ++ + + ++  WQ   E  ++   R  
Sbjct: 7   VEQSPAKCNTTPEKCNNSTAEINSTVGAKTKETKKGFPFHDLAKWQ---EQYKNKSSR-- 61

Query: 61  NSFLGCFDSLFYMHNESVNIYTHLLPGLCFFFVVLF--DKVAIKVFDTTTFL-DYIMVDL 117
                         NESV    +LL  +  F +++F  D   I +F TTT + DYI+ + 
Sbjct: 62  --------------NESVVALIYLLGSMLSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNF 107

Query: 118 FFLGAFTCLILSSTFHCLKTHSLRIAILG-NKLDYLGIVALIVSSMISIMYYGFFDSGKF 176
           + L  F   ++   +H +K  SL+  +    K  YL  + L++SS I+I+YY F+D   F
Sbjct: 108 YLLNVFVFCMVHFIYHFIKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFF 167

Query: 177 FYGFSTLTLVFGIACAIASLSDTFRSREWRPYRAALFVAFG-LSAVLPIFSGVAVY-GFK 234
           F  F+ L    G+      L+D   S + R  +   F++   +   LP+ + +  + G +
Sbjct: 168 FKIFTLLMNFIGLVAYFFILTDKLISSK-RFNKTVFFISVSVICCSLPLLTAIITFDGLE 226

Query: 235 ETWVKVQVKWVLLGGVFYIIGALLYALRLPERISPG--KFDIWGHSHQIFHILVVIAALC 292
               +++V  +    V  +  +++Y  R PE    G  K + W HS  +FH+++  AA  
Sbjct: 227 NLKERIKVNAITWELVALVAASIIYVTRFPELFLRGKKKEEGWNHSEYLFHLIISGAAFY 286

Query: 293 HLKAVLNSYELVHKKL 308
           H   ++ SY L+H  L
Sbjct: 287 HFFILIQSYILMHSSL 302

>YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}
           IZH4Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by fatty acids and altered zinc levels; deletion
           reduces sensitivity to excess zinc; possible role in
           sterol metabolism
          Length = 312

 Score = 80.5 bits (197), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 67/242 (27%), Positives = 119/242 (49%), Gaps = 9/242 (3%)

Query: 75  NESVNIYTHLLPGLCFFFVVLF--DKVAIKVFDTTTFL-DYIMVDLFFLGAFTCLILSST 131
           NES+    +LL  +  F +++F  D   I +F TTT + DYI+ + + L  F   ++   
Sbjct: 62  NESLVALIYLLGSMLSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHFI 121

Query: 132 FHCLKTHSLRIAILG-NKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIA 190
           +H +K  SL+  +    K  YL  + L++SS I+I+YY F+D   FF  F+ L    G+ 
Sbjct: 122 YHFVKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGLV 181

Query: 191 CAIASLSDTFRSREWRPYRAALFVAFG-LSAVLPIFSGVAVY-GFKETWVKVQVKWVLLG 248
                L+D   S + R  +   F++   +   LP+ + +  + G +    +++V  +   
Sbjct: 182 AYFFILTDKLISSK-RFNKTVFFISVSVVCCSLPLLTAIITFDGLENLKERIKVNAITWE 240

Query: 249 GVFYIIGALLYALRLPERI--SPGKFDIWGHSHQIFHILVVIAALCHLKAVLNSYELVHK 306
            V  +  +++Y  R PE +     K + W HS  +FH+L+   A  H   ++ SY L+H 
Sbjct: 241 LVALVAASIIYVTRFPESLFRRNKKEEGWNHSEYLFHLLISGTAFYHFFILIQSYILMHS 300

Query: 307 KL 308
            L
Sbjct: 301 SL 302

>TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {ON}
           Anc_5.197 YLR023C
          Length = 569

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 84/292 (28%), Positives = 130/292 (44%), Gaps = 41/292 (14%)

Query: 2   EPEPNRRRLQIKRANIVKEETMSTGTINKKRV------------RRLYSWEEIPDWQKDN 49
           E E   R+L++    I+K+E +++  I    +             R   + E+P   ++N
Sbjct: 201 EQEECLRKLRV----ILKKEELTSTDIRNYNIAFNHDVAFDLGKERHLHYYELPFPWREN 256

Query: 50  EHIRHGYVRETNSFLGCFDSLFY---MHNESVNIYTHLLPG--LCFFFVVLFDKVAI--- 101
           ++I HGY R  + F     S+F    +HNE+ NI+TH+L    L +   V F K  I   
Sbjct: 257 KYIIHGY-RFHDKFYQLILSVFNWYGVHNETTNIWTHMLAAFYLIYLLTVDFQKTFIVLD 315

Query: 102 --KVFDTTTFLDYIMVDLFFLGA-FTCLILSSTFHCLK-THSLRIAILGNKLDYLGIVAL 157
              V  TT ++ Y+     FLGA   C+  S  +H    T S+R+      +DY GI  L
Sbjct: 316 TEHVPATTKYIIYM-----FLGAGIKCMFASVFWHTFNGTTSIRLRPKFCCVDYTGITLL 370

Query: 158 IVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYRAALFVAFG 217
           I +S++S  Y   +D  K    +  L+ +F +     + S  F S E RP R   FV   
Sbjct: 371 ISASIMSAEYITLYDYPKAMSFYMILSGIFAVFGLYLNWSPKFDSPEARPLRIKFFVLLA 430

Query: 218 LSAVLPIFSGVAVYGF-KETWV--KVQVKWVLLGGVFYIIGALLYALRLPER 266
               L   + V + G  +  W+   V  K V    ++YIIG   Y   +PER
Sbjct: 431 AVGGLSFVNLVCLEGLSRAIWLFSPVTNKSV----IYYIIGVFFYGSFIPER 478

>KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5.197
           YLR023C
          Length = 509

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 59/232 (25%), Positives = 107/232 (46%), Gaps = 10/232 (4%)

Query: 41  EIPDWQKDNEHIRHGYVRETNSFLGCFDSLFYMHNESVNIYTHLLPGLCFFFVVLFDKVA 100
           ++P   ++N +I + Y R  +S      S+F +HNE+ NI++HLL G  +F  VLF  + 
Sbjct: 197 QLPFPYRENRYIINNY-RFYDSHKKSLLSIFKLHNEATNIWSHLL-GAIYFLYVLFHDLP 254

Query: 101 IKVFDTTTFLDY---IMVDLFFLGAFTCLILSSTFHCLK-THSLRIAILGNKLDYLGIVA 156
             +  +++ +     + + LF   +  C++ S+ +H    T  L++      +DY GI  
Sbjct: 255 NSIIVSSSMVPTTAKLFLYLFVFASLKCMLSSTFYHTFNGTSMLKLRRKFMCVDYSGISI 314

Query: 157 LIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYRAALFVAF 216
           LI SS++SI +   +D       +   + + G+     + S  F S E RP R   F+  
Sbjct: 315 LITSSILSIQFISLYDYPNILKFYMCASFMLGVLGIFMNWSPLFDSPEARPLRIKFFILL 374

Query: 217 GLSAVLPIFSGVAVYGFKETWVKVQVKWVLLGG--VFYIIGALLYALRLPER 266
                  +     V+  K  +  + V   L     V+Y++G + Y   +PER
Sbjct: 375 SSCGAFALLH--LVFLEKSIFAAIDVLLPLTNKSIVWYLVGVVFYGSFIPER 424

>KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some
           similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 622

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 75/292 (25%), Positives = 130/292 (44%), Gaps = 36/292 (12%)

Query: 32  RVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLGCFDSL---FYMHNESVNIYTHLLPGL 88
           R R L+ +E +P   ++N +I HGY R  +S +    S+   +  HNE++NI++HL   +
Sbjct: 295 RQRHLHFYE-LPFPWRENRYIIHGY-RFYDSHVKSVLSVVNWYGWHNETLNIWSHLFGAV 352

Query: 89  CFFFVVLFDKVAIKVF--DTTTFLDYIMVDLFFLGAFTCLILSSTFHCLK-THSLRIAIL 145
              +++       KVF          +++ +F +    CL+ SS +H L  T  L +   
Sbjct: 353 YLAYLLFIQLPTTKVFMSQDVPLFGKLIIQVFLIAGVKCLLSSSVWHTLNGTCCLPLRCK 412

Query: 146 GNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFS-----TLTLVFGIACAIASLSDTF 200
              +DY GI  LI +S++S  +   ++        S     +L+L  GI  +  + S  F
Sbjct: 413 FACIDYTGITVLITASILSTEFVSVYNLATQSLSTSMTVYMSLSLCLGIFGSFMNWSPRF 472

Query: 201 RSREWRPYRAALFVAF-GLSAV----LPIFSGV--AVYGFKETWVKVQVKWVLLGGVFYI 253
              E RP+R A +V   GL  +    L I  G+  +   FK  W +          ++Y+
Sbjct: 473 DRPESRPFRIAFYVLLAGLGMISFLHLTISRGIDHSSQFFKPVWNR--------SLIWYL 524

Query: 254 IGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNSYELVH 305
           IG + Y   +PER        W    ++ + +   A LC    +L  ++ VH
Sbjct: 525 IGVVFYGSFIPER--------WRTDVELDYTIPTDAELCSNLDILTKHKHVH 568

>Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON}
           (229517..231250) [1734 nt, 578 aa]
          Length = 577

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/234 (26%), Positives = 108/234 (46%), Gaps = 12/234 (5%)

Query: 41  EIPDWQKDNEHIRHGYV---RETNSFLGCFDSLFYMHNESVNIYTHLLPGLCFFFVVLFD 97
           ++P   ++N +I +GY    + +   L  F+  +  HNE+ NI++HLL  + F ++VLF+
Sbjct: 255 QLPFPWRENRYIINGYRFYHKNSKLLLSVFN-WYGFHNETANIWSHLLGAIYFAYIVLFE 313

Query: 98  ---KVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFHCLK-THSLRIAILGNKLDYLG 153
                 ++  +      YI V LF L    C++ S  +H    T S+++      +DY G
Sbjct: 314 FPKSFIVQSPEVPPSAKYI-VYLFLLAGIKCMLASVFWHTFNGTCSIKLRPKYCCVDYSG 372

Query: 154 IVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYRAALF 213
           I  LI +S+++  +   +D       + +L+L+FG      + S  F S E RP R   F
Sbjct: 373 ITILITASILTAEFVSLYDHRSIMTVYMSLSLLFGCFGLYLNWSPKFDSPEARPLRIKFF 432

Query: 214 VAFGLSAVLPIFSGVAVYGFK-ETWVKVQVKWVLLGGVFYIIGALLYALRLPER 266
           +       L  F    + G     W+   V    +  V+Y+IG   Y   +PER
Sbjct: 433 ILLAALGGLAFFHVAYLEGMAYAAWLYSPVTSKSI--VWYLIGVFFYGSFIPER 484

>SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]
           {ON} some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 563

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 69/254 (27%), Positives = 110/254 (43%), Gaps = 22/254 (8%)

Query: 30  KKRVRRLYSWEEIPDWQKDNEHIRHGYV---RETNSFLGCFDSLFYMHNESVNIYTHLLP 86
           K  + R   + E+P   ++N  I HGY      T S L   +  +  HNE+ NI+THL  
Sbjct: 225 KTGLSRHLHYYELPFPWRENRFIIHGYRFYHSHTKSLLSILN-WYGWHNETTNIWTHLFG 283

Query: 87  GLCFFFVVLFDKVAIKVF---DTTTFLDYIMVDLFFLGAFTCLILSSTFHCLK-THSLRI 142
            L   ++  ++     V+   D   F  Y MV LF    F CL+ S T+H    T  L +
Sbjct: 284 SLYIAYLAFYEFPQSSVYLSGDVPQFAKY-MVYLFLGAGFKCLVSSVTWHTFNGTCKLHL 342

Query: 143 AILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACA--------IA 194
                 +DY GI  LI +S+++  +   + +G       T +L+F +A +          
Sbjct: 343 RSKFACMDYTGITVLITASIMTAEFVSLYGNGDNPNSPVTFSLIFYMAVSSVLCCFGVFM 402

Query: 195 SLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGF-KETWVKVQVKWVLLGGV-FY 252
           + S  F   E RP R A ++       L       +  F   +W+   ++ VL   V +Y
Sbjct: 403 NWSPRFDRPESRPLRIAFYLLLAGMGFLAFLHLTLITNFAHSSWL---IRPVLDKSVCWY 459

Query: 253 IIGALLYALRLPER 266
           +IG + Y   +PER
Sbjct: 460 LIGVIFYGSFIPER 473

>NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.197
           YLR023C
          Length = 543

 Score = 68.2 bits (165), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 105/233 (45%), Gaps = 10/233 (4%)

Query: 41  EIPDWQKDNEHIRHGYV---RETNSFLGCFDSLFYMHNESVNIYTHLLPGLCFFFVVLFD 97
           ++P   ++N +I + Y        S L  F+  +  HNE+ NI+THL+ GL   ++ ++D
Sbjct: 220 QLPFPWRENRYIIYNYRFYDSHKKSLLSIFN-WYGWHNETSNIWTHLIGGLYLIYMAVYD 278

Query: 98  KVAIKVF--DTTTFLDYIMVDLFFLGAFTCLILSSTFHCLK-THSLRIAILGNKLDYLGI 154
               ++F  D       ++V LF   A  CL  S  +H    T +L++      +DY GI
Sbjct: 279 FPRSEIFLSDKIPTTAKLIVYLFLFAAIKCLFASVFWHSFNGTCTLKLRSKFACVDYSGI 338

Query: 155 VALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYRAALFV 214
             LI +S+++  +   + S +    +  ++L  GI     + S  F   E RP R   FV
Sbjct: 339 SILITASILTTEFVTLYSSYRAMCVYMAISLSLGIFGVFMNWSPKFDRPEARPLRIKFFV 398

Query: 215 AFGLSAVLPIFSGVAVYGFK-ETWVKVQVKWVLLGGVFYIIGALLYALRLPER 266
                 VL       +  +K  TW+   V    +  V+Y IG + Y   +PER
Sbjct: 399 LLASMGVLSFLHLTFLTDWKYATWLLAPVTNKSI--VWYCIGVVFYGSFIPER 449

>AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR023C
          Length = 419

 Score = 64.7 bits (156), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 76/325 (23%), Positives = 131/325 (40%), Gaps = 68/325 (20%)

Query: 33  VRRLYSWEEIPDWQKDNEHIRHG---YVRETNSFLGCFDSLFYMHNESVNIYTHLLPGLC 89
            R L+ WE +P   ++N +I +G   Y     S L   ++ +  HNE++NI++HL+    
Sbjct: 102 ARHLHYWE-LPYAWRENRYIIYGHRFYHSHRKSLLSVLNA-YGWHNETINIWSHLVGAAV 159

Query: 90  FFFVVLFDKVAIKVFDTTTF--LDYIMVDLFFLGAFTCLILSSTFHCLK-THSLRIAILG 146
             +++ +      V+       L    +  F      C+  S  +H    T  L++    
Sbjct: 160 LAYLLCWGWPRSDVYRAAQVPRLAKWAIGAFLACGVKCMASSVAWHTFNGTCHLKLRSRF 219

Query: 147 NKLDYLGIVALIVSSMIS---IMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSR 203
             +DY GI  L+ +S+++   +  YG   S    Y +   ++  G A  + + S  F   
Sbjct: 220 VCVDYTGITLLVTASVVTTVAVTLYGL--SRPLMYAYMVASIGLGTAAGVMNWSPHFDRP 277

Query: 204 EWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKVQVKW---------VLLGGVFYII 254
           E RP R A++V  GL+A       + +  F   W  +QV+W         V    V+Y I
Sbjct: 278 EARPLRIAVYV--GLAA-------LGLVSFVHVW--MQVRWASAHLMAPLVYKSLVWYGI 326

Query: 255 GALLYALRLPER---------------------------ISPGKFDIWG--------HSH 279
           G + YA  +PER                           ++      W         HSH
Sbjct: 327 GVVFYATLVPERWRSDVTLDCCSGPVHEAACRQFRDLPPVARKDRQFWSLWWVDYFCHSH 386

Query: 280 QIFHILVVIAALCHLKAVLNSYELV 304
            ++H+ VV+  + H +AVL    +V
Sbjct: 387 FLWHVFVVLGVVGHYRAVLQMSRIV 411

>KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.197
           YLR023C
          Length = 538

 Score = 62.8 bits (151), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 76/326 (23%), Positives = 124/326 (38%), Gaps = 66/326 (20%)

Query: 34  RRLYSWEEIPDWQKDNEHIRHGYV---RETNSFLGCFDSLFYMHNESVNIYTHLLPGLCF 90
            +L  + E+P   ++N +I H Y        S L   +  +  HNE+ NI++H    L F
Sbjct: 214 EKLLHYYELPFPWRENRYIIHNYRFYDSNVKSLLSAIN-WYGWHNETSNIWSHF---LGF 269

Query: 91  FFVVL-----FDKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFHCLK-THSLRIAI 144
           F+VV      F +  +   D        +V +F   A  CLI S+ +H    T  L++  
Sbjct: 270 FYVVYLAVYEFPQSVVFQSDRIPSSAKFVVYIFLFAAMKCLIASAFWHTFNGTAFLKMRR 329

Query: 145 LGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSRE 204
               +DY GI  LI +S+++  +    D       + T++L  GI     + S  F + E
Sbjct: 330 RFACVDYSGISILITASILTAEFVTLNDHRPMMILYMTISLTLGIIGVFLNCSPQFDTPE 389

Query: 205 WRPYRAALFVAFGLSAVLPIFSGVAVYGFKETW---VKVQVKWVLLGGVFYIIGALLYAL 261
            RP R   F+      VL   +      + E+W   V +         V+Y++G + Y  
Sbjct: 390 ARPLRIRFFMLLAAMGVLSFINA----SYLESWAYAVDLLSPITNKSIVWYLVGVVFYGS 445

Query: 262 RLPERI-----------------------------------------SPGKFDIW----- 275
            +PER                                            G F  W     
Sbjct: 446 FIPERFRTDVVVDDRIPTTFQLGTDLDIITKDKEIHFRHKPTCCHHPRKGIFSCWWVDYV 505

Query: 276 GHSHQIFHILVVIAALCHLKAVLNSY 301
           G SH  +HI VV+  + H KA+++ +
Sbjct: 506 GCSHTFWHIFVVLGVVGHYKAIIDMF 531

>NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197
          Length = 578

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 59/233 (25%), Positives = 103/233 (44%), Gaps = 10/233 (4%)

Query: 41  EIPDWQKDNEHIRHGYV---RETNSFLGCFDSLFYMHNESVNIYTHLLPGLCFFFVVLFD 97
           ++P   ++N +I + Y        S L  F+  +  HNES NI+THLL  +   ++ ++D
Sbjct: 254 QLPFPWRENRYIIYNYRFYDSHKKSLLSIFN-WYGWHNESSNIWTHLLGAIYLIYLSIYD 312

Query: 98  KVAIKVFDTTTF--LDYIMVDLFFLGAFTCLILSSTFHCLK-THSLRIAILGNKLDYLGI 154
               ++F +        ++V LF   A  CL+ S  +H    T  L++      +DY GI
Sbjct: 313 FPNSEIFQSEKVPTTAKLIVYLFLFAAIKCLLASVFWHTFNGTSFLKLRSKFACVDYSGI 372

Query: 155 VALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYRAALFV 214
             LI +S+++  +   + S      + T++L  G+     + S  F   E RP R   F+
Sbjct: 373 TILITASILTTEFVTMYSSFFAMCIYMTISLSLGMFGVFMNWSPKFDRPEARPLRIKFFI 432

Query: 215 AFGLSAVLPIFSGVAVYGFK-ETWVKVQVKWVLLGGVFYIIGALLYALRLPER 266
                 VL       +   +  TW+   V       V+Y++G + Y   +PER
Sbjct: 433 LLASMGVLSFLHLTYLTNLQYATWLLTPV--TNKSIVWYLVGVVFYGSFIPER 483

>TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {ON}
           Anc_5.197 YLR023C
          Length = 450

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 63/236 (26%), Positives = 107/236 (45%), Gaps = 16/236 (6%)

Query: 41  EIPDWQKDNEHIRHGYVRETNSFLGCFDSL---FYMHNESVNIYTHLLPGLCFFFVVLFD 97
           ++P   ++N  I HGY R  +S      S+   +  HNE+ NI+THL   L   ++ ++D
Sbjct: 136 QLPFPWRENRFIIHGY-RFYDSHYKSLLSIVNWYGWHNETANIWTHLGGALYVLWLAVYD 194

Query: 98  KVAIKVFDTTT--FLDYIMVDLFFLGAFTCLILSSTFHCLK-THSLRIAILGNKLDYLGI 154
                V+++     +   +V +F   A  C++ S   H    T  L +      +DY GI
Sbjct: 195 FPRTSVWESEQVPMVAKCIVYVFLAAALKCMLASVFGHTFNGTCCLALRSKFACVDYSGI 254

Query: 155 VALIVSSMIS---IMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYRAA 211
             LI +S+++   +  Y +  S +F+   ST+  +FG+   I + S  F   E RP R  
Sbjct: 255 TMLITASILTTEFVTMYNYPWSLRFYLAVSTVLGIFGV---IMNWSPKFDRPEARPLRIK 311

Query: 212 LFVAFGLSAVLPIFSGVAVYGFK-ETWVKVQVKWVLLGGVFYIIGALLYALRLPER 266
            F+       L       + G+K  +W+   V    L  V+Y++G   Y   +PER
Sbjct: 312 FFILLAAMGGLSFMQLGLLGGWKYASWLMAPVTHKSL--VWYLLGVAFYGSFVPER 365

>YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON}
           IZH3Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by zinc deficiency; deletion reduces sensitivity
           to elevated zinc and shortens lag phase, overexpression
           reduces Zap1p activity
          Length = 543

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 105/235 (44%), Gaps = 14/235 (5%)

Query: 41  EIPDWQKDNEHIRHGYV---RETNSFLGCFDSLFYMHNESVNIYTHLLPGLCFFFVVLFD 97
           ++P   ++N +I HGY      + S L  F+  +  HNE+ NI++HLL  +   ++ ++D
Sbjct: 220 QLPFPWRENRYIIHGYRFYNTHSKSLLSIFN-WYGWHNETSNIWSHLLGAIYIIYLAIYD 278

Query: 98  KVAIKVFDTTTFLDYI--MVDLFFLGAFTCLILSSTFHCLKTHS-LRIAILGNKLDYLGI 154
               +V+  +        +V +F   A  C++ S  +H     S L++      +DY GI
Sbjct: 279 FPQSEVWRNSQVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVDYSGI 338

Query: 155 VALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYRAALFV 214
             LI +S+++  +   +      Y + +++L  G+     + S  F   E RP R   F+
Sbjct: 339 TILITASILTTEFVTMYSCYWAMYTYMSISLALGVFGVFMNWSPRFDRPEARPLRIRFFI 398

Query: 215 AFGLSAVLPIFSGV---AVYGFKETWVKVQVKWVLLGGVFYIIGALLYALRLPER 266
                 VL     +    ++     +  V  K V    V+Y++G + Y   +PER
Sbjct: 399 LLATMGVLSFLHLIFLTDLHYAATLFSPVTYKSV----VWYLVGVVFYGSFIPER 449

>Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 101/235 (42%), Gaps = 14/235 (5%)

Query: 41  EIPDWQKDNEHIRHGYV---RETNSFLGCFDSLFYMHNESVNIYTHLLPGLCFFFVVLFD 97
           ++P   ++N +I HGY      + S L   +  +  HNE+ NI++HLL  +   ++ ++D
Sbjct: 219 QLPFPWRENRYIIHGYRFYNTHSKSLLSIIN-WYGWHNETSNIWSHLLGAMYIIYLAIYD 277

Query: 98  KVAIKVFDTTTFLDYI--MVDLFFLGAFTCLILSSTFHCLKTHS-LRIAILGNKLDYLGI 154
               +V+           +V +F   A  C++ S  +H     S LR+      +DY GI
Sbjct: 278 FPQSEVWRNPNVPQQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLRLRSKFACVDYSGI 337

Query: 155 VALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYRAALFV 214
             LI +S+++  +   +        +  ++L  G+     + S  F   E RP R   F+
Sbjct: 338 TILITASILTTEFVTMYSCYWAMCTYMGISLALGVIGVFMNWSPRFDRPEARPLRIRFFI 397

Query: 215 AFGLSAVLPIFSGV---AVYGFKETWVKVQVKWVLLGGVFYIIGALLYALRLPER 266
                 VL     +    +Y     +  V  K V    V+Y++G + Y   +PER
Sbjct: 398 LLATMGVLSFLHLIFLTDIYYASRLFGPVTYKSV----VWYLVGVVFYGSFIPER 448

>TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON}
           Anc_5.197 YLR023C
          Length = 437

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 68/328 (20%), Positives = 127/328 (38%), Gaps = 62/328 (18%)

Query: 29  NKKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLGCFDSL---FYMHNESVNIYTHLL 85
           N  R      + ++P   ++N +I  GY R  +S + C  S+   +  HNE++NI++HL 
Sbjct: 106 NLGRSNNTLHYYQLPFPWRENRYIIKGY-RFYDSNVKCLLSVVNYYGWHNETLNIWSHLG 164

Query: 86  PGLCFFFVVLFDKVAIKVFDTTTF--LDYIMVDLFFLGAFTCLILSSTFHCLK---THSL 140
             L   ++ +F     +V+ +        +++ +F +    C++ S  +H      +++L
Sbjct: 165 GFLTLLYIAVFVYPNTEVYQSELIPTTAKMLLFVFLIAGMKCMLASVFWHTFDGTCSYTL 224

Query: 141 RIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTF 200
           R       +DY GI  LI +S+++  Y     +  + + + +L+L  G      + S  F
Sbjct: 225 RPKFCC--VDYTGITILITASILTAEYVSLSHAPIWMFIYMSLSLALGTFGVYINWSPKF 282

Query: 201 RSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKET-WVKVQVKWVLLGGVFYIIGALLY 259
              E RP R   FV       L     +     +   W+   +  +    ++Y+IG   Y
Sbjct: 283 DGPEARPLRIKFFVTLSAMGCLSFVHLIFTTSLRHACWLLAPI--ISKSTIWYVIGVFFY 340

Query: 260 ALRLPERI-----------------------------------SPGK------------- 271
              +PE+                                    +P K             
Sbjct: 341 GSFIPEKYRSDYILDKTIPTSKQLSCDLSIITKDRHIHFRDQPTPNKNGPRKTGLRSLWW 400

Query: 272 FDIWGHSHQIFHILVVIAALCHLKAVLN 299
            D  G SH I+HI V++  + H KA L+
Sbjct: 401 VDYVGQSHTIWHIFVLLGVVGHYKACLD 428

>Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}
           similar to Ashbya gossypii AAL153C
          Length = 568

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 60/250 (24%), Positives = 113/250 (45%), Gaps = 26/250 (10%)

Query: 32  RVRRLYSWEEIPDWQKDNEHIRHG---YVRETNSFLGCFDSLFYMHNESVNIYTHLLPGL 88
           R R L+ + E+P   ++N +I +G   Y     S L   + ++  HNE++NI++H+   +
Sbjct: 236 RARHLH-YYELPQPWRENPYIIYGHRFYHSHKKSLLSILN-VYGWHNETINIWSHIAGAI 293

Query: 89  CFFFVVLFDKVAIKVFDTTTFLDYI--MVDLFFLGAFTCLILSSTFHCLK-THSLRIAIL 145
              +++L       VF++T         + +F L    C++ S  +H    T  L +   
Sbjct: 294 ILLYIMLRGFPNSDVFNSTQVPKVAKGAIYVFLLCGIKCMVSSVMWHTFSGTCHLPLRSR 353

Query: 146 GNKLDYLGIVALIVSSMISIMYYGFFD-SGKFFYGFSTLTLVFGIACAIASLSDTFRSRE 204
            + +DY GI  LI +S+++   +  +  + K  Y +  ++L  G+  A  + S  F   +
Sbjct: 354 FSCVDYTGITILITASVMTTEAFTLYRLAPKAMYLYMGISLCLGVFAAFTNWSRRFDGPD 413

Query: 205 WRPYRAALFVAFGLSAVLPIFSGVAVYGF-----KETWVKVQVKWVLLGG---VFYIIGA 256
            R +R A +V         I +G+ +  F        W   ++    L     V+Y+IG 
Sbjct: 414 SRIFRVAFYV---------ILAGLGLISFVHLTVHSDWSSSRLMITPLINKSIVWYLIGV 464

Query: 257 LLYALRLPER 266
           + YA  +PER
Sbjct: 465 VFYATLVPER 474

>Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 101/235 (42%), Gaps = 14/235 (5%)

Query: 41  EIPDWQKDNEHIRHGYV---RETNSFLGCFDSLFYMHNESVNIYTHLLPGLCFFFVVLFD 97
           ++P   ++N +I HGY      + S L  F+  +  HNE+ NI++HLL  +   ++ ++D
Sbjct: 219 QLPFPWRENRYIIHGYRFYNTHSKSLLSIFN-WYGWHNETSNIWSHLLGAMYLIYLAIYD 277

Query: 98  KVAIKVFDTTTFLDYI--MVDLFFLGAFTCLILSSTFHCLKTHS-LRIAILGNKLDYLGI 154
               +V+           +V +F   A  C++ S  +H     S L++      +DY GI
Sbjct: 278 FPQSEVWKNPKVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVDYSGI 337

Query: 155 VALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYRAALFV 214
             LI +S+++  +   +        +  ++L  GI     + S  F   E RP R   F+
Sbjct: 338 TILITASILTTEFVTMYSCYWAMCTYMGISLALGIFGVFMNWSPRFDRPEARPLRIRFFI 397

Query: 215 AFGLSAVLPIFSGVAVYGFK---ETWVKVQVKWVLLGGVFYIIGALLYALRLPER 266
                 VL     + +   +     +  V  K V    V+Y++G   Y   +PER
Sbjct: 398 LLATMGVLSFLHLIFLTDLRYAARLFSPVTYKSV----VWYLVGVAFYGSFIPER 448

>KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 546

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 100/243 (41%), Gaps = 25/243 (10%)

Query: 41  EIPDWQKDNEHIRHGYVRETNSFLGCFDSLFYM---HNESVNIYTHLLPGLCFFFVVL-- 95
           E+P   ++N  I HGY R  NS+     S+F     HNE+VNI+THL   L F F++   
Sbjct: 219 ELPFPWRENRFIIHGY-RFYNSYSKSLLSIFNWYGWHNETVNIWTHLCGALYFAFLIFKG 277

Query: 96  FDKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFHCLKTHSLRIAILGNK-----LD 150
           F +  +   +        M  +F      C + S  +H        I  L  +     +D
Sbjct: 278 FSQTTVYQSELVPTAAKFMAFVFLTAGLECFLFSVVWHTFNG----ICHLKQRSNCACVD 333

Query: 151 YLGIVALIVSSMISIMYYGFFDSGKFFYGFSTL-----TLVFGIACAIASLSDTFRSREW 205
           Y GI  L+ +S+++  +     S    + +S L     +   G      + S  F   E 
Sbjct: 334 YTGITVLVTASILTTEFVTLSGSSDATFTWSLLFFTGASAALGAVGVFMNWSPKFDRPES 393

Query: 206 RPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKVQ-VKWVLLGGV-FYIIGALLYALRL 263
           RP R A ++   L A    FS +    F         +K V +  + +YIIG + Y   +
Sbjct: 394 RPLRIAFYL---LLASFGFFSYLHSRLFNTAVDSSDLIKPVFMKSLAWYIIGVVFYGTFI 450

Query: 264 PER 266
           PER
Sbjct: 451 PER 453

>Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023C -
           Hypothetical ORF [contig 94] FULL
          Length = 566

 Score = 55.5 bits (132), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 63/243 (25%), Positives = 106/243 (43%), Gaps = 25/243 (10%)

Query: 41  EIPDWQKDNEHIRHGYVRETNSFLGCFDSLFYM---HNESVNIYTHLLPGLCFFFVVL-- 95
           E+P   ++N  I HGY R  NS+     S+F     HNE+VNI+THL   L   +++   
Sbjct: 239 ELPFPWRENRFIIHGY-RFYNSYKKSLLSIFNWYGWHNETVNIWTHLGGALYLAYLLFRG 297

Query: 96  FDKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFHCLKTHSLRIAILGNK-----LD 150
           F + A+   +        M  +F L    C + S  +H        I  L  +     +D
Sbjct: 298 FSQTAVYQSELVPTAAKCMAFVFLLSGLECFLFSVVWHTFNG----ICHLQQRSNCACVD 353

Query: 151 YLGIVALIVSSMISIMYYGFFDSGKFFYG-----FSTLTLVFGIACAIASLSDTFRSREW 205
           Y GI  L+ +S+++  +     + +  +      F+T + + G+     + S  F   E 
Sbjct: 354 YTGITILVTASILTTEFVTLSGAAEAPFTWSLLFFTTTSSILGVIGVYMNWSPKFDRPES 413

Query: 206 RPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKVQ-VKWVLLGGV-FYIIGALLYALRL 263
           RP R A ++   L A    FS +    F  +    + +K VL   + +Y+IG + Y   +
Sbjct: 414 RPLRIAFYL---LLASFGFFSYLHSRIFHTSISSSELIKPVLSKSLAWYLIGVVFYGTFI 470

Query: 264 PER 266
           PER
Sbjct: 471 PER 473

>ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 531

 Score = 55.1 bits (131), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 60/232 (25%), Positives = 97/232 (41%), Gaps = 8/232 (3%)

Query: 41  EIPDWQKDNEHIRHGY---VRETNSFLGCFDSLFYMHNESVNIYTHLLPGLCFFFVVL-- 95
           ++P   ++N++I HGY        SFL   +  +  HNE+ NI+THLL GL   ++    
Sbjct: 209 QLPFPYRENKYIIHGYRFYASHKKSFLSIIN-WYGWHNETSNIWTHLLGGLYLIYLAFYH 267

Query: 96  FDKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFHCLK-THSLRIAILGNKLDYLGI 154
           F    I + D        +V +F   A  C+  S  +H    TH LR+      +DY GI
Sbjct: 268 FPHSNIWLSDRVPKPAKCIVAVFLAAAIKCMFASVFWHTFNGTHLLRLRSKFACVDYTGI 327

Query: 155 VALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYRAALFV 214
             LI +S++++ +   +D       +   +L  GI     + S  F   E RP R   F+
Sbjct: 328 TILITASILTVEFVTMYDYKISLLFYMICSLALGIIGVSMNWSPKFDRPEARPLRIKFFI 387

Query: 215 AFGLSAVLPIFSGVAVYGFKETWVKVQVKWVLLGGVFYIIGALLYALRLPER 266
                        V +  ++     +         V+Y+IG   Y   +PER
Sbjct: 388 LLATVGCSSFIRLVFLTNWRYA-ADLLTPLTNKSVVWYLIGVFFYGSFIPER 438

>Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {ON}
           YLR023C (REAL)
          Length = 541

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 56/233 (24%), Positives = 99/233 (42%), Gaps = 10/233 (4%)

Query: 41  EIPDWQKDNEHIRHGYVRETNSFLGCFDSL---FYMHNESVNIYTHLLPGLCFFFVVLFD 97
           ++P   ++N +I HGY R  N+      S+   +  HNE+ NI+THLL  +   ++ ++D
Sbjct: 219 QLPFPWRENRYIIHGY-RFYNTHYKSLLSVINWYGWHNETSNIWTHLLGAMYIVYLAVYD 277

Query: 98  KVAIKVFDTTTFLDYI--MVDLFFLGAFTCLILSSTFHCLKTHS-LRIAILGNKLDYLGI 154
               +V+           +V  F   A  C++ S  +H     S L +      +DY GI
Sbjct: 278 FPHSEVWQNPEVPQQARWIVFAFLAAALKCMLSSVFWHTFNGTSFLGLRSKFACVDYSGI 337

Query: 155 VALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYRAALFV 214
             LI +S+++  +   +        + T++L  G+     + S  F   E RP R   F+
Sbjct: 338 TILITASILTTEFVTMYSCYWAMCTYMTISLALGVFGVFMNWSPRFDRPEARPLRIRFFI 397

Query: 215 AFGLSAVLPIFSGVAVYGFK-ETWVKVQVKWVLLGGVFYIIGALLYALRLPER 266
                 VL     + +       W+   V       V+Y++G + Y   +PER
Sbjct: 398 LLATMGVLSFLHLIFLTDLHYAIWLFSPV--TNKSVVWYLVGVVFYGSFIPER 448

>CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q07959 Saccharomyces cerevisiae
           YLR023c
          Length = 545

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 62/242 (25%), Positives = 106/242 (43%), Gaps = 11/242 (4%)

Query: 32  RVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLGCFDSL---FYMHNESVNIYTHLLPGL 88
           +VR L+ + E+P   ++N  I +GY R  NS      S+   +  HNE+ NI+THLL GL
Sbjct: 210 KVRHLH-YYELPFPWRENRCIINGY-RFYNSHKKSLLSIVNWYGWHNETSNIWTHLLGGL 267

Query: 89  CFFFVVLFDKVAIKVF--DTTTFLDYIMVDLFFLGAFTCLILSSTFHCLK-THSLRIAIL 145
              +++ +   + +VF  +       ++  +F + A  CL  S  +H    T  LR+   
Sbjct: 268 YILYLMFYQFPSSEVFMSEQVPKAAKLITYVFLIAAAKCLFSSVFWHTFNGTSLLRLRCK 327

Query: 146 GNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSREW 205
              +DY GI  LI +S+++  +   +        +  L+   GI     + S  F   E 
Sbjct: 328 FACVDYSGISILITASILTTEFVTMYQCPWAMVSYMALSTALGIFGVFMNWSPKFDRPEA 387

Query: 206 RPYRAALFVAFGLSAVLPIFSGVAVYGFKE-TWVKVQVKWVLLGGVFYIIGALLYALRLP 264
           RP R   F+      +L       +      TW+   +       V+Y++G + Y   +P
Sbjct: 388 RPLRIKFFILLASMGILSFLHLTFITSLSHSTWLLSPI--TKKSVVWYLVGVVFYGSFIP 445

Query: 265 ER 266
           ER
Sbjct: 446 ER 447

>KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {ON} 
          Length = 321

 Score = 34.3 bits (77), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 22/103 (21%), Positives = 49/103 (47%), Gaps = 10/103 (9%)

Query: 106 TTTFLDYIMVDLFFLGAFTCLILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISI 165
           +TT  DY+++++F   AF C        C  T +      G+ L  + ++     S +++
Sbjct: 124 STTMTDYVLLNVFLATAFQCAAC-HMVQCFTTTA------GSVLSTITMLNHWACSAVTL 176

Query: 166 MYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRS---REW 205
           +YY ++D+  +F   +  T  + +  A  +++ T  +   R+W
Sbjct: 177 LYYSYYDNVFYFKLLALFTANWTLVVAAVTVTSTASNSPKRQW 219

>SAKL0C01210g Chr3 complement(107136..108656) [1521 bp, 506 aa] {ON}
           similar to uniprot|P25568 Saccharomyces cerevisiae
           YCL038C ATG22 Protein required for the breakdown of
           autophagic vesicles in the vacuole during autophagy
           putative integral membrane protein that localizes to
           vacuolar membranes and punctate structures attached to
           the vacuole
          Length = 506

 Score = 33.5 bits (75), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 39/81 (48%)

Query: 49  NEHIRHGYVRETNSFLGCFDSLFYMHNESVNIYTHLLPGLCFFFVVLFDKVAIKVFDTTT 108
           ++H R     +    LG FD+L ++   S  +YT  L  LC   +V+     + + +T  
Sbjct: 64  HDHTRKCSPSDDKCVLGLFDNLVFIDTSSFALYTFSLSVLCQTLIVISVSGIVDMCNTVK 123

Query: 109 FLDYIMVDLFFLGAFTCLILS 129
           F   +++    LG+ + +++S
Sbjct: 124 FKSNVLLFFGLLGSVSTILIS 144

>KAFR0A00620 Chr1 complement(112316..114310) [1995 bp, 664 aa] {ON}
           Anc_2.454 YMR100W
          Length = 664

 Score = 33.1 bits (74), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 6/68 (8%)

Query: 122 AFTCLILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSS-MISIMYYGFFDSGKFFYGF 180
           AF CL+L+ T     T ++R  ++ + +  L I+A I+ + +I    Y FF    + YGF
Sbjct: 113 AFQCLVLTGT---RGTEAIRAQVVSSGI--LPILATILDNFLIYHGNYDFFTDSYYKYGF 167

Query: 181 STLTLVFG 188
            +LTL  G
Sbjct: 168 QSLTLKTG 175

>KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8.303
           YDR135C
          Length = 1535

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 7   RRRLQIKRANIVKEETMSTGTI-NKKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLG 65
           ++RLQ  +     E T     I N  +  +LY+WEE   ++K  EH+R+    +  + LG
Sbjct: 468 QKRLQKSQMGFKDERTSVISEILNNIKSLKLYAWEE--PYKKKLEHVRNDKELKNLTKLG 525

Query: 66  CF 67
           CF
Sbjct: 526 CF 527

>Smik_5.34 Chr5 complement(56141..58339) [2199 bp, 732 aa] {ON}
           YEL053C (REAL)
          Length = 732

 Score = 30.4 bits (67), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 6/55 (10%)

Query: 253 IIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNSY--ELVH 305
           IIGAL  +L+L E  S G      H   + HIL +I  L HL+  L  Y  E +H
Sbjct: 194 IIGALTESLQLLEAYSDGSL----HLTTLRHILKIILCLVHLEDHLTDYSTETIH 244

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.330    0.144    0.452 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,094,168
Number of extensions: 1349423
Number of successful extensions: 4160
Number of sequences better than 10.0: 88
Number of HSP's gapped: 4193
Number of HSP's successfully gapped: 90
Length of query: 311
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 202
Effective length of database: 40,982,805
Effective search space: 8278526610
Effective search space used: 8278526610
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 65 (29.6 bits)