Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E01452g6.25ON73773737600.0
KLLA0D01309g6.25ON74474921660.0
ACL001C6.25ON74574721430.0
NCAS0H008606.25ON75575120250.0
Kpol_1037.296.25ON74675519990.0
Ecym_30306.25ON74775219820.0
Kwal_56.224476.25ON73573819750.0
YOR001W (RRP6)6.25ON73374519700.0
Suva_15.1766.25ON74575219630.0
ZYRO0C07678g6.25ON74174819520.0
TPHA0J003706.25ON74374519470.0
KNAG0M012306.25ON73875619420.0
Smik_15.1706.25ON77374419330.0
KLTH0C11066g6.25ON73573819280.0
KAFR0G026606.25ON73573719230.0
Skud_15.1626.25ON73474218970.0
CAGL0E02585g6.25ON73774518840.0
TBLA0A071706.25ON77174718770.0
NDAI0D008506.25ON79077018590.0
TDEL0G044406.25ON73573717670.0
TPHA0A051705.88ON1016175752.5
Kwal_56.241516.236ON480100725.3
SAKL0C12518g3.54ON185116696.8
Suva_8.2648.628ON89863708.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E01452g
         (737 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} simila...  1452   0.0  
KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} simila...   838   0.0  
ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON} S...   830   0.0  
NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {O...   784   0.0  
Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {O...   774   0.0  
Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to ...   768   0.0  
Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001...   765   0.0  
YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nucle...   763   0.0  
Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001...   760   0.0  
ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} simila...   756   0.0  
TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON...   754   0.0  
KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {...   752   0.0  
Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001...   749   0.0  
KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {...   747   0.0  
KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.2...   745   0.0  
Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001...   735   0.0  
CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} simila...   730   0.0  
TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6...   727   0.0  
NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {O...   720   0.0  
TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.2...   685   0.0  
TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]...    33   2.5  
Kwal_56.24151 s56 complement(874353..875795) [1443 bp, 480 aa] {...    32   5.3  
SAKL0C12518g Chr3 (1119664..1120221) [558 bp, 185 aa] {ON} highl...    31   6.8  
Suva_8.264 Chr8 complement(477821..480517) [2697 bp, 898 aa] {ON...    32   8.2  

>SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 737

 Score = 1452 bits (3760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 713/737 (96%), Positives = 713/737 (96%)

Query: 1   MSSDKPDKLLSNLVGTVRAASALSAQDLDFFKSLDXXXXXXXXXXXXXLLNLINEVLLSI 60
           MSSDKPDKLLSNLVGTVRAASALSAQDLDFFKSLD             LLNLINEVLLSI
Sbjct: 1   MSSDKPDKLLSNLVGTVRAASALSAQDLDFFKSLDSGISKSVEGSSSKLLNLINEVLLSI 60

Query: 61  DENNDTIEYGKDNFQESWKDIGDIMDNLFEKSDHAFDALKRNSINQGNSNVQYLDDSSRS 120
           DENNDTIEYGKDNFQESWKDIGDIMDNLFEKSDHAFDALKRNSINQGNSNVQYLDDSSRS
Sbjct: 61  DENNDTIEYGKDNFQESWKDIGDIMDNLFEKSDHAFDALKRNSINQGNSNVQYLDDSSRS 120

Query: 121 NLNPSKRIEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHYPH 180
           NLNPSKRIEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHYPH
Sbjct: 121 NLNPSKRIEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHYPH 180

Query: 181 PYGYEIDTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLEH 240
           PYGYEIDTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLEH
Sbjct: 181 PYGYEIDTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLEH 240

Query: 241 HDYRSYYGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWLQ 300
           HDYRSYYGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWLQ
Sbjct: 241 HDYRSYYGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWLQ 300

Query: 301 RDLGIYVVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRAY 360
           RDLGIYVVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRAY
Sbjct: 301 RDLGIYVVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRAY 360

Query: 361 ARADTHFLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPIEK 420
           ARADTHFLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPIEK
Sbjct: 361 ARADTHFLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPIEK 420

Query: 421 DEPWRNLMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDPA 480
           DEPWRNLMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDPA
Sbjct: 421 DEPWRNLMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDPA 480

Query: 481 GVLSVSNFITDYVRSNSKMLSNLIKKTLESLKNGDVSTNNAGSSQLEEKDLSQVLSISQI 540
           GVLSVSNFITDYVRSNSKMLSNLIKKTLESLKNGDVSTNNAGSSQLEEKDLSQVLSISQI
Sbjct: 481 GVLSVSNFITDYVRSNSKMLSNLIKKTLESLKNGDVSTNNAGSSQLEEKDLSQVLSISQI 540

Query: 541 QNMCLQFNSLASKVKKANSATNSMPKVSILFDGDHIFSNDRAVLYSKNSKIVIDENQLQE 600
           QNMCLQFNSLASKVKKANSATNSMPKVSILFDGDHIFSNDRAVLYSKNSKIVIDENQLQE
Sbjct: 541 QNMCLQFNSLASKVKKANSATNSMPKVSILFDGDHIFSNDRAVLYSKNSKIVIDENQLQE 600

Query: 601 RKLEVSEKLKEVQEPDFRLHVNVTTKETDEVSKDVSEKDDVNRASETDPLETNKDEIIVL 660
           RKLEVSEKLKEVQEPDFRLHVNVTTKETDEVSKDVSEKDDVNRASETDPLETNKDEIIVL
Sbjct: 601 RKLEVSEKLKEVQEPDFRLHVNVTTKETDEVSKDVSEKDDVNRASETDPLETNKDEIIVL 660

Query: 661 KKKKRHEPQDRKKVGNSTDVEPMDYKNAEKLLGNXXXXXXXXXXXRRFDPYTSENVGPQS 720
           KKKKRHEPQDRKKVGNSTDVEPMDYKNAEKLLGN           RRFDPYTSENVGPQS
Sbjct: 661 KKKKRHEPQDRKKVGNSTDVEPMDYKNAEKLLGNSKKSSKQKTTKRRFDPYTSENVGPQS 720

Query: 721 AKKRKKPTPGKNMSFKN 737
           AKKRKKPTPGKNMSFKN
Sbjct: 721 AKKRKKPTPGKNMSFKN 737

>KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 744

 Score =  838 bits (2166), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/749 (57%), Positives = 555/749 (74%), Gaps = 19/749 (2%)

Query: 1   MSSDKPDKLLSNLVGTVRAASALSAQDLDFFKSLDXXXXXXXXXXXXXLLNLINEVLLSI 60
           MSS+  D LLS+LV TVR++SAL+AQD+DF+KSLD             +L+LIN++LLSI
Sbjct: 1   MSSEDKDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTSTNILSLINDLLLSI 60

Query: 61  DENNDTIEYGKDNFQESWKDIGDIMDNLFEKSDHAFDALKRNSINQGNS-NVQYLDDSSR 119
           D NND I+ GKD+F +SWK I +IMDNLFEKSDHA D ++  +       +++YL+D  R
Sbjct: 61  DPNNDVIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRAGNGGNAGGPSLKYLNDDDR 120

Query: 120 SNLNPSKRIEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHYP 179
           SN  PSKRIEKPQL+FKTP+DNTE HPFKPLLE KPH+L+P    LK  PE E+IPSHYP
Sbjct: 121 SNNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYP 180

Query: 180 HPYGYEIDTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLE 239
           HPY YEID Q+YN+SIL   +PIPS+ W++T+ +WVDT E L K+ +EL  A E+A+DLE
Sbjct: 181 HPYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLE 240

Query: 240 HHDYRSYYGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWL 299
           HHDYRSYYGIVCLMQIS RE DW+VDTIALREEL++LN+IFTDP+V KV HGAFMDIIWL
Sbjct: 241 HHDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWL 300

Query: 300 QRDLGIYVVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRA 359
           QRDLG+Y+V LFDTYHASR LG P+HSLAYLLE+FA FKTSKKYQLADWRIRPLTKPM A
Sbjct: 301 QRDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLA 360

Query: 360 YARADTHFLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPIE 419
           YARADTHFLLNI+D+LRNSL+EQNK++ VLH+SR VAKRRFEY+SFRPK+ S+ VFSPIE
Sbjct: 361 YARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPIE 420

Query: 420 KDEPWRNLMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDP 479
           KDEPW+N+M+QYNIP S+E L+R+LYEWRDTIARRDDESPRYVMPNQLLVSLVA APT+P
Sbjct: 421 KDEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEP 480

Query: 480 AGVLSVSNFITDYVRSNSKMLSNLIKKTLESLKNGDVSTNNAGSSQLEEK-----DLSQV 534
             VLSVS+++++++R+NSK+++NLIK+TLE LK     +N++    LE       DL+ +
Sbjct: 481 INVLSVSSYVSEHLRTNSKVIANLIKRTLEDLKGN---SNSSAIPLLESAESNGTDLANI 537

Query: 535 LSISQIQNMCLQFNSLASKV--KKANSATNSMPKVSILFDGDHIFSNDRAVLYSKNSKIV 592
           ++ SQI+++   F+SLAS++  +K N+  NS  + S+LF+G      + AV Y+  ++ +
Sbjct: 538 ITTSQIKSIQNIFHSLASEINSQKLNNEQNS--EKSVLFNGISNLDVNTAVRYTPKTRTL 595

Query: 593 IDENQLQERKLEVSEKLKEVQEPDFRLHVNVTTKETDEVSKDVSEKDDVNRASETDP--- 649
           I +++L +R+ E++  L E +  D +    V     DE    VS  ++ N    +DP   
Sbjct: 596 IPQHELLKRQHEITRTL-EQEYTDRQAQSIVLPSNEDEAPTQVSNDENRNEVITSDPSQE 654

Query: 650 -LETNKDEIIVLKKKKRHEPQDRKKVGNSTDVEPMDYKNAEKLLGNXX-XXXXXXXXXRR 707
            +E NKDE+I L+K++      RK +      E MDY     LL +            RR
Sbjct: 655 EIEENKDEVITLRKRQSQSNNKRKTISPPASHEIMDYAAGSDLLNSTKNNTNSQKHKKRR 714

Query: 708 FDPYTSENVGPQSAKKRKKPTPGKNMSFK 736
           FDPY+ E+VGPQ  KK+ KP  GKN+SFK
Sbjct: 715 FDPYSVEHVGPQPIKKKSKPAKGKNVSFK 743

>ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR001W
           (RRP6)
          Length = 745

 Score =  830 bits (2143), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/747 (56%), Positives = 549/747 (73%), Gaps = 13/747 (1%)

Query: 1   MSSDKPDKLLSNLVGTVRAASALSAQDLDFFKSLDXXXXXXXXXXXXXLLNLINEVLLSI 60
           M+S   D L   +V T+RAA+ALSAQD+DF++SL              +++LINE+LLS+
Sbjct: 1   MASTDEDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSV 60

Query: 61  DENNDTIEYGKDNFQESWKDIGDIMDNLFEKSDHAFDALKRNSINQGNS-NVQYLDDSSR 119
           DENN+ ++ G+DNF++SWK++ ++MDN+FEKSDHAFD++K  S ++    N+QYL DSS 
Sbjct: 61  DENNNELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEGVNMQYLADSSH 120

Query: 120 SNLNPSKRIEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHYP 179
            +  PSKRIEKPQL FKTP+DNTE HPFKPLL+ KPHAL+PL E L   PE EN+P+HYP
Sbjct: 121 DDSTPSKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAHYP 180

Query: 180 HPYGYEIDTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLE 239
           HPY YEID Q YN+S+L++R+ I  QPWE T+P+WVD  ESL ++L+EL+  KE+AVDLE
Sbjct: 181 HPYEYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDLE 240

Query: 240 HHDYRSYYGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWL 299
           HHDYRSYYGIVCLMQIS+R +DWLVDTIALR++LHVLN I  DP+V+KVFHGAFMD+IWL
Sbjct: 241 HHDYRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIWL 300

Query: 300 QRDLGIYVVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRA 359
           QRDLG+YVVSLFDTYHASR+LG P+HSLAYLLE FA+FKTSKKYQLADWR+RPL KP+R 
Sbjct: 301 QRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLRD 360

Query: 360 YARADTHFLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPIE 419
           YAR+DTHFLL+IYD LRN+L++  KLA VL+ SRNVAKRRFEYTSFRP+I  ++V+SPIE
Sbjct: 361 YARSDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSPIE 420

Query: 420 KDEPWRNLMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDP 479
             EPWR LMYQYN+P S+EPL++KLYEWRDT+ARRDDES RYVMPNQLLVSLV+++P++ 
Sbjct: 421 STEPWRKLMYQYNLPPSKEPLLKKLYEWRDTVARRDDESVRYVMPNQLLVSLVSLSPSET 480

Query: 480 AGVLSVSNFITDYVRSNSKMLSNLIKKTLESLKNGDVSTNNAGSSQLEEKDLSQVLSISQ 539
           AGVLSVS ++TDYVRSN++ L+NLIK+TLE++K G  S     SS+    + +  LS+  
Sbjct: 481 AGVLSVSTYVTDYVRSNARTLANLIKRTLETIKAGTASVAEFSSSERALSNPAATLSLHM 540

Query: 540 IQNMCLQFNSLASKVKKANSATNSMPKVSILFDGDHIFSNDRAVLYSKNSKIVIDENQLQ 599
           IQN+   F SL  + +K + +  S    S+LF+ D + +   AV Y+   K VI +N LQ
Sbjct: 541 IQNLDDHFRSLLMEAQKQSGSICSQHSSSLLFNSD-LATGPSAVEYTNGQKHVIGDNVLQ 599

Query: 600 ERKLEVSEKL-KEVQEP--DFRLHVNVTTKETDEVSKDV--SEKDDVNRASETDPLETNK 654
            RK  + +K   +  EP  D     + ++ E  +VS+D+  SE  +     + D  +  K
Sbjct: 600 TRKHALLQKFTSQPVEPVTDIEAPSHQSSSENPQVSEDISPSEPQESQNEVQKDEPDFEK 659

Query: 655 DEIIVLKKKKRHEPQDRKKVGNSTDVEPMDYKNAEKLLGNXXXXXXXXX-----XXRRFD 709
            EI+VL+KKK+   Q + K  +S+  E +DY NA+++LG                 R+FD
Sbjct: 660 SEIVVLRKKKKAHAQ-KPKGTSSSPTETVDYSNAKEVLGKGTSSTAKRGDKDRPRKRKFD 718

Query: 710 PYTSENVGPQSAKKRKKPTPGKNMSFK 736
           PY  +N  P   KK+ KP+ GK++SFK
Sbjct: 719 PYGQDNNAPSGVKKKNKPSKGKSISFK 745

>NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {ON}
           Anc_6.25 YOR001W
          Length = 755

 Score =  784 bits (2025), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/751 (53%), Positives = 526/751 (70%), Gaps = 17/751 (2%)

Query: 2   SSDKPDKLLSNLVGTVRAASALSAQDLDFFKSLDXXXXXXXXXXXXXLLNLINEVLLSID 61
           S ++   LL  +V TVRAASAL+AQD+DF++S+D             + ++IN VLLSID
Sbjct: 5   SQEQEKTLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVLLSID 64

Query: 62  ENNDTIEYGKDNFQESWKDIGDIMDNLFEKSDHAFDALKR-NSINQGNSNVQYLDDSSRS 120
           EN++ ++  K+N ++ WKD G++MDNLFEKSD + D + R +  + G S +QY+D+ S  
Sbjct: 65  ENSEQVDGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQSGMQYIDEFSGR 124

Query: 121 NLNPSKRIEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHYPH 180
           +L P K+I KPQL F TPIDNTESHPF PLL+ KP AL+PL E ++  PE E  P HYP 
Sbjct: 125 DLTPGKQILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPMHYPQ 184

Query: 181 PYGYEIDTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLEH 240
           PY YEID QEYN+ ILQ +DPIPS  W D +P+WVDT   LQ ++ +L ++ EIAVDLEH
Sbjct: 185 PYEYEIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAVDLEH 244

Query: 241 HDYRSYYGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWLQ 300
           HDYR+YYGI CLMQISTR+ D+L+DT+ALRE+L +LN +F +P + KVFHGAFMDIIWLQ
Sbjct: 245 HDYRTYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDIIWLQ 304

Query: 301 RDLGIYVVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRAY 360
           RDLG+YVV LFDT+HASR++GLP+HSLAYLLEKFAQFKTSKKYQLADWRIRPL+K M AY
Sbjct: 305 RDLGLYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKAMHAY 364

Query: 361 ARADTHFLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSAD--VFSPI 418
           ARADTHFLLNI+DQ+RNSLIEQNKLA VL +SRNVAKRRFEY+SFRPK++  +  V+SPI
Sbjct: 365 ARADTHFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLVYSPI 424

Query: 419 EKDEPWRNLMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTD 478
           EKD+PW+ +M+QYNIP  +EPL+++LY+WRD IARRDDESPR+VMPNQLLVSLVA  P D
Sbjct: 425 EKDDPWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAYTPID 484

Query: 479 PAGVLSVSNFITDYVRSNSKMLSNLIKKTLESLKNGDVSTNNA---GSSQLEEK--DLSQ 533
             GV+SVSN +TDYVRSNSK+L+NLIK  L  +K+     NN    G S + E   DLSQ
Sbjct: 485 APGVVSVSNSVTDYVRSNSKILANLIKNCLAKMKDNKFLDNNVAEEGISVVPETGHDLSQ 544

Query: 534 VLSISQIQNMCLQFNSLASKVKKANSATNSMPKVSILFDGDHIFSNDRAVLYSKNSKIVI 593
            L+I Q+QN+  +F  L+ K   +     S      LFDG   F++D  + Y  + KI  
Sbjct: 545 KLTIHQLQNLKSKFQLLSDKFNNSVKTRLSNHDQLYLFDGIS-FADDVTIKYFADGKIQT 603

Query: 594 DENQLQERKLEVSEKLKEVQEPDFRLHV---NVTTKETDEVSKDVSEKDDVNRASETDPL 650
              Q +ER  +  + +K+++E ++ + V   N  T++ D +       +   + +E    
Sbjct: 604 TAEQYKERSEQFDDAMKQLEEVEYCIPVIEENKQTQDQDNIPPITVATNAEGQVNEMIEK 663

Query: 651 ETNKDEIIVLKKKKRHEP-QDRKKVGNSTDVEPMDYKNAEKLLGNXXXXXXX----XXXX 705
             + DE+IVL+K  +++  +++ K     ++E +DY    K+L N               
Sbjct: 664 PEDLDEVIVLRKTNKNKSIKNKPKNREEPELEIIDYFKTAKVLTNDKNSRGGRNNNGNKR 723

Query: 706 RRFDPYTSENVGPQSAKKRKKPTPGKNMSFK 736
           +RFDPY++ N GP + KKRK  T GKN+SFK
Sbjct: 724 KRFDPYSAANEGPAAPKKRKNVTRGKNVSFK 754

>Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {ON}
           complement(68981..71221) [2241 nt, 747 aa]
          Length = 746

 Score =  774 bits (1999), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/755 (52%), Positives = 526/755 (69%), Gaps = 29/755 (3%)

Query: 1   MSSDKPDKLLSNLVGTVRAASALSAQDLDFFKSLDXXXXXXXXXXXXXLLNLINEVLLSI 60
           MS D   +LLS++V TVRAAS+L+AQD+DF+++LD             + N+IN +LLSI
Sbjct: 1   MSEDINKELLSSVVSTVRAASSLAAQDVDFYRNLDKEISTSLNESSKEITNMINTLLLSI 60

Query: 61  DENNDTIEYGKDNFQESWKDIGDIMDNLFEKSDHAFDALKRNSINQGN-SNVQYLDDSSR 119
           +ENN+ +E GK+  ++ WKD  ++MDNLFEKSD + D + R+  +  N S  QYL DS++
Sbjct: 61  NENNEELESGKEGLEQYWKDFSNVMDNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQ 120

Query: 120 SNLNPSKRIEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHYP 179
           S+ NPSKR+ KPQL F  P+DN+ES PF PLL +KPH+++  ++ L   PE+E +PSHY 
Sbjct: 121 SDSNPSKRVTKPQLQFSRPVDNSESKPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYA 180

Query: 180 HPYGYEIDTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLE 239
           HPY  EID QEYN S+LQ+ +P+ SQPW +++  WVDT E+LQ +L++L+   EIAVDLE
Sbjct: 181 HPYEVEIDKQEYNASVLQVAEPLKSQPW-NSESTWVDTSEALQSMLDKLKECTEIAVDLE 239

Query: 240 HHDYRSYYGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWL 299
           HHDYRSYYGIVCLMQISTR+ D+LVDT+ALR+ELH+LNE+F DP++LKV HGAFMDIIWL
Sbjct: 240 HHDYRSYYGIVCLMQISTRKEDFLVDTLALRDELHILNEVFADPNILKVLHGAFMDIIWL 299

Query: 300 QRDLGIYVVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRA 359
           QRDLG+YVVSLFDTYHASR+LG PRHSLAYLLEK+A FKTSKKYQLADWR+RPL+KPM A
Sbjct: 300 QRDLGLYVVSLFDTYHASRALGFPRHSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHA 359

Query: 360 YARADTHFLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPIE 419
           YARADTHFLLNIYDQ+RN LI +NKLA VL +SRNVAKRRFEY+ FRPK+ S  VF+PIE
Sbjct: 360 YARADTHFLLNIYDQIRNQLIRENKLAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIE 419

Query: 420 KDEPWRNLMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDP 479
           K+EPWR L+YQYN+P ++  L+++++EWRD IARRDDESPRY+MPNQL++SLV   P DP
Sbjct: 420 KEEPWRTLVYQYNVPSTKIELLKRIWEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDP 479

Query: 480 AGVLSVSNFITDYVRSNSKMLSNLIKKTLESLKN---GDVSTNNAGSSQLEEKDLSQVLS 536
           AGV+SVSN +TD+VRSNSK+++NLIKK+LE +K+   G ++       ++ +K  S  L+
Sbjct: 480 AGVISVSNVMTDHVRSNSKVIANLIKKSLEDMKSVPAGALTAFQNIDYKIGQKFASDKLT 539

Query: 537 ISQIQNMCLQFNSLASK---VKKANSATNSMPKVSILFDGDHIFSNDRAVLYSKNSKIVI 593
           ISQIQNM   F  +AS    ++K  S      K+  +   +   S +  VLY  + + V+
Sbjct: 540 ISQIQNMTALFKEIASNPSIIEKDVSK-----KIDPILFSNIFLSKNEIVLYDHDKRHVV 594

Query: 594 DENQLQERKLEVSEKLKEVQEPDFRLHV------NVTTKETDE----VSKDVSEKDDVNR 643
              QL  R  EV   + E       +++      +V   E  E     S  +S  ++ + 
Sbjct: 595 TNEQLAGRAEEVEGFMNEANNTTLAINIESSAEMHVEEPEAKEKNALFSPPISNVENAS- 653

Query: 644 ASETDPLETNKDEIIVLKKKKRHEPQDRKKVGNSTDVEPMDYKNAEKLLGNXXXXXXXXX 703
           +S TD  E   D I++   KKR   +D KK     + E +DY   + +L           
Sbjct: 654 SSNTDGFEDMNDIIVLKDVKKRTNIKDHKKKQGMPNKEVIDYSKLDTILSK---EKRENS 710

Query: 704 XXRRFDPYTSENV--GPQSAKKRKKPTPGKNMSFK 736
             R+ DP+  EN   GP++AKKRK+   GKN+SFK
Sbjct: 711 KKRKGDPFGEENGLEGPKAAKKRKQINRGKNVSFK 745

>Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to
           Ashbya gossypii ACL001C
          Length = 747

 Score =  768 bits (1982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/752 (51%), Positives = 530/752 (70%), Gaps = 22/752 (2%)

Query: 1   MSSDKPDKLLSNLVGTVRAASALSAQDLDFFKSLDXXXXXXXXXXXXXLLNLINEVLLSI 60
           MSSD  D LL+ ++GTVRAAS+L+AQD+DF + LD             +++L+NEV+LS 
Sbjct: 1   MSSDNKDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILST 60

Query: 61  DENNDTIEYGKDNFQESWKDIGDIMDNLFEKSDHAFDALKRNSINQG---NSNVQYLDDS 117
            + N+ +E GKDN + +WKD+ +I+DNLFEKSDH+ D L++   +     ++N+QYL+  
Sbjct: 61  SKANNDLEVGKDNLEAAWKDLSNIIDNLFEKSDHSLDVLQKLLSSSSSQLDTNMQYLNVD 120

Query: 118 SRSNLNPSKRIEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSH 177
           S+ +   S+RI KPQL FK P+DN+E HPFKPLL+ KPHAL+PL E+   T ETE +P+H
Sbjct: 121 SQRDGKLSQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAH 180

Query: 178 YPHPYGYEIDTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVD 237
           YPHPY YEID Q Y++S+L I++PI    W++ +P+WVD   +L  +LN L++ KEIAVD
Sbjct: 181 YPHPYEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVD 240

Query: 238 LEHHDYRSYYGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDII 297
           LEHHDYRSYYG+VCLMQISTRE DWLVDTIALR++L VLNEIFTDPS+LKVFHGAFMDII
Sbjct: 241 LEHHDYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDII 300

Query: 298 WLQRDLGIYVVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPM 357
           WLQRDLG+YVVSLFDTYHASR+LG P+HSLAYLLE FA FKTSKKYQLADWRIRPL+KPM
Sbjct: 301 WLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPM 360

Query: 358 RAYARADTHFLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSP 417
           + YARADTHFLLNIYD+LRNSLI+++KL+ VLH SRNVAKRRFEYTSFRPK++S  VFSP
Sbjct: 361 KTYARADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSP 420

Query: 418 IEKDEPWRNLMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPT 477
           IEKD+PWR LM QYN+P  +EPLMRKLY+WRD +AR+DDES RYVMPNQLLVSLV +AP+
Sbjct: 421 IEKDDPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPS 480

Query: 478 DPAGVLSVSNFITDYVRSNSKMLSNLIKKTLESLKNG---DVSTNNAGSSQLEEKDLSQV 534
           DP+G+L+V ++I D+VR+N+++L N+I KT+E +K+G     S  N  ++ +  +D    
Sbjct: 481 DPSGLLTVKSYIPDHVRANARVLCNIINKTMEEIKSGSHEGQSIENVTTTYVSAQDPE-- 538

Query: 535 LSISQIQNMCLQFNSLASKVKKANSATNSMPKVSILFDGDHIFSNDRAVLYSKNSKIVID 594
           +S+S I+ M   F  L  +V+      +S+ + S+LF G  +F   +AV Y+   K +++
Sbjct: 539 MSVSLIKTMDRHFKFLLDEVQSHAVEPSSVCEDSLLFKG-FLFDKPKAVAYNSVGKRLVN 597

Query: 595 ENQLQERKLEVSEKLKEVQEP---DFRLHVNVTTKETD---EVSKDVSEKDDVNRASETD 648
           + +L +RK ++S+K  +V +        H+   +  ++   + + +V         + +D
Sbjct: 598 DRELLDRKSDLSQKFSKVFKAAGIAIGSHIEKLSSNSELPADTTSNVESPSKEESKNNSD 657

Query: 649 PLETNKDEIIVLKKKKRHEPQDRKKVGNSTDVEPMDYKNAEKLLGNXXXX----XXXXXX 704
            L+ +K EIIVL K+KR    + K        E +DY N   +L N              
Sbjct: 658 DLKEDKHEIIVL-KRKRDYGSNTKSTSKQPKKEHVDYNNVNSILDNTSQQDKPNSGRHVD 716

Query: 705 XRRFDPYTSENVGPQSAKKRKKPTPGKNMSFK 736
            R+F      ++G  + KK +  + GK +S+K
Sbjct: 717 KRKFHSDLQGSIGAAAIKKPR--SKGKTVSYK 746

>Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001W
           (RRP6) - involved in 5.8S rRNA processing [contig 185]
           FULL
          Length = 735

 Score =  765 bits (1975), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/738 (52%), Positives = 516/738 (69%), Gaps = 14/738 (1%)

Query: 4   DKPDKLLSNLVGTVRAASALSAQDLDFFKSLDXXXXXXXXXXXXXLLNLINEVLLSIDEN 63
           DK   +L+ +VGT+RA+SA+SAQD+DF+KSLD             LL+LIN+V++SID+N
Sbjct: 7   DKRSSILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLSLINDVVISIDDN 66

Query: 64  NDTIEYGKDNFQESWKDIGDIMDNLFEKSDHAFDALKRNSINQGNSNVQYLDDSSRSNLN 123
           ND IE G+   + SW +IG++MD LFEKS+HA  A+K+   N   +N+QYLDDS      
Sbjct: 67  NDLIEPGRAGLENSWNNIGEVMDLLFEKSEHALAAMKKKGSNIIGNNLQYLDDSQPLTDT 126

Query: 124 PSKRIEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHYPHPYG 183
              +I KPQ +F  P+DNTESHPFKPLL  KP+ALRPL ++L+ T E E IP+HYPHPY 
Sbjct: 127 TLTKITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPAHYPHPYE 186

Query: 184 YEIDTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLEHHDY 243
           YEID QEY+ES+L+IR PIPS+PWE+TD  WVD   +L  ++ EL  AKE+A+DLEHHDY
Sbjct: 187 YEIDHQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAIDLEHHDY 246

Query: 244 RSYYGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWLQRDL 303
           R+YYGI CLMQISTRE DWLVDTIALR+ L VLNEIFT+P V+KVFHGAFMD+IWLQRDL
Sbjct: 247 RTYYGITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDVIWLQRDL 306

Query: 304 GIYVVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRAYARA 363
           G+Y+VSLFDT+HASR LG P+HSLAYLLE++A FKTSKKYQLADWRIRPL+KP++AYARA
Sbjct: 307 GLYLVSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKPLKAYARA 366

Query: 364 DTHFLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPIEKDEP 423
           DTHFLLNIYDQ+RNSLIEQ KLA  LH+SR VAKRRFEYT FRP +++++V+SP+E+++P
Sbjct: 367 DTHFLLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYSPVEREDP 426

Query: 424 WRNLMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDPAGVL 483
           WR+L++ YNIP S+  L+++LYEWRDTIARRDDESPRYVMPNQLLV+LV  APTD  G+L
Sbjct: 427 WRSLIFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAPTDTYGLL 486

Query: 484 SVSNFITDYVRSNSKMLSNLIKKTLESLKNGDVSTNNAGSSQLEEKDLSQVLSISQIQNM 543
           SV++F+T++VRSN+K LS LIKKTL S +  D+ T+        +  +   LS   ++  
Sbjct: 487 SVTSFVTEHVRSNAKSLSQLIKKTLASPQ--DLFTDQINHMDSNKSMVDSKLSPGDVKAN 544

Query: 544 CLQFNSLASKVKKANSATNSMPKVSILFDGDHIFSNDRAVLYSKNSKIVIDENQLQERKL 603
              F+    K ++      ++ +   LF G  +  N+  V Y       I+   L +R+ 
Sbjct: 545 HQNFDQYTRKSRELVIHGPTVVRGCSLFPGKPL-PNEAYVSYQGTQVHHIEPTVLDDRRE 603

Query: 604 EVSEKLKEVQEPDFRLHVNVTTKETDEVSKDVSEKDDVNRASET-DPLETNKDEIIVLKK 662
            V++ +        +L V V      EVS ++ E +    + +T   L+ +KDEI+VLK+
Sbjct: 604 LVAQNITTTANVTEKLQVAVEKTPAPEVSDELDEGEAKELSDDTVSQLKEDKDEIVVLKR 663

Query: 663 KKRHEPQD----RKKVGNSTDVEPMDYKNAEKLLGNXXXXXXXXXXXRRFDPYTSENVGP 718
           +K   PQ     +   GN  ++  +D+KN +K++             +RFDPY  +  GP
Sbjct: 664 RKAL-PQSSSPPKNAEGNPKEI--LDFKNNKKIM--TATASVPRKSTKRFDPYAIQASGP 718

Query: 719 QSAKKRKKPTPGKNMSFK 736
              K+RKK T G   SFK
Sbjct: 719 DGVKRRKK-TRGIQKSFK 735

>YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nuclear
           exosome exonuclease component; has 3'-5' exonuclease
           activity; involved in RNA processing, maturation,
           surveillance, degradation, tethering, and export; has
           similarity to E. coli RNase D and to human PM-Sc1 100
           (EXOSC10); mutant displays reduced transcription
           elongation in the G-less-based run-on (GLRO) assay
          Length = 733

 Score =  763 bits (1970), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/745 (52%), Positives = 526/745 (70%), Gaps = 22/745 (2%)

Query: 1   MSSDKPDKLLSNLVGTVRAASALSAQDLDFFKSLDXXXXXXXXXXXXXLLNLINEVLLSI 60
           M+S+ PD LLS ++  VRAAS+L++QD+DF+K+LD             L ++ NE++LSI
Sbjct: 1   MTSENPDVLLSRVINVVRAASSLASQDVDFYKNLDRGFSKDLKSKADKLADMANEIILSI 60

Query: 61  DENNDTIEYGKDNFQESWKDIGDIMDNLFEKSDHAFDALKR--NSINQGNSNVQYLDDSS 118
           DE++++ E  +++  + W + G+IMDNL E SDH+ D L    NS ++G S++QYL + S
Sbjct: 61  DEHHESFELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRG-SDLQYLGEFS 119

Query: 119 RSNLNPSKRIEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHY 178
             N +P+KR+EKPQL FK+PIDN+ESHPF PLL+ KP+AL+PLSE L+   + EN PSHY
Sbjct: 120 GKNFSPTKRVEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHY 179

Query: 179 PHPYGYEIDTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDL 238
           PHPY YEID QEY+  ILQIR+ IPS+ W+D+ P+WVDT   L+ +L +L++ KEIAVDL
Sbjct: 180 PHPYEYEIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDL 239

Query: 239 EHHDYRSYYGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIW 298
           EHHDYRSYYGIVCLMQISTRERD+LVDT+ LRE LH+LNE+FT+PS++KVFHGAFMDIIW
Sbjct: 240 EHHDYRSYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIW 299

Query: 299 LQRDLGIYVVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMR 358
           LQRDLG+YVV LFDTYHAS+++GLPRHSLAYLLE FA FKTSKKYQLADWRIRPL+KPM 
Sbjct: 300 LQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMT 359

Query: 359 AYARADTHFLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPI 418
           AYARADTHFLLNIYDQLRN LIE NKLA VL++SRNVAKRRFEY+ +RP   S++V+SPI
Sbjct: 360 AYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPI 419

Query: 419 EKDEPWRNLMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTD 478
           EK+ PW+ LMYQYNIP  RE L+R+LY+WRD IARRDDESPR+VMPNQLL +LVA  PTD
Sbjct: 420 EKESPWKILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTD 479

Query: 479 PAGVLSVSNFITDYVRSNSKMLSNLIKKTLESLKNGDVSTNNAGSSQLEEKD-LSQVLSI 537
             GV+S++N +T++VR N+K+L+NLI+  L ++KN +       SS+ +    L + +S+
Sbjct: 480 VIGVVSLTNGVTEHVRQNAKLLANLIRDALRNIKNTNEEATPIPSSETKADGILLETISV 539

Query: 538 SQIQNMCLQFNSLA------SKVKKANSATNSMPKVSILFDGDHIFSNDRAVLYSKNSKI 591
            QI+++  +F+ L       S+ K   +++  + K+    + D  +S D      K   I
Sbjct: 540 PQIRDVMERFSVLCNSNISKSRAKPVTNSSILLGKILPREEHDIAYSKDGLPNKVKTEDI 599

Query: 592 VIDENQLQERKLEVSEKLKEVQEPDFRLHVNVTTKETDEVSKDVSEKDDVNRASETDPLE 651
            I     +     + + + E+++P   L V V  +E     K V      N + E D   
Sbjct: 600 RIRAQNFKSALANLEDIIFEIEKP---LVVPVKLEEI----KTVDPASAPNHSPEID--- 649

Query: 652 TNKDEIIVLKKKKRHEPQDRKKVGNSTDVEPMDYKNAEKLLGNXXXXXXXXXXXRRFDPY 711
            N D+++VLKKK   + Q  K+ G  T+ + +DY     +L N           RRFDP 
Sbjct: 650 -NLDDLVVLKKKNIQKKQPAKEKG-VTEKDAVDYSKIPNILSNKPGQNNRQQKKRRFDPS 707

Query: 712 TSENVGPQSAKKRKKPTPGKNMSFK 736
           +S++ GP++AKKR+    GKN+SFK
Sbjct: 708 SSDSNGPRAAKKRRPAAKGKNLSFK 732

>Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001W
           (REAL)
          Length = 745

 Score =  760 bits (1963), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/752 (52%), Positives = 524/752 (69%), Gaps = 42/752 (5%)

Query: 1   MSSDKPDKLLSNLVGTVRAASALSAQDLDFFKSLDXXXXXXXXXXXXXLLNLINEVLLSI 60
           M+S+  D LLS +V  +RAAS+L+AQD+DF+++LD             L  ++N ++LSI
Sbjct: 19  MASENSDVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSI 78

Query: 61  DENNDTIEYGKDNFQESWKDIGDIMDNLFEKSDHAFDALKRNS-INQGNSNVQYLDDSSR 119
           DE++D++E  ++   + WKD G+IMDNL EKSDH+ D L R S  N   +++QYL D S 
Sbjct: 79  DEHHDSLELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSNSNNSAADLQYLGDFSG 138

Query: 120 SNLNPSKRIEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHYP 179
            +  P+KR+EKPQL FKTPIDN+ESHPF PLL+ KP+AL+PLS+ L+     EN P HYP
Sbjct: 139 KDSQPTKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRMIETEENSPGHYP 198

Query: 180 HPYGYEIDTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLE 239
           HPY YEID QEYN +ILQI+  IPS+PW+ ++P+W+++K +L+ +L +L++A EIAVDLE
Sbjct: 199 HPYEYEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVDLE 258

Query: 240 HHDYRSYYGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWL 299
           HHDYRSYYG+VCLMQ+STRERD+LVDT+ LRE+LH+LNE+FT+PS++KVFHGAFMDIIWL
Sbjct: 259 HHDYRSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDIIWL 318

Query: 300 QRDLGIYVVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRA 359
           QRDLG+YVV LFDTYHAS+++GLPRHSLAYLLE FA FKTSKKYQLADWRIRPL+KPM A
Sbjct: 319 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 378

Query: 360 YARADTHFLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPIE 419
           YARADTHFLLNIYDQLRN LIE NKLA VL++SRNVAKRRFEY+ +RP   S+ V+SP E
Sbjct: 379 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPITPSSKVYSPTE 438

Query: 420 KDEPWRNLMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDP 479
           K+ PWR LMYQYNI   RE L++ LYEWRD IARRDDESPR++MPNQLL +LVA  P D 
Sbjct: 439 KENPWRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPIDV 498

Query: 480 AGVLSVSNFITDYVRSNSKMLSNLIKKTLESLKNGDVSTNNAGSSQLEEKDLSQVLSISQ 539
            GV+S+SN +TD+VR N+K+L+NLIK  L S+K+    +    SS+ +   L + +++SQ
Sbjct: 499 IGVVSLSNGVTDHVRQNAKILANLIKSALRSMKDTHKESAEIVSSKFKSASL-EAITVSQ 557

Query: 540 IQNMCLQFNSLASKVKKANSATNSMPKVSILF-------DGDHIFSNDRAVLYSKNSKIV 592
           I+++  +F+  +S     + + +S    SILF       +GD ++  D  + +    + +
Sbjct: 558 IRDIMDRFSVFSSNSVTEDRSMDSTAS-SILFGKILPYEEGDIVYE-DSGLPHKVKVEDM 615

Query: 593 IDENQLQERKLEVSEKLK-EVQEPDFRLHVNVTTKETDEVSKDVSEKDDVNRASETDPLE 651
            D  Q     L   E +K EV++P     VNV   E  ++              ET P  
Sbjct: 616 RDRAQRFNSALVGLEDIKFEVEKP-----VNVEKSEMVKI--------------ETTPEP 656

Query: 652 TNK----DEIIVLKKKKRHEPQDRKKVGNSTDV---EPMDYKNAEKLLGNXXXXXXXXXX 704
             K    DE++VLKKK+ H    +K+V   +DV   E +DY     +L +          
Sbjct: 657 PTKIEDPDEVVVLKKKRIH----KKQVAKRSDVAAEEAVDYSKIPNVLSSKPGQNNKQQR 712

Query: 705 XRRFDPYTSENVGPQSAKKRKKPTPGKNMSFK 736
            RRFDP  +++ GP++ KK++  T GKN+SFK
Sbjct: 713 KRRFDPSFNDSEGPRAPKKKRPTTRGKNVSFK 744

>ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 741

 Score =  756 bits (1952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/748 (52%), Positives = 523/748 (69%), Gaps = 20/748 (2%)

Query: 1   MSSDKPDKLLSNLVGTVRAASALSAQDLDFFKSLDXXXXXXXXXXXXXLLNLINEVLLSI 60
           M+ +  ++LL  +VGTVRAA+AL+AQD+DF++SLD             L+++IN  LL I
Sbjct: 1   MAEESNEQLLPKVVGTVRAAAALAAQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCI 60

Query: 61  DENNDTIEYGKDNFQESWKDIGDIMDNLFEKSDHAFDALKRNSINQGNSNVQYLDDSSRS 120
           D+N+  +E GK+  ++S KD  ++MDNLFEKSD + D L+  + ++  + + YLDD++RS
Sbjct: 61  DQNSRLLEGGKEKLEDSRKDFSNLMDNLFEKSDRSLDILRGRAPDRKGAALMYLDDAARS 120

Query: 121 NLNPSKRIEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHYPH 180
           ++ P+KRI KPQ+ F+ PIDNTE+HPFKPLLENKPHALRPLS+ ++     E+IP HYP 
Sbjct: 121 DMIPAKRILKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEHYPQ 180

Query: 181 PYGYEIDTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLEH 240
           PY YEI+ QEYNESIL+I +PIPS+PW+ ++PVWVD KESL  +L +L+ + EIAVDLEH
Sbjct: 181 PYEYEIENQEYNESILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDLEH 240

Query: 241 HDYRSYYGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWLQ 300
           HDYRSYYGIVCLMQ+STR+ D+LVDT+ALR++L VLNE+F +P ++KVFHGAFMDIIWLQ
Sbjct: 241 HDYRSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIWLQ 300

Query: 301 RDLGIYVVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRAY 360
           RDLG+Y+VSLFDTYHASR+LG PRHSLAYLLE FA FKTSKKYQLADWR+RPL+K M AY
Sbjct: 301 RDLGLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMSAY 360

Query: 361 ARADTHFLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPIEK 420
           ARADTHFLLNIYDQLRN LI +NKLA VL +SRNVAKR F+Y+ +RPK+ ++ V+SP+++
Sbjct: 361 ARADTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPVDR 420

Query: 421 DEPWRNLMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDPA 480
            + W+ LM QYNIPL +E L++ LYEWRDTIARRDDESPRYVMPNQLL  LV   P DP 
Sbjct: 421 ADGWKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLDPT 480

Query: 481 GVLSVSNFITDYVRSNSKMLSNLIKKTLESLKNGDVSTNNAGSSQLEEKDLSQVLSISQI 540
           GV+SVS  +TD+VR+N+K L+NLI K+L+ + +             ++ DLSQVL++ QI
Sbjct: 481 GVISVSPTVTDHVRTNAKALANLIVKSLQQIADAGSDIKVESVQHKDQHDLSQVLTVGQI 540

Query: 541 QNMCLQFNSLASKVKKANSATNSMPKVSILFDGDHIFSNDRAVLYSKNSKIVIDENQLQE 600
           ++   QF+ L+   K  +  TNS    S +  G+ + +    V Y ++ K  + + Q+++
Sbjct: 541 ESQVSQFHDLSKAFKGLSQGTNSSNSSSSIIFGNILHAPCGFVGYGRSLKKPVTDKQIEK 600

Query: 601 RKLEVSEKLKEVQEPDFRLHVNVTTKETDEVSKDVSEKDDVNRASETD----------PL 650
           RKLE+SE L+ +           T +E D  S+   E  D  + SE D            
Sbjct: 601 RKLELSEALEFIDA-----ETATTIQEEDRGSELTHEPADDKKVSENDESKKEEAKETEP 655

Query: 651 ETNKDEIIVLKKKKRHEPQDRKKVGNSTDVEPMDYKNAEKLLGNXXXXXXXXXXXRRFDP 710
           E +K+EII LKK K    +  K+   S   EP+DYK ++K+L             R FDP
Sbjct: 656 EEDKNEIITLKKVK-DRGKKSKRSNESEPEEPIDYKKSKKIL--ETEKKSKSTKKRAFDP 712

Query: 711 YTSENVGPQS--AKKRKKPTPGKNMSFK 736
           Y + N    +   KK+++   GK+ SFK
Sbjct: 713 YAASNDAGNAPKPKKKRRMARGKSASFK 740

>TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON}
           Anc_6.25 YOR001W
          Length = 743

 Score =  754 bits (1947), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/745 (51%), Positives = 518/745 (69%), Gaps = 21/745 (2%)

Query: 7   DKLLSNLVGTVRAASALSAQDLDFFKSLDXXXXXXXXXXXXXLLNLINEVLLSIDENNDT 66
           D+LL  +V +VRAASAL+AQD+DF++SLD             + ++IN ++ S+DEN++ 
Sbjct: 4   DELLPLVVSSVRAASALAAQDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENSEG 63

Query: 67  IEYGKDNFQESWKDIGDIMDNLFEKSDHAFDALKRNSINQGNS-NVQYLDDSSRSNLNPS 125
           +  GK+N  ESWKDIG+++D+LFE +DH+ DAL + S    N   ++YL+DS     +  
Sbjct: 64  LVEGKENLDESWKDIGNLLDSLFELADHSIDALSKASQKSSNDPKMKYLNDSLNFESDNV 123

Query: 126 KRIEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHYPHPYGYE 185
            R+ KPQLNF  P+DN+E+HPF+PLL +KP+A+ PL E+LK    TE+ P HYP PY  E
Sbjct: 124 TRLSKPQLNFSVPVDNSETHPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYETE 183

Query: 186 IDTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLEHHDYRS 245
           ID QEYNE +LQ  DPIPS+ WE+T+ +WVD +ESL  +LNEL++A E+AVDLEHHD+RS
Sbjct: 184 IDKQEYNEQVLQFSDPIPSKVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDFRS 243

Query: 246 YYGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWLQRDLGI 305
           YYGI CLMQISTR  D+LVDTIALR++L VLN +FTDP + K+ HGAFMDIIWLQRDLG+
Sbjct: 244 YYGITCLMQISTRNTDYLVDTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDLGL 303

Query: 306 YVVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRAYARADT 365
           Y+VSLFDTYHASR+LG PRHSLAYLLE+FA FKTSK+YQLADWR RPL+K M AYARADT
Sbjct: 304 YIVSLFDTYHASRALGFPRHSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARADT 363

Query: 366 HFLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPIEKDEPWR 425
           HFLLNI+DQLRN LI+++KLA++LH+SR VAKRRFEY+ ++P + S+ VFSP E D PWR
Sbjct: 364 HFLLNIFDQLRNMLIQEDKLASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDMPWR 423

Query: 426 NLMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDPAGVLSV 485
           +++YQYNIP  +  L+++L+EWRDTIARRDDESPRY+MPNQL+ SLV   PT+PAGV+SV
Sbjct: 424 SMIYQYNIPSQKVELVKRLWEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVISV 483

Query: 486 SNFITDYVRSNSKMLSNLIKKTLESLKNGDVSTNNAGSSQLEEKDLSQVLSISQIQNMCL 545
           +  +TD VRSN+K ++NLIK TLE +KN ++ST    ++  +++  S  LS SQI+ +  
Sbjct: 484 NRMMTDPVRSNAKAIANLIKSTLEDMKNNNISTTVVSTTAKDKETSSNDLSTSQIKFIVS 543

Query: 546 QFNSLASKVKKANSATNSMP----KVSILFDGDHIF-SNDRAVLYSKNSKIVIDENQLQE 600
           QF ++  K    NS  N +     K S++F    IF S D  + Y K +K +I E QL +
Sbjct: 544 QFENILEKYSSNNSNLNDVTSKEGKDSLVFSK--IFNSRDDIITYDKGTKHLITEQQLSD 601

Query: 601 RKLEVSEKLKEVQEPDFRLHVNVTTKETDEVSKDVSEKDDVNRASETDPLETNK-----D 655
           R+ EV   +K+ +E  F + V  T KE+  + +   E ++V   S     E  +     D
Sbjct: 602 RQKEVDAAMKQAEEIAFSMEVQDTHKES--MKQPFPEPEEVISQSHLPAFEDKEEQEDLD 659

Query: 656 EIIVLKKKKRHEPQDRKKVGNSTDVEP--MDYKNAEKLLGNXXXXXXXXXXXRRFDPYTS 713
           EIIVLK  K    +  +  G S D +   +DY   +K+L             R++DP+++
Sbjct: 660 EIIVLKDTKDRRNRQHRGRGRSADSDHTVIDYSKGDKILSQ--DNRRRTPNKRKYDPFSA 717

Query: 714 EN--VGPQSAKKRKKPTPGKNMSFK 736
           +N     Q AK+R+     +N+SFK
Sbjct: 718 DNNENALQGAKRRRPTAKNRNVSFK 742

>KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {ON}
           Anc_6.25 YOR001W
          Length = 738

 Score =  752 bits (1942), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/756 (51%), Positives = 506/756 (66%), Gaps = 39/756 (5%)

Query: 1   MSSDKPDKLLSNLVGTVRAASALSAQDLDFFKSLDXXXXXXXXXXXXXLLNLINEVLLSI 60
           M S++  KLLS  VGTVRA+S+L  QD+ FF +LD             +L +IN++L SI
Sbjct: 1   MDSEEQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSI 60

Query: 61  DENNDTIEYGKDNFQESWKDIGDIMDNLFEKSDHAFDALKRNSI--NQGNSNVQYLDDSS 118
           DEN+       +   ESW+D  ++ DNLFEKSD + D + + +    Q  S VQYLDD  
Sbjct: 61  DENSKPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLDDLV 120

Query: 119 RSNLNPSKRIEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHY 178
            ++ +  KRI KPQL+F  P+DN+ES PFKPLL  KP+AL+PL E L+  P TENIPSHY
Sbjct: 121 GNDSSSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHY 180

Query: 179 PHPYGYEIDTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDL 238
           P+PY YEI  QEYN  IL+ R PIPS PW +++PVWVD+ E LQ LL +L+  KE+A+DL
Sbjct: 181 PNPYDYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDL 240

Query: 239 EHHDYRSYYGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIW 298
           EHHDYRSYYGIVCLMQISTR+ D+LVDTIALR+ELH+LN++FTDP V KVFHGAFMDIIW
Sbjct: 241 EHHDYRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIW 300

Query: 299 LQRDLGIYVVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMR 358
           LQRDLG+Y+VSLFDT+HAS++LG P+HSLAYLLE  A FKTSKKYQLADWRIRPL+KPM 
Sbjct: 301 LQRDLGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMS 360

Query: 359 AYARADTHFLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPI 418
            YARADTHFLLNI+DQ+RN LI+ NKLA VL +SR VAKRRFEY+ FRPK+   DVF+PI
Sbjct: 361 VYARADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTPI 420

Query: 419 EKDEPWRNLMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTD 478
           EK+ PWR LM+QYN+   +E L++ LYEWRDTIARRDDESPRY+MPNQLL+SL A  PTD
Sbjct: 421 EKESPWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTD 480

Query: 479 PAGVLSVSNFITDYVRSNSKMLSNLIKKTLESLKNGDVSTNNAGSSQLEEKDLSQVLSIS 538
           P  ++SV++++TD VRSNSK+L+NLIK  +ES K G  S+    +   E      VL++S
Sbjct: 481 PVSLVSVNSYVTDCVRSNSKVLANLIKSFVESSKLGPQSSYTPNT---ENTSTPFVLTLS 537

Query: 539 QIQNMCLQFNSLASKVKKANSATNSMPKVSIL----FDGDHIFSNDRAVLYSKNSKIVID 594
           QI+++ ++F  L       N  ++S  K+S L    F GD +      V Y+      + 
Sbjct: 538 QIKDIGMRFTKLTE-----NFQSSSCQKISPLQRSSFFGD-LSKGKVTVSYNDAKTTPVS 591

Query: 595 ENQLQERKLEVSE----------KLKEVQEPDFRLHVNVTTKETDEVSKDVSEKDDVNRA 644
           ++ L+ R  + +E          K+  + EP   L +   T  T+       EK   N  
Sbjct: 592 QSVLESRSKQFNEYMKAFGDIEYKIPSIVEPVMDLPIPSGTTSTESADSKTVEKPPKN-- 649

Query: 645 SETDPLETNKDEIIVLKKKKRHEPQDRKKVGNSTDVEP--MDYKNAEKLLGNXX--XXXX 700
                ++ + DEI+VLKK KR  P+ +   GN  D E   +DY   +K+L          
Sbjct: 650 -----IKEDMDEIVVLKKVKRELPKPK---GNDEDAEREIVDYSKEDKVLVQRQFDKKKK 701

Query: 701 XXXXXRRFDPYTSENVGPQSAKKRKKPTPGKNMSFK 736
                +RFDP+++ + GP++ KKRK  T GKN SFK
Sbjct: 702 NNNNKKRFDPFSAISEGPKAPKKRKAVTKGKNASFK 737

>Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001W
           (REAL)
          Length = 773

 Score =  749 bits (1933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/744 (52%), Positives = 519/744 (69%), Gaps = 20/744 (2%)

Query: 1   MSSDKPDKLLSNLVGTVRAASALSAQDLDFFKSLDXXXXXXXXXXXXXLLNLINEVLLSI 60
           M+S  PD LLS +V  +RAAS+L+ QD+DF+K+LD             L ++ NE++LSI
Sbjct: 41  MASQNPDVLLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSI 100

Query: 61  DENNDTIEYGKDNFQESWKDIGDIMDNLFEKSDHAFDALKRNSINQGN-SNVQYLDDSSR 119
           DE++++ E   ++    W D G+IMDNL E SDH+ D L R   ++ N +++QYL D S 
Sbjct: 101 DEHHESFELKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVTSKPNGADLQYLGDFSE 160

Query: 120 SNLNPSKRIEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHYP 179
            NL+P+KR+EKPQL FKTPIDN+ESHPF PLL+ KP+AL+PLS+ L+   E +N PSHYP
Sbjct: 161 KNLSPAKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSHYP 220

Query: 180 HPYGYEIDTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLE 239
           HPY YEID QEY  +ILQIR  IPS+ W D++P+W+DT   L+ +L EL++ +EIAVDLE
Sbjct: 221 HPYEYEIDHQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDLE 280

Query: 240 HHDYRSYYGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWL 299
           HHDYRSYYGIVCLMQISTRE+D+LVDT+ LRE LH+LNE+FTDPS++KVFHGAFMDIIWL
Sbjct: 281 HHDYRSYYGIVCLMQISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIWL 340

Query: 300 QRDLGIYVVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRA 359
           QRDLG+YVV LFDTYHAS+++GLPRHSLAYLLE FA FKTSKKYQLADWRIRPL+KPM A
Sbjct: 341 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMIA 400

Query: 360 YARADTHFLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPIE 419
           YARADTHFLLNIYDQLRN LIE NKLA VL++SRNVAKRRFEY+ +RP+I S++V+SPIE
Sbjct: 401 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSEVYSPIE 460

Query: 420 KDEPWRNLMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDP 479
           K+ PWR LMYQYNI   +E L++ LY+WRD IARRDDESPR+VMPNQLL +LVA  P D 
Sbjct: 461 KEAPWRVLMYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPIDV 520

Query: 480 AGVLSVSNFITDYVRSNSKMLSNLIKKTLESLKNGDVSTNNAGSSQLEEKDLS-QVLSIS 538
            GV+S++N IT++VR N+K+L NLIK +L  +K+     +    S+    ++S + ++I 
Sbjct: 521 IGVISLTNGITEHVRQNAKVLVNLIKNSLRHIKDTYKEDSPVTFSESMTNEVSLEAITIP 580

Query: 539 QIQNMCLQF----NSLASKVKKANSATNS--MPKVSILFDGDHIFSNDRAVLYSKNSKIV 592
           QI+++  +F    NS  S  +  N AT S  + ++  L + D  + N+      K   I 
Sbjct: 581 QIRDIMERFSVLSNSNVSNCRAKNGATPSILLGRILPLEENDIAYKNNGLPNRVKFEDIR 640

Query: 593 IDENQLQERKLEVSEKLKEVQEPDFRLHVNVTTKETDEVSKDVSEKDDVNRASETDPLET 652
                       + + + EV++P   L  NV  K+ + ++      +DV + S T  +E 
Sbjct: 641 ARAQSFNSALSNLEDCMLEVEKPHI-LPTNV--KKIERIN-----TEDVPKHSAT--IE- 689

Query: 653 NKDEIIVLKKKKRHEPQDRKKVGNSTDVEPMDYKNAEKLLGNXXXXXXXXXXXRRFDPYT 712
           N D+I+VLKKK  H  Q      ++   + +DY     +L +           RR DP  
Sbjct: 690 NPDDIVVLKKKNIHRTQS-MNAKDTMGEKAIDYSKIPNVLSSKSDQNRRQQKKRRSDPLF 748

Query: 713 SENVGPQSAKKRKKPTPGKNMSFK 736
           +++ GP++AKK++  T G+N+SFK
Sbjct: 749 NDSDGPRAAKKKRPATRGRNVSFK 772

>KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {ON}
           similar to uniprot|Q12149 Saccharomyces cerevisiae
           YOR001W RRP6 Exonuclease component of the nuclear
           exosome contributes to the quality-control system that
           retains and degrades aberrant mRNAs in the nucleus
          Length = 735

 Score =  747 bits (1928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/738 (51%), Positives = 511/738 (69%), Gaps = 23/738 (3%)

Query: 9   LLSNLVGTVRAASALSAQDLDFFKSLDXXXXXXXXXXXXXLLNLINEVLLSIDENNDTIE 68
           +L+ ++ T+RA+SA++AQD+ F+K+LD             LL LIN++LLS+DENND IE
Sbjct: 12  VLNQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDILLSVDENNDIIE 71

Query: 69  YGKDNFQESWKDIGDIMDNLFEKSDHAFDALKRNSINQGNSNVQYLDDSSRSNLNPSKRI 128
            G +  + +W ++G++MD LFEKS+HA  A ++    + +  VQYLDDS   +    K+I
Sbjct: 72  QGSEGLESAWSNVGEVMDLLFEKSEHALAAGEKRDNGELSKTVQYLDDSPSLHDGAPKKI 131

Query: 129 EKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHYPHPYGYEIDT 188
            KPQL FK PIDN+ESHPFKPLL+ KPHALR L E L+ T E E++P+HYP PY YEID 
Sbjct: 132 LKPQLLFKRPIDNSESHPFKPLLKKKPHALRSLDESLRLTAEQEDVPAHYPQPYEYEIDH 191

Query: 189 QEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLEHHDYRSYYG 248
           QEYNES+LQI +P+PS PW++T+  WVD  ++L+ +LNEL  A EIA+DLEHHDYR+YYG
Sbjct: 192 QEYNESVLQISEPVPSLPWDETEAEWVDNTDALKLMLNELLLANEIAIDLEHHDYRTYYG 251

Query: 249 IVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWLQRDLGIYVV 308
           I CLMQISTRE+DWL+DTIALR++L +LNE+FTDP + KV HGAFMDIIWLQRDLG+Y+V
Sbjct: 252 ITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDIIWLQRDLGLYIV 311

Query: 309 SLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRAYARADTHFL 368
           SLFDTYHASR LG P+HSLAYLLE++A FKTSKKYQL+DWR+RPL K ++AYARADTHFL
Sbjct: 312 SLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKALKAYARADTHFL 371

Query: 369 LNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPIEKDEPWRNLM 428
           LNIYD +RNSLIEQNKL+ VLHDSRNVAKRRFE+T+FRPKIV++ VFSPIE+++PWR LM
Sbjct: 372 LNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSPIEREDPWRTLM 431

Query: 429 YQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDPAGVLSVSNF 488
           +QYNIP S+  L+R+LYEWRD +ARRDDESPRYV+PNQLLVSL   APT PA +++ S F
Sbjct: 432 FQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPTTPALIMATSTF 491

Query: 489 ITDYVRSNSKMLSNLIKKTLES-------LKNGDVSTNNAGSSQLEEKDLSQVLSISQIQ 541
           +T+++R N+K L+ LIKK+LES       L N   +  N+  +++  +D         I+
Sbjct: 492 VTEHIRQNAKSLALLIKKSLESSSNEFGQLLNSANTVQNSSPTKMSSED---------IE 542

Query: 542 NMCLQFNSLASKVKKANSATNSMPKVSILFDGDHIFSNDRAVLYSKNSKIVIDENQLQER 601
                F           +A   +   S LF    +   +  V Y ++   ++D N L+ R
Sbjct: 543 KNSRMFEKFLEDFSYEKAADCGISLGSSLFQKKFV-PCEEYVSYQESRASLVDHNSLENR 601

Query: 602 KLEVSEKLKEVQEPDFRLHVNVTTKETDEVS-KDVSEKDDVNRASETDPLETNKDEIIVL 660
           + +VS+K  E +    R  V++    +  V  K+   +D+ +   E    +   DE+IVL
Sbjct: 602 RHQVSKKY-EAERDIARPQVHIRAASSHAVCDKEAGAEDNESAEEENKARKEEMDEVIVL 660

Query: 661 KKKKRHEPQDRKKVGNST-DVEPMDYKNAEKLLGNXXXXXXXXXXXRRFDPYTSENVGPQ 719
           K++K    ++++ V  +T  +EP+D ++A K+L             +RFDPY +   GP 
Sbjct: 661 KQRKTLADKEQRAVDKATPSIEPLDLQSARKIL--EAPSNNVRRPKKRFDPYATLAAGPP 718

Query: 720 SAKKRKKPTPGKNMSFKN 737
           S KKRKK T G   SF+ 
Sbjct: 719 SVKKRKK-TKGLQKSFRG 735

>KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  745 bits (1923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/737 (51%), Positives = 507/737 (68%), Gaps = 17/737 (2%)

Query: 8   KLLSNLVGTVRAASALSAQDLDFFKSLDXXXXXXXXXXXXXLLNLINEVLLSIDENNDTI 67
           KLLS++V TVRA+S L+AQD+DF++SLD             L +++N ++LSIDEN +T+
Sbjct: 8   KLLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSIDENYETL 67

Query: 68  EYGKDNFQESWKDIGDIMDNLFEKSDHAFDALKRNSINQ-GNSNVQYLDDSSRSNLNPSK 126
           + GK+   ESWK + +I+DNLFEKSD + D LK  +  +  N   +Y ++++ +   P K
Sbjct: 68  DEGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKPTNPPFEYFENATTTENIPQK 127

Query: 127 RIEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHYPHPYGYEI 186
           RI KPQL F  PIDN+ESHPF PLL+ KP+AL+ + E  K     EN+P HY HPY YEI
Sbjct: 128 RINKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYAHPYEYEI 187

Query: 187 DTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLEHHDYRSY 246
           D Q YN+SILQ+R+PIPS+ W +T+ VWVD  ESL  +LN+++   EIA+DLEHHDYR+Y
Sbjct: 188 DNQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLEHHDYRTY 247

Query: 247 YGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWLQRDLGIY 306
           YGIVCLMQISTRE D+LVDTIALR +L VLNE+FTDPSV+KV HGAFMDIIWLQRDLG+Y
Sbjct: 248 YGIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWLQRDLGLY 307

Query: 307 VVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRAYARADTH 366
           +VSLFDT+HASR+LG PRHSLAYLLE+FA FKTSKKYQLADWR+RPL+K M AYARADTH
Sbjct: 308 IVSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTAYARADTH 367

Query: 367 FLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPIEKDEPWRN 426
           FLLNIYDQLRN L+E NKL  VL++SRNVAKRRFEY+ FRP++ S +V+S +EK++PWR 
Sbjct: 368 FLLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALEKEDPWRT 427

Query: 427 LMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDPAGVLSVS 486
           LM+QYNIP  RE L++ L+EWRD IARRDDESPRY+MPNQL+V+LVA  PTDPAGV+S S
Sbjct: 428 LMFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDPAGVISAS 487

Query: 487 NFITDYVRSNSKMLSNLIKKTLESLKNGDVSTNNAGSSQLEEKDLSQ-VLSISQIQNMCL 545
             +TDYVRSNSK+++NLIK  L   K+ +        +   E   S   +++SQI+    
Sbjct: 488 QVVTDYVRSNSKIIANLIKNALTRAKDQNRQLQFVADNHTRESYRSTDKMTVSQIKETAS 547

Query: 546 QFNSLASKVKKANSATNSMPKVSILFDGDHIFSNDRAVL----YSKNSKIVIDENQLQER 601
            F  +A K+   N+        S  F   + F +    L    Y    K  + + QL  R
Sbjct: 548 VFIQIAEKLGTCNNDQQQ----SKSFARSNYFGSLSKKLDIIEYKNGEKHSVKQQQLVSR 603

Query: 602 KLEVSEKLKEVQEPDFRLHVNVTTKETDEVSKDVSEKDDVNRASETDPL--ETNKDEIIV 659
               ++++ E+    + L V+   KE  ++ KD  E+      +++ P   E + DE++V
Sbjct: 604 FNTYTKQVNELTNVRYELPVH---KEPPQLQKDDVEEVKKTIIADSIPAKPEIDLDEVVV 660

Query: 660 LKKKKRHEPQDRKKVGNSTDVEPMDYKNAEKLLGNXXXXXXXXXXXRRFDPYTSENVGPQ 719
           LKK  R    ++ K+  +  ++ +DY  +EK+L             R+FDP+ + N GP+
Sbjct: 661 LKKVNRQP--NKTKLEENEKIDFIDYSKSEKILKGDKQRKKRESKKRQFDPFAASNEGPK 718

Query: 720 SAKKRKKPTPGKNMSFK 736
           +A+KRK  T G+N+S+K
Sbjct: 719 AARKRKSGTRGRNLSYK 735

>Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001W
           (REAL)
          Length = 734

 Score =  735 bits (1897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/742 (52%), Positives = 518/742 (69%), Gaps = 15/742 (2%)

Query: 1   MSSDKPDKLLSNLVGTVRAASALSAQDLDFFKSLDXXXXXXXXXXXXXLLNLINEVLLSI 60
           M S+ PD L S +V  VRAAS+L++QD+DF+K+L+             L +++NE++LSI
Sbjct: 1   MPSENPDVLFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSI 60

Query: 61  DENNDTIEYGKDNFQESWKDIGDIMDNLFEKSDHAFDALKRNSINQ-GNSNVQYLDDSSR 119
           DE++++ E  +D     WKD G+IMDNL E SDH+ D L   + ++   + +QYL D S 
Sbjct: 61  DEHHESFELKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSG 120

Query: 120 SNLNPSKRIEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHYP 179
            +   +KR+EKPQL FK  IDN+ESHPF PLL+ KP+AL+PLSE L+     EN PSHY 
Sbjct: 121 KDSLSTKRLEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPLSESLRLAEAEENNPSHYL 180

Query: 180 HPYGYEIDTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLE 239
           HPY YEID QEY+  +LQI+  IPS+ W+D++P+W+DTK  L  +L +L++A EIAVDLE
Sbjct: 181 HPYAYEIDHQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLE 240

Query: 240 HHDYRSYYGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWL 299
           HHDYRSYYGIVCLMQ+STRERD+LVDTI LR+ LH+LNE+FTDP ++KVFHGAFMDIIWL
Sbjct: 241 HHDYRSYYGIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWL 300

Query: 300 QRDLGIYVVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRA 359
           QRDLG+YVV LFDTYHAS+++GLPRHSLAYLLE FA FKTSKKYQLADWR RPL+KPM A
Sbjct: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTA 360

Query: 360 YARADTHFLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPIE 419
           YARADTHFLLNIYDQLRN LIE NKLA VL++SRNVAKRRFEY+  RP+  S++V+SPIE
Sbjct: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPIE 420

Query: 420 KDEPWRNLMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDP 479
           K+ PWR LMYQYNI   +E L++ LY WRD IARRDDESPR+VMPNQLL +LVA AP D 
Sbjct: 421 KENPWRVLMYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDV 480

Query: 480 AGVLSVSNFITDYVRSNSKMLSNLIKKTLESLKNGDVSTNNAGSSQLEEKDLS-QVLSIS 538
            GV+S++N +T++VR N+K+L+NLI+  L ++K+ +  T +  SS+ +   +S +V++IS
Sbjct: 481 IGVVSLTNGVTEHVRQNAKVLANLIENALGNIKDTNKKTTSITSSESKPDGISLEVITIS 540

Query: 539 QIQNMCLQFNSLASKVKKANSATNSMPKVSILFDGDHIFSNDRAVLYSKNS---KIVIDE 595
           QI+++  +F SL S     N+ T +    S +  G  +   +  + Y K     K+ +++
Sbjct: 541 QIRDIMERF-SLLSNSGVINNRTKTGDSTSSILLGKTLPFEECGISYGKKGTPNKVKVED 599

Query: 596 NQLQERKLEVSEKLKEVQEPDFRLHVNVTTKETDEVSKDVSEKDDVNRASETDPLETNKD 655
             ++ R  + +  L  ++   F L   VT   + E  + V    ++  A E      + D
Sbjct: 600 --IKARAQKFNSALAGLENIMFELEKPVTVPASVEKGEAV----EIESAPELPSKAESFD 653

Query: 656 EIIVLKKKKRHEPQDRKKVGNSTDVEPMDYKNAEKLLGNXXXXXXXXXXXRRFDPYTSEN 715
           +IIVLKKKK H+ Q  K   + T  E +DY     +L +           RRFDP ++++
Sbjct: 654 DIIVLKKKKMHKKQPAKG-KDMTVKEAVDYSKMPSVLSSKPGQNRKQQRKRRFDPSSNDS 712

Query: 716 VGPQSAKKRKKPTP-GKNMSFK 736
            GP++AKK K+P P GKNMSFK
Sbjct: 713 EGPRAAKK-KRPAPRGKNMSFK 733

>CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001w RRP6
          Length = 737

 Score =  730 bits (1884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/745 (51%), Positives = 513/745 (68%), Gaps = 18/745 (2%)

Query: 1   MSSDKPDKLLSNLVGTVRAASALSAQDLDFFKSLDXXXXXXXXXXXXXLLNLINEVLLSI 60
           MSSD  D +L  ++ TVRA++AL++QD++F KS+D             + +++N +LLSI
Sbjct: 1   MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 60

Query: 61  DENNDTIEYGKDNFQESWKDIGDIMDNLFEKSDHAFDALKR-NSINQGNSNVQYLDDSSR 119
           D NN+ ++   +N +E  K+  ++MD LFEK+D + D L R +S N    N+Q+LDD + 
Sbjct: 61  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNV 120

Query: 120 SNLNPSKRIEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHYP 179
           +  +PS+RI KPQLNFKTP+DN+ESHPFKPLL  KP+AL+ + E  +    TE+IP H+ 
Sbjct: 121 AENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQ 180

Query: 180 HPYGYEIDTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLE 239
            PY YEI  QEYN  IL+ ++PIPS  W DT+ +WVD   SLQ ++ EL+ + EIAVDLE
Sbjct: 181 QPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE 240

Query: 240 HHDYRSYYGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWL 299
           HHD+RSYYG+VCLMQISTR +D++VDTIALR++L +LNE+FT+P + KVFHGAFMDIIWL
Sbjct: 241 HHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWL 300

Query: 300 QRDLGIYVVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRA 359
           QRDLG+Y+VSLFDT+HAS++LGLP+HSLAYLLEK+A FKTSKKYQLADWR RPL+K M A
Sbjct: 301 QRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMA 360

Query: 360 YARADTHFLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPIE 419
           YARADTHFLLNI+DQ+RN LI   KLA VL +SRNVA RRFEY+ ++PKI  A++F+P+E
Sbjct: 361 YARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVE 420

Query: 420 KDEPWRNLMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDP 479
           K+ PWR LMYQYNIP+ +EPL+R+LYEWRD +ARRDDESPRYVMPNQLLVSLVA  P DP
Sbjct: 421 KESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDP 480

Query: 480 AGVLSVSNFITDYVRSNSKMLSNLIKKTLESLKNGDV-STNNAGSSQLE-EKDLSQVLSI 537
             V+SVS+ +TD+VR NSK L+NLIKK LE +K G+V S NN   S L+  +D  Q L  
Sbjct: 481 ISVVSVSSVVTDHVRRNSKTLANLIKKKLEEIKLGEVKSINNRLPSSLDVSQDELQFLPS 540

Query: 538 SQIQNMCLQFNSLASKVKKANSATNSMPKVSILFDGDHIFSNDRAVLYSKNSKIVIDENQ 597
            +I+ M   F  + +++ +A  +  +M    +L   + +   + AV Y   S   ++E++
Sbjct: 541 HKIELMTGAFKEIENQLTQATKSKQAMTSSVVL--SEILLHPEHAVKYHNGSACSVEESE 598

Query: 598 LQERKLEVSEKLKEVQEPDFRLHVNVTTK----ETDEVSKDVSEKDDVNRASETDPLETN 653
           L++R L   +        +  + +  +      ET+E     S++  V    + D     
Sbjct: 599 LKDRYLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIPEKQED----- 653

Query: 654 KDEIIVLKKKKRHEPQDRKKVGNSTDV--EPMDYKNAEKLLGNXXXXXXXXXXXRRFDPY 711
            DEI+VLKKKK H   D+K   +  D+  EP+DY  A  +L +           R FDPY
Sbjct: 654 MDEIVVLKKKKIHS-NDQKAKHDDGDIVEEPVDYSKA-NILASDNREVKKKDKKRVFDPY 711

Query: 712 TSENVGPQSAKKRKKPTPGKNMSFK 736
           +S   GP++AKKR+  T GK +SFK
Sbjct: 712 SSTGEGPKAAKKRRLVTKGKKISFK 736

>TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6.25
           YOR001W
          Length = 771

 Score =  727 bits (1877), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/747 (51%), Positives = 516/747 (69%), Gaps = 13/747 (1%)

Query: 1   MSSDKPDKLLSNLVGTVRAASALSAQDLDFFKSLDXXXXXXXXXXXXXLLNLINEVLLSI 60
           MS D  ++LL N+VG VRA++AL+AQD+DF+KSLD              L++ N +LLSI
Sbjct: 26  MSEDNCEELLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSI 85

Query: 61  DENNDTIEYGKDNFQESWKDIGDIMDNLFEKSDHAFDAL-KRNSINQGNSNVQYLDDSSR 119
           DEN   +E GKD   + W    +IMDNL EKSDH  DAL K N+ N   +   +LD++SR
Sbjct: 86  DENCSPLEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDALSKPNNFNGKYNETTFLDNNSR 145

Query: 120 SNLNPSKRIEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHYP 179
           +N NPSKRIEKPQL F  P+DNT+S PFKPLL  KP+AL+PL + L   PE+  +P+HY 
Sbjct: 146 TNSNPSKRIEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPTHYL 205

Query: 180 HPYGYEIDTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLE 239
            PY YEID QEYNE +++IRDP P +PWE T  +W+DTKESL  LL +LR   EIAVDLE
Sbjct: 206 QPYEYEIDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAVDLE 265

Query: 240 HHDYRSYYGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWL 299
           HHD RSYYGI CLMQISTRE+D++VDTI+LR++L VLNEIFT+P++ KVFHGA MDIIWL
Sbjct: 266 HHDLRSYYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDIIWL 325

Query: 300 QRDLGIYVVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRA 359
           QRDLG+Y+VSLFDT+HAS++LGL RHSLAYLLE +A FKTSKKYQLADWR RPLT  M A
Sbjct: 326 QRDLGLYIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNNMLA 385

Query: 360 YARADTHFLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPIE 419
           YAR+DTHFLLNI+DQLRN+LI+QNKLA VLH+SRNVAKRRFEY  FRP +   ++++ IE
Sbjct: 386 YARSDTHFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPNLYTLIE 445

Query: 420 KDEPWRNLMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDP 479
           K+ PW++L+ QYNI   +E L++KL+EWRD IARRDDESPRY+MP Q+L+SL++  PTD 
Sbjct: 446 KEAPWKSLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISYTPTDS 505

Query: 480 AGVLSVSNFITDYVRSNSKMLSNLIKKTLESLKNGDVSTNNAGSSQLEEKD--LSQVLSI 537
           +GV+SVSN +T++VRSNS  L+NLIKK LES K+   S++++ +  +   D  ++ ++SI
Sbjct: 506 SGVISVSNMVTEHVRSNSTTLANLIKKALESTKSIPNSSDSSSTFNMSRTDTNVASLISI 565

Query: 538 SQIQNMCLQFNSLASKVKKANSATNSMPKVSILFDGDHIFSNDRAVLYSKNSKIVIDENQ 597
           ++I N+CL+FNSL+     +   T+ +   S+LF  + + S+ +   YSK+         
Sbjct: 566 TEINNICLKFNSLSKHYNTSKFLTSGIEVSSLLF-SNIMTSSPKISDYSKDKTTSFKSED 624

Query: 598 LQERKLEVSEKLKEVQEPD-FRLHVNVTTKETDEVSKD---VSEKDDVNRASETDPLETN 653
           +  R + +SE LK +   + F     V   ++ E++ +    + +    +   T  +  +
Sbjct: 625 MIARHIRLSEGLKGLSANNSFIYQPPVEDIKSIEITTENPIPTLEPKSTQKKTTKEINED 684

Query: 654 KDEIIVLKKKKRHEPQDRKKVGNSTDVEPMDYKNAEKLLGNXXXXXXXXXXXRR-FDPYT 712
            +EIIVLKK  R   + +K     + V  +DY  A+K+              R+ FDPY 
Sbjct: 685 NEEIIVLKKVNRKYQKGKKDADKDSTV-VVDYSKAKKIFQKKDETINGNSKKRKSFDPYN 743

Query: 713 SE---NVGPQSAKKRKKPTPGKNMSFK 736
           ++   +  P++ KKR+  T GKN+S+K
Sbjct: 744 NDGDTDKVPRALKKRQTNTRGKNISYK 770

>NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {ON}
           Anc_6.25 YOR001W
          Length = 790

 Score =  720 bits (1859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/770 (50%), Positives = 522/770 (67%), Gaps = 46/770 (5%)

Query: 7   DKLLSNLVGTVRAASALSAQDLDFFKSLDXXXXXXXXXXXXXLLNLINEVLLSIDENNDT 66
           D+LL  +V TVRA+ AL+AQD+DF++S+D             L ++IN VLL++DEN++T
Sbjct: 26  DQLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLLAVDENSET 85

Query: 67  IEYGKDNFQESWKDIGDIMDNLFEKSDHAFDALKRNSINQGNSN-VQYLDDSSRSNLNPS 125
           ++  K+N +++WKD  ++MDNL EKSD + D L R+     N++ +QYLD+ S  +   S
Sbjct: 86  LDGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNTNTNNSNMQYLDEYSGRDDTSS 145

Query: 126 KR--IEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHYPHPYG 183
           KR  I KPQL F  P+DNTE+HPF PLL++KP+AL+ L E ++  P  EN+P HY  PY 
Sbjct: 146 KRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVPEHYAQPYE 205

Query: 184 YEIDTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLEHHDY 243
           YEID Q YN+ ILQ+ DPIPSQPW +T  +WVDT ESLQ ++ +L +  E AVDLEHHDY
Sbjct: 206 YEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFAVDLEHHDY 265

Query: 244 RSYYGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWLQRDL 303
           R+YYGIVCLMQISTR +D++VDT+ LR  L  LNE FT+P + KV HGAFMDIIWLQRDL
Sbjct: 266 RTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMDIIWLQRDL 325

Query: 304 GIYVVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRAYARA 363
           G+Y+VSLFDT+HASR+LG P++SLAYLLEKF+ FKTSKKYQ+ADWRIRPL+K M +YAR+
Sbjct: 326 GLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNSYARS 385

Query: 364 DTHFLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPIEKDEP 423
           DTHFLLNI+DQ+RN L++  KLA VL +SRNVAKRRFEY  +RP I S+ V+SPIEK +P
Sbjct: 386 DTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVYSPIEKIDP 445

Query: 424 WRNLMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDPAGVL 483
           W+ LMYQYNIPL++E L+++LY+WRD IARRDDESPRY+MPNQLLVSLVA AP +PAGV+
Sbjct: 446 WKTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYAPVEPAGVV 505

Query: 484 SVSNFITDYVRSNSKMLSNLIKKTLESLKNGDVSTNNAGSSQLEEK-------------D 530
           SVSN +TD+VRSNSK+L+NLIK  L  +K+    T +A S  L+++             D
Sbjct: 506 SVSNMVTDHVRSNSKILANLIKNCLTKIKD----TTDADSLILQQEQNQPGTSTTTTNVD 561

Query: 531 LSQVLSISQIQNMCLQFNSLASKVKK----ANSATNSMPKVSILFDGDHIFSNDR----- 581
           LS+ LSI Q+  +  QF SL SKV       N+A N+  K S L   DH+  ND      
Sbjct: 562 LSEQLSIHQLNTLKSQFLSLYSKVNHIEGVTNNARNAEKKNSFLLCTDHMSFNDEDGKNF 621

Query: 582 ---AVLYSKNSKIVIDENQLQERKLEVSEKLKEVQEPDFRLHV---NVTTKETDEVSKDV 635
              +V   K  KI  +E  L +R+    + ++++Q+ ++ + +    +   E+++    +
Sbjct: 622 IKYSVSPDKKDKITTEE--LLKREEMFDQAMEQLQQVEYSIPIPENEIVVVESEQQEPSI 679

Query: 636 SEKDDVNRASETDPLETNKDEIIVLKKKKRHEPQDRKKVGNSTD----VEPMDYKNAEKL 691
              +     +     + + DEIIVLKK  R++ + R++  +  D    +E +DY   EK+
Sbjct: 680 PAANAEITTAVASRKKEDLDEIIVLKKTNRNKGKKRERKHSDDDDEGEIEVIDYSKMEKV 739

Query: 692 LGNX-----XXXXXXXXXXRRFDPYTSENVGPQSAKKRKKPTPGKNMSFK 736
           L N                +RFDPY   N GP++ KKRK  T GKN+SFK
Sbjct: 740 LDNSNTKRNQNKNNNGNKRKRFDPYNVNNEGPRAPKKRKAMTRGKNVSFK 789

>TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/737 (50%), Positives = 501/737 (67%), Gaps = 16/737 (2%)

Query: 7   DKLLSNLVGTVRAASALSAQDLDFFKSLDXXXXXXXXXXXXXLLNLINEVLLSIDENNDT 66
           D+LL  +V T+RA+SAL+AQD+DF +SL              +++LIN +L SID+N++ 
Sbjct: 7   DQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSIDQNSEP 66

Query: 67  IEYGKDNFQESWKDIGDIMDNLFEKSDHAFDALKRNSINQGNS-NVQYLDDSSRSNLNPS 125
           +  GK+   E WKD  ++MDNLFE SD + D L R   ++ +   +++LD+SS ++  PS
Sbjct: 67  LVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGEKLKFLDNSSSNDSIPS 126

Query: 126 KRIEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHYPHPYGYE 185
           KRI KPQLNFK P++NTE  PF PLL+ KP ALRPL  I    P  + +P HY  PY YE
Sbjct: 127 KRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPL--ISDIVPGNDAVPEHYAQPYEYE 184

Query: 186 IDTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLEHHDYRS 245
           I+ QEY ES++   +PIPS+PWE T+ +WVD  E L+ ++++L+S  EIAVDLEHHDYRS
Sbjct: 185 IEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVDLEHHDYRS 244

Query: 246 YYGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWLQRDLGI 305
           YYGIVCLMQISTRERD+L+DTIALR++L +LNE+F +P +LKVFHGAFMDIIWLQRDLG+
Sbjct: 245 YYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDIIWLQRDLGL 304

Query: 306 YVVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRAYARADT 365
           YVVSLFDT+HASR++GLPRHSLAYLLEKFA FKTSKKYQLADWR+RPL+K M AYARADT
Sbjct: 305 YVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAMNAYARADT 364

Query: 366 HFLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPIEKDEPWR 425
           HFLLNIYDQLRN+LIEQNKLA VL +SRNVAKRRFEY+ FRP   S  V+ PI+K +PW+
Sbjct: 365 HFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYCPIDKPDPWK 424

Query: 426 NLMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDPAGVLSV 485
            LM+QY+I  +RE L++KLY+WRDTIARRDDESPRYVMPNQLLV L   APT+P  V+SV
Sbjct: 425 VLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPTEPINVISV 484

Query: 486 SNFITDYVRSNSKMLSNLIKKTLESL-KNGDVSTNNAGSSQLEEKDLSQVLSISQIQNMC 544
           ++ +TD+VRSNS +L++LIK TL S  K  D  T  A ++     D + +L++ QIQ + 
Sbjct: 485 NSIVTDHVRSNSLVLAHLIKNTLASSDKESDKGTFEADNNS---TDAASLLTVPQIQKLA 541

Query: 545 LQFNSLASKVKKANSATNSMPKVSILFDGDHIFSNDRAVLYSKNSKIVIDENQLQERKLE 604
             F  ++       +        SI    D + S D AV Y  N+   I + +L +R  +
Sbjct: 542 ACFAGVSRAFTILQNEYKDGRSSSIF--TDILTSEDDAVNYVGNNMDHITKKELGKRAAK 599

Query: 605 VSEKLKEVQEP-DFRLHVNVTTKETDEVSKDVSEKDDVNRASETDPLETNKDEIIVLKKK 663
             + +++  E   + + +    KE++ + +      +  + S + P E + DEII LKK 
Sbjct: 600 ALQSMEQFDEATSYYMPIPEIAKESNTMEEIRPPAPEEVKESPSPPKE-DMDEIITLKKI 658

Query: 664 KRHEPQDRKKVGNST-DVEPMDYKNAEKLLGNXXXXXXXXXXXRRFDPYTSENV---GPQ 719
           K+ + Q  K++G S  ++  +DY   +K+L             +  DPY + N     P+
Sbjct: 659 KKQKSQSPKELGISEREIPAVDYTKTKKVLATNQDKNKDKKKRKF-DPYAASNHSSDAPR 717

Query: 720 SAKKRKKPTPGKNMSFK 736
           + KKRK     +N+SFK
Sbjct: 718 APKKRKPVNRERNVSFK 734

>TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1016

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 80/175 (45%), Gaps = 16/175 (9%)

Query: 504 IKKTLESLKNGDVSTNNAGSSQLEEKDLSQVLSISQIQNMCLQFNSLASK----VKKAN- 558
           I+  +E ++N D  T +A +S L ++ L+    +S    + LQ N+L  K    + K   
Sbjct: 600 IESVVEPVENADNFTTSASTSGLMDEGLAIATVVSSPTKVSLQNNTLEEKNINEISKVAI 659

Query: 559 -SATNSMPKVSILFDGDHIFSNDRA--VLYSKNSKIVIDENQLQERKLEVSEKLKEVQ-- 613
              TN+ P  S     D +    ++  V    +SK+ I+++ +++ +L++ E  +E Q  
Sbjct: 660 PDDTNASPLASRTVVNDEVIDTTKSDNVAEKHSSKVYIEKSVIEQLRLQLEEIKRETQKS 719

Query: 614 --EPDFRLHV-NVTTKETDEVSKDVSEKDDVNRASETDPLETNKDEIIVLKKKKR 665
             E    +HV  +  K     S ++S  D  N  S T  LE    +II +  K +
Sbjct: 720 AKEASDHIHVLELENKNLKANSVNISTDDLANLKSHTQELEA---DIIQINTKNK 771

>Kwal_56.24151 s56 complement(874353..875795) [1443 bp, 480 aa] {ON}
           YPL219W (PCL8) - cyclin (Pho85p) [contig 165] FULL
          Length = 480

 Score = 32.3 bits (72), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 50/100 (50%), Gaps = 11/100 (11%)

Query: 441 MRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDPAGVLSVSNF-ITDYVRSNSKM 499
           M ++  ++  +  +  E PR +  N    S VA APT P+G  SVSNF +++   SNS  
Sbjct: 136 MDRINTFQSNVYYQGSEGPRSISQN--FASNVATAPTTPSG--SVSNFQLSEAGASNS-- 189

Query: 500 LSNLIKKTLESLKNGDVSTNNAGSSQLEEKDLSQVLSISQ 539
           L N      + L  G ++ +N    + E+  + Q+LS  Q
Sbjct: 190 LDNEQSACDDDLLTGALTVDN----EREDHRIKQILSRHQ 225

>SAKL0C12518g Chr3 (1119664..1120221) [558 bp, 185 aa] {ON} highly
           similar to uniprot|Q75AS4 Ashbya gossypii ADL154C
           ADL154Cp and some similarities with uniprot|P38013
           Saccharomyces cerevisiae YLR109w AHP1 Alkyl
           hydroperoxide reductase
          Length = 185

 Score = 31.2 bits (69), Expect = 6.8,   Method: Composition-based stats.
 Identities = 30/116 (25%), Positives = 52/116 (44%), Gaps = 22/116 (18%)

Query: 525 QLEEKDLSQVLSISQIQNMCLQFNSLASKVKK-----ANSATNSMPKVSILFDGDHIFSN 579
           +L++K +SQVL  +   +   Q  S A K  K     A++          LFD  HIF N
Sbjct: 87  ELKQKGVSQVLVTTVNDSFVTQAWSEALKCPKEVRIIADTQGEFARAGGHLFDSKHIFGN 146

Query: 580 DRAVLYSKNSKIVIDENQLQERKLEVSEKLKEVQEPDFRLHVNVTTKETDEVSKDV 635
           +R+V Y+     ++++ ++          +KE  EPD    + V     D + K++
Sbjct: 147 ERSVRYAA----IVEDGKV----------VKEFVEPD---KIGVDVSSADNILKNL 185

>Suva_8.264 Chr8 complement(477821..480517) [2697 bp, 898 aa] {ON}
           YOR211C (REAL)
          Length = 898

 Score = 31.6 bits (70), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 30/63 (47%), Gaps = 1/63 (1%)

Query: 159 RPLSEILKQTPETENIPSHYPHPYGYEI-DTQEYNESILQIRDPIPSQPWEDTDPVWVDT 217
           RP+   L  TP + N+ + +P    Y I D +E    ++++   +P+      DP+ +  
Sbjct: 263 RPIELTLVNTPNSNNVTADFPSMRLYNIKDFKEVKRMLMELNMAVPTSEAVSEDPIQLTI 322

Query: 218 KES 220
           K S
Sbjct: 323 KSS 325

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 81,913,814
Number of extensions: 3865711
Number of successful extensions: 15399
Number of sequences better than 10.0: 320
Number of HSP's gapped: 16215
Number of HSP's successfully gapped: 344
Length of query: 737
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 620
Effective length of database: 40,065,477
Effective search space: 24840595740
Effective search space used: 24840595740
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 70 (31.6 bits)