Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E01408g6.26ON30730715140.0
KLTH0C11110g6.26ON2802438511e-114
Kwal_56.224436.26ON2802148351e-111
ACR001C6.26ON3462277577e-99
TDEL0G044306.26ON3472367533e-98
KLLA0D01287g6.26ON3452097516e-98
Ecym_30296.26ON3512267456e-97
Kpol_1037.306.26ON3672577329e-95
ZYRO0C07634g6.26ON3822267278e-94
TPHA0J003806.26ON3562427134e-92
YOL001W (PHO80)6.26ON2932347006e-91
Skud_15.1616.26ON2932456996e-91
KNAG0I017506.26ON3242426974e-90
Smik_15.1696.26ON2912446892e-89
Suva_15.1746.26ON2952476851e-88
CAGL0E02541g6.26ON3422266882e-88
TBLA0A071606.26ON2682346551e-84
NDAI0C026406.26ON4272605682e-69
NCAS0D021506.26ON3692315521e-67
Skud_9.1197.240ON2851601933e-16
Suva_9.1497.240ON2861561924e-16
Smik_9.1407.240ON2851561925e-16
YIL050W (PCL7)7.240ON2851761915e-16
KNAG0D016307.240ON4381691851e-14
NCAS0E032207.240ON3411881778e-14
KLLA0C08305g7.240ON4092021752e-13
SAKL0F08602g7.240ON4741531724e-13
Ecym_43367.240ON3851491707e-13
Kwal_23.58077.240ON4651631691e-12
KLTH0A04268g7.240ON5801221691e-12
KAFR0I018407.240ON3251151662e-12
ADL075W7.240ON2071491612e-12
CAGL0M12342g7.240ON4571291654e-12
KAFR0L008807.240ON3131321563e-11
NCAS0A134807.240ON4481201574e-11
TPHA0C010907.240ON3851411503e-10
NDAI0A025607.240ON5031191494e-10
KNAG0L014707.240ON3541791476e-10
TBLA0D040707.240ON661601424e-09
TDEL0H020207.240ON3631361397e-09
ZYRO0C08118g7.240ON4051611398e-09
Kpol_2000.147.289ON3101581361e-08
Kpol_1033.137.240ON250601341e-08
TBLA0C048507.289ON3681601325e-08
Suva_5.1677.240ON424601326e-08
Smik_5.1897.240ON415601316e-08
YER059W (PCL6)7.240ON420601309e-08
Skud_5.1737.240ON420601309e-08
NDAI0E047707.240ON303571272e-07
CAGL0E02233g3.70ON2661101218e-07
YDL127W (PCL2)7.289ON3081111201e-06
NCAS0A137707.289ON3121081183e-06
Smik_4.1107.289ON3081191156e-06
ZYRO0C09284g7.289ON3111201156e-06
TDEL0H015507.289ON3091191121e-05
Kpol_1020.87.289ON2961231112e-05
Suva_14.503.70ON2791051102e-05
SAKL0F09856g7.289ON3351131093e-05
TPHA0P008107.289ON2471061074e-05
AFR159C7.289ON3081131085e-05
YDL179W (PCL9)7.289ON3041051076e-05
Kwal_23.60067.289ON304991068e-05
CAGL0J09328g7.289ON297941059e-05
Skud_4.1287.289ON3081111051e-04
Suva_4.687.289ON3051061041e-04
TBLA0A078903.70ON3611031042e-04
YNL289W (PCL1)3.70ON2791031032e-04
Smik_14.423.70ON2791031032e-04
TPHA0A005803.70ON2891141022e-04
Skud_14.483.70ON2791051022e-04
NCAS0D040706.236ON4731731032e-04
Ecym_80387.289ON3141111022e-04
NDAI0A022707.289ON3301211022e-04
KNAG0A014903.70ON2621221013e-04
Suva_4.1187.289ON3091171013e-04
TBLA0J006507.289ON3631121004e-04
Skud_4.797.289ON309111987e-04
KLTH0A05346g7.289ON301109970.001
Skud_7.1396.236ON434106970.001
ZYRO0C02068g3.70ON330118960.002
Kpol_1020.163.70ON282117940.002
KLLA0E13223g3.70ON282100930.003
KNAG0B029307.289ON312102920.004
CAGL0J06336g7.289ON314141910.005
Smik_4.607.289ON305104910.006
TDEL0E007903.70ON254110890.009
Suva_16.876.236ON501114890.012
Skud_16.606.236ON500114880.016
YPL219W (PCL8)6.236ON492114880.017
SAKL0C12100g3.70ON31498860.026
SAKL0A03938g6.236ON50185860.028
KLLA0F05654g7.289ON31199850.030
KAFR0A082803.70ON24194840.038
Smik_6.4246.236ON492114850.041
KNAG0F018706.236ON48394840.049
TBLA0B084403.70ON268114830.050
AEL195W3.70ON237108820.063
NDAI0C019805.347ON226100820.066
TPHA0A032507.289ON289111820.072
NCAS0A098703.70ON29493810.091
Kpol_1005.175.347ON319156810.11
KAFR0C015603.70ON26794800.13
KAFR0L012007.289ON27995800.14
Kwal_23.52313.70ON25696790.16
NDAI0A060503.70ON28696790.19
KLTH0A01584g3.70ON28188750.48
NCAS0A109203.321ON153350741.0
TPHA0B004204.343ON110064721.9
NCAS0H016505.347ON21098702.0
ADR383C7.37ON71786693.7
Smik_16.4547.547ON656118684.8
TDEL0E028005.347ON19979657.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E01408g
         (307 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar...   587   0.0  
KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {O...   332   e-114
Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W...   326   e-111
ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON} S...   296   7e-99
TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.2...   294   3e-98
KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} simila...   293   6e-98
Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to ...   291   6e-97
Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {O...   286   9e-95
ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} simila...   284   8e-94
TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON...   279   4e-92
YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cycli...   274   6e-91
Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W...   273   6e-91
KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26...   273   4e-90
Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W...   270   2e-89
Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W...   268   1e-88
CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} simila...   269   2e-88
TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6....   256   1e-84
NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {O...   223   2e-69
NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26     217   1e-67
Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W (...    79   3e-16
Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W (...    79   4e-16
Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W (...    79   5e-16
YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p ...    78   5e-16
KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.2...    76   1e-14
NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {O...    73   8e-14
KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {...    72   2e-13
SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} simila...    71   4e-13
Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}...    70   7e-13
Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL05...    70   1e-12
KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} simila...    70   1e-12
KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.24...    69   2e-12
ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic hom...    67   2e-12
CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa...    68   4e-12
KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.2...    65   3e-11
NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa] ...    65   4e-11
TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {O...    62   3e-10
NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.2...    62   4e-10
KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7....    61   6e-10
TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa] ...    59   4e-09
TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {O...    58   7e-09
ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} simila...    58   8e-09
Kpol_2000.14 s2000 (24019..24951) [933 bp, 310 aa] {ON} (24019.....    57   1e-08
Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON} (30454.....    56   1e-08
TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa] ...    55   5e-08
Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W ...    55   6e-08
Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W ...    55   6e-08
YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p...    55   9e-08
Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W ...    55   9e-08
NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7....    54   2e-07
CAGL0E02233g Chr5 (215934..216734) [801 bp, 266 aa] {ON} similar...    51   8e-07
YDL127W Chr4 (234927..235853) [927 bp, 308 aa] {ON}  PCL2Cyclin,...    51   1e-06
NCAS0A13770 Chr1 complement(2704299..2705237) [939 bp, 312 aa] {...    50   3e-06
Smik_4.110 Chr4 (211556..212482) [927 bp, 308 aa] {ON} YDL127W (...    49   6e-06
ZYRO0C09284g Chr3 complement(706160..707095) [936 bp, 311 aa] {O...    49   6e-06
TDEL0H01550 Chr8 (266510..267439) [930 bp, 309 aa] {ON} Anc_7.28...    48   1e-05
Kpol_1020.8 s1020 (18215..19105) [891 bp, 296 aa] {ON} (18215..1...    47   2e-05
Suva_14.50 Chr14 (84601..85440) [840 bp, 279 aa] {ON} YNL289W (R...    47   2e-05
SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {...    47   3e-05
TPHA0P00810 Chr16 complement(165632..166375) [744 bp, 247 aa] {O...    46   4e-05
AFR159C Chr6 complement(723082..724008) [927 bp, 308 aa] {ON} Sy...    46   5e-05
YDL179W Chr4 (138291..139205) [915 bp, 304 aa] {ON}  PCL9Cyclin,...    46   6e-05
Kwal_23.6006 s23 complement(1411337..1412251) [915 bp, 304 aa] {...    45   8e-05
CAGL0J09328g Chr10 (920703..921596) [894 bp, 297 aa] {ON} simila...    45   9e-05
Skud_4.128 Chr4 (230632..231558) [927 bp, 308 aa] {ON} YDL127W (...    45   1e-04
Suva_4.68 Chr4 (125518..126435) [918 bp, 305 aa] {ON} YDL179W (R...    45   1e-04
TBLA0A07890 Chr1 (1943543..1944628) [1086 bp, 361 aa] {ON} Anc_3...    45   2e-04
YNL289W Chr14 (87897..88736) [840 bp, 279 aa] {ON}  PCL1Cyclin, ...    44   2e-04
Smik_14.42 Chr14 (72224..73063) [840 bp, 279 aa] {ON} YNL289W (R...    44   2e-04
TPHA0A00580 Chr1 (101866..102735) [870 bp, 289 aa] {ON} Anc_3.70...    44   2e-04
Skud_14.48 Chr14 (81435..82274) [840 bp, 279 aa] {ON} YNL289W (R...    44   2e-04
NCAS0D04070 Chr4 (764711..766132) [1422 bp, 473 aa] {ON} Anc_6.236     44   2e-04
Ecym_8038 Chr8 complement(87401..88345) [945 bp, 314 aa] {ON} si...    44   2e-04
NDAI0A02270 Chr1 (511135..512127) [993 bp, 330 aa] {ON} Anc_7.289      44   2e-04
KNAG0A01490 Chr1 (62182..62970) [789 bp, 262 aa] {ON} Anc_3.70 Y...    44   3e-04
Suva_4.118 Chr4 (223497..224426) [930 bp, 309 aa] {ON} YDL127W (...    44   3e-04
TBLA0J00650 Chr10 complement(152884..153975) [1092 bp, 363 aa] {...    43   4e-04
Skud_4.79 Chr4 (134241..135170) [930 bp, 309 aa] {ON} YDL179W (R...    42   7e-04
KLTH0A05346g Chr1 complement(445174..446079) [906 bp, 301 aa] {O...    42   0.001
Skud_7.139 Chr7 (260060..261364) [1305 bp, 434 aa] {ON} YGL134W ...    42   0.001
ZYRO0C02068g Chr3 complement(163475..164467) [993 bp, 330 aa] {O...    42   0.002
Kpol_1020.16 s1020 complement(33477..34325) [849 bp, 282 aa] {ON...    41   0.002
KLLA0E13223g Chr5 (1170139..1170987) [849 bp, 282 aa] {ON} simil...    40   0.003
KNAG0B02930 Chr2 (563319..564257) [939 bp, 312 aa] {ON} Anc_7.28...    40   0.004
CAGL0J06336g Chr10 complement(602954..603898) [945 bp, 314 aa] {...    40   0.005
Smik_4.60 Chr4 (115068..115985) [918 bp, 305 aa] {ON} YDL179W (R...    40   0.006
TDEL0E00790 Chr5 (163333..164097) [765 bp, 254 aa] {ON} Anc_3.70...    39   0.009
Suva_16.87 Chr16 (146154..147659) [1506 bp, 501 aa] {ON} YPL219W...    39   0.012
Skud_16.60 Chr16 (110205..111707) [1503 bp, 500 aa] {ON} YPL219W...    39   0.016
YPL219W Chr16 (136750..138228) [1479 bp, 492 aa] {ON}  PCL8Cycli...    39   0.017
SAKL0C12100g Chr3 complement(1083684..1084628) [945 bp, 314 aa] ...    38   0.026
SAKL0A03938g Chr1 (367076..368581) [1506 bp, 501 aa] {ON} weakly...    38   0.028
KLLA0F05654g Chr6 (552056..552991) [936 bp, 311 aa] {ON} weakly ...    37   0.030
KAFR0A08280 Chr1 complement(1661106..1661831) [726 bp, 241 aa] {...    37   0.038
Smik_6.424 Chr6 complement(686097..687575) [1479 bp, 492 aa] {ON...    37   0.041
KNAG0F01870 Chr6 (356849..358300) [1452 bp, 483 aa] {ON} Anc_6.2...    37   0.049
TBLA0B08440 Chr2 complement(2023101..2023907) [807 bp, 268 aa] {...    37   0.050
AEL195W Chr5 (266347..267060) [714 bp, 237 aa] {ON} Syntenic hom...    36   0.063
NDAI0C01980 Chr3 complement(445212..445892) [681 bp, 226 aa] {ON...    36   0.066
TPHA0A03250 Chr1 (717085..717954) [870 bp, 289 aa] {ON} Anc_7.28...    36   0.072
NCAS0A09870 Chr1 complement(1974028..1974912) [885 bp, 294 aa] {...    36   0.091
Kpol_1005.17 s1005 (29070..30029) [960 bp, 319 aa] {ON} (29070.....    36   0.11 
KAFR0C01560 Chr3 complement(320148..320951) [804 bp, 267 aa] {ON...    35   0.13 
KAFR0L01200 Chr12 complement(225099..225938) [840 bp, 279 aa] {O...    35   0.14 
Kwal_23.5231 s23 complement(1069167..1069937) [771 bp, 256 aa] {...    35   0.16 
NDAI0A06050 Chr1 complement(1372672..1373532) [861 bp, 286 aa] {...    35   0.19 
KLTH0A01584g Chr1 (141289..142134) [846 bp, 281 aa] {ON} similar...    33   0.48 
NCAS0A10920 Chr1 (2171372..2175973) [4602 bp, 1533 aa] {ON} Anc_...    33   1.0  
TPHA0B00420 Chr2 complement(88557..91859) [3303 bp, 1100 aa] {ON...    32   1.9  
NCAS0H01650 Chr8 complement(316598..317230) [633 bp, 210 aa] {ON...    32   2.0  
ADR383C Chr4 complement(1393399..1395552) [2154 bp, 717 aa] {ON}...    31   3.7  
Smik_16.454 Chr16 complement(779609..781579) [1971 bp, 656 aa] {...    31   4.8  
TDEL0E02800 Chr5 complement(539086..539685) [600 bp, 199 aa] {ON...    30   7.6  

>SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar to
           uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 307

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/307 (95%), Positives = 292/307 (95%)

Query: 1   MSAEELXXXXXXXXXXXXXXXKNSSNSTPVEQRQCLTQAPEQTSSQIMLPDEFLKCSRTA 60
           MSAEEL               KNSSNSTPVEQRQCLTQAPEQTSSQIMLPDEFLKCSRTA
Sbjct: 1   MSAEELTANGSAGSATIASTSKNSSNSTPVEQRQCLTQAPEQTSSQIMLPDEFLKCSRTA 60

Query: 61  LVVLISRMLSSLIQMNDSMCKDKNLKLTRFHSRVPPGISVYNYLIRLAKYSSLEPAVLIA 120
           LVVLISRMLSSLIQMNDSMCKDKNLKLTRFHSRVPPGISVYNYLIRLAKYSSLEPAVLIA
Sbjct: 61  LVVLISRMLSSLIQMNDSMCKDKNLKLTRFHSRVPPGISVYNYLIRLAKYSSLEPAVLIA 120

Query: 121 AVYYIDLLSSVYPSFTLNSLTVHRFLLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNV 180
           AVYYIDLLSSVYPSFTLNSLTVHRFLLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNV
Sbjct: 121 AVYYIDLLSSVYPSFTLNSLTVHRFLLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNV 180

Query: 181 LETEFLKRVNYRIIPRDDNIFNCKEEYQQGVFITFPLADKIKGPNNGFNVLDTYYKKMIQ 240
           LETEFLKRVNYRIIPRDDNIFNCKEEYQQGVFITFPLADKIKGPNNGFNVLDTYYKKMIQ
Sbjct: 181 LETEFLKRVNYRIIPRDDNIFNCKEEYQQGVFITFPLADKIKGPNNGFNVLDTYYKKMIQ 240

Query: 241 LVGPSNSSPDKTSKVSYVLEPSEQQESQTRKRHYGQVHEDKQLNSTDIENRKKHSNLQRQ 300
           LVGPSNSSPDKTSKVSYVLEPSEQQESQTRKRHYGQVHEDKQLNSTDIENRKKHSNLQRQ
Sbjct: 241 LVGPSNSSPDKTSKVSYVLEPSEQQESQTRKRHYGQVHEDKQLNSTDIENRKKHSNLQRQ 300

Query: 301 RAGTPPR 307
           RAGTPPR
Sbjct: 301 RAGTPPR 307

>KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {ON}
           similar to uniprot|P20052 Saccharomyces cerevisiae
           YOL001W PHO80 Cyclin negatively regulates phosphate
           metabolism Pho80p-Pho85p (cyclin-CDK complex)
           phosphorylates Pho4p and Swi5p deletion of PHO80 leads
           to aminoglycoside supersensitivity truncated form of
           PHO80 affects vacuole inheritance
          Length = 280

 Score =  332 bits (851), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 158/243 (65%), Positives = 201/243 (82%), Gaps = 3/243 (1%)

Query: 41  EQTSSQIMLPDEFLKCSRTALVVLISRMLSSLIQMNDSMCKDKNLKLTRFHSRVPPGISV 100
           E    ++ LP++F +C RT LV+LISRMLS LI++NDS+ KD + +LTRFHSRVPP ISV
Sbjct: 26  EDPVPEVALPNDFSQCPRTDLVILISRMLSFLIRINDSIPKDNSSELTRFHSRVPPQISV 85

Query: 101 YNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRFLLTATTVASKGLSDS 160
           Y+YL+RL +YSSLEPAVLIA+VYYIDLLS++Y +F+LNSLTVHRFLLTATTV SKGL DS
Sbjct: 86  YDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAFSLNSLTVHRFLLTATTVGSKGLCDS 145

Query: 161 FCTNVHYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQQGVFITFPLADK 220
           FCTN HYAKVGGVQCSEL+VLE+EFLKRVNYRI+PRDDNI NCK E ++G+F+T   A +
Sbjct: 146 FCTNSHYAKVGGVQCSELHVLESEFLKRVNYRILPRDDNILNCKAERREGLFVTATYAKE 205

Query: 221 IKGPNNGFNVLDTYYKKMIQLVGPSNSSPDKTSKVSYVLE-PSEQQESQTRKRHYGQVHE 279
            +GPNNGFNVLDTYY+K+I++VG  +SSPDKT +  YV++ P   +E++  K+   + HE
Sbjct: 206 NRGPNNGFNVLDTYYQKIIEIVGSYDSSPDKTKRAHYVMKTPPAPREAEAPKKK--RAHE 263

Query: 280 DKQ 282
           + +
Sbjct: 264 ESE 266

>Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W
           (PHO80) - The Pho80p Cyclin [contig 185] FULL
          Length = 280

 Score =  326 bits (835), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 151/214 (70%), Positives = 186/214 (86%)

Query: 46  QIMLPDEFLKCSRTALVVLISRMLSSLIQMNDSMCKDKNLKLTRFHSRVPPGISVYNYLI 105
           ++ LP++F +CSRT LV+LISRMLS L ++NDS+ KD   +LTRFHSRVPP ISVY+Y++
Sbjct: 31  EVALPEDFSQCSRTDLVILISRMLSFLTRINDSVPKDDAKELTRFHSRVPPQISVYDYMM 90

Query: 106 RLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRFLLTATTVASKGLSDSFCTNV 165
           RL +YSSLEPAVL+A+VYYIDLLS++YPSF+LNSLTVHRFLLTATTVASKGL DSFCTN 
Sbjct: 91  RLTRYSSLEPAVLVASVYYIDLLSAMYPSFSLNSLTVHRFLLTATTVASKGLCDSFCTNS 150

Query: 166 HYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQQGVFITFPLADKIKGPN 225
           HYAKVGGVQCSEL+VLE+EFLK+VNYRI+PRDDNI NCK E + G+F+T   +   +GPN
Sbjct: 151 HYAKVGGVQCSELHVLESEFLKKVNYRILPRDDNISNCKAEKKAGLFVTPTYSKSCRGPN 210

Query: 226 NGFNVLDTYYKKMIQLVGPSNSSPDKTSKVSYVL 259
           NGFNVLDTYY+K+I++VG  +SSPDKT +  YV+
Sbjct: 211 NGFNVLDTYYRKIIEIVGSFDSSPDKTKRAHYVM 244

>ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL001W
           (PHO80)
          Length = 346

 Score =  296 bits (757), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 151/227 (66%), Positives = 178/227 (78%), Gaps = 7/227 (3%)

Query: 42  QTSSQIMLPDEFLKCSRTALVVLISRMLSSLIQMNDSMC-KDKNLKLTRFHSRVPPGISV 100
           ++ +++ LP +FL CSRT LVVLISRML+SLI MND+   K K +KLTRFHSRVPP ISV
Sbjct: 11  ESVTEMELPRQFLSCSRTYLVVLISRMLTSLIGMNDAQGDKSKPIKLTRFHSRVPPAISV 70

Query: 101 YNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRFLLTATTVASKGLSDS 160
           YNYLIRL KYSSLE  VL+A+VYYIDLL++VYP F L+SLTVHRFLLTATTVASKGL DS
Sbjct: 71  YNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRFLLTATTVASKGLCDS 130

Query: 161 FCTNVHYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQQGVF--ITFPLA 218
           FCTN HYAKVGGVQCSELNVLE EFL+RVNYRI+PRDDNI  C  E Q+ +F     P+ 
Sbjct: 131 FCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLERQERIFSYSNIPM- 189

Query: 219 DK---IKGPNNGFNVLDTYYKKMIQLVGPSNSSPDKTSKVSYVLEPS 262
           DK   ++  NNGF VL+ YY +MI L+G  N SPDK+  +S+ L  S
Sbjct: 190 DKDCALQDRNNGFGVLEKYYHRMIHLIGDFNMSPDKSCNLSFTLAES 236

>TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.26
           YOL001W
          Length = 347

 Score =  294 bits (753), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 156/236 (66%), Positives = 179/236 (75%), Gaps = 10/236 (4%)

Query: 45  SQIMLPDEFLKCSRTALVVLISRMLSSLIQMNDSMC--KDKNLK-LTRFHSRVPPGISVY 101
           S I LP +F KCSRT L VLISRML+ LIQ+NDS+   K +N + LTRFHSRVPPGISVY
Sbjct: 31  STIYLPRKFSKCSRTDLAVLISRMLTFLIQINDSLALSKPENARGLTRFHSRVPPGISVY 90

Query: 102 NYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRFLLTATTVASKGLSDSF 161
           NYLIRL KYSSLE  VL+ AVYYIDLLSSVYP FTL+SLTVHRFLLTATTVASKGL DSF
Sbjct: 91  NYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLSSLTVHRFLLTATTVASKGLCDSF 150

Query: 162 CTNVHYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQQGVFITF--PLAD 219
           CTN HYAKVGGV  SELN+LE EFLKRVNYRI+PRDDNI  CK E +   F  +  P   
Sbjct: 151 CTNTHYAKVGGVHSSELNILECEFLKRVNYRILPRDDNIDWCKLETKLQKFTLYEEPEMG 210

Query: 220 KIKGP-----NNGFNVLDTYYKKMIQLVGPSNSSPDKTSKVSYVLEPSEQQESQTR 270
           +   P     N+G+NVLD Y++K++QLVG   SSPDK+  V+YVL PS   +  +R
Sbjct: 211 QNSRPQNSLKNSGYNVLDAYFRKIVQLVGSYASSPDKSKVVNYVLRPSSPIKDGSR 266

>KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 345

 Score =  293 bits (751), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 173/209 (82%), Gaps = 2/209 (0%)

Query: 47  IMLPDEFLKCSRTALVVLISRMLSSLIQMNDSM-CKDKNLKLTRFHSRVPPGISVYNYLI 105
           I LP+E+L+CSRT LVV+ISRMLS LIQ+ND+    ++ ++LTRFHS+  P I+VY YLI
Sbjct: 19  IPLPEEYLRCSRTHLVVIISRMLSFLIQINDANNAGNQTMELTRFHSKAAPSITVYQYLI 78

Query: 106 RLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRFLLTATTVASKGLSDSFCTNV 165
           RL KYSSLE +VL++AVYYIDLLS+VYP FTLNSLTVHRFLLTATT+ASKGL DSFCTN 
Sbjct: 79  RLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHRFLLTATTIASKGLCDSFCTNT 138

Query: 166 HYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQQGVFITFPLADKI-KGP 224
           HY+KVGGVQCSELN+LE EFL+RV YRIIPRDDNI NCK E + G  +  P+ +   +GP
Sbjct: 139 HYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQKLGSNMLIPMKNASQRGP 198

Query: 225 NNGFNVLDTYYKKMIQLVGPSNSSPDKTS 253
           +NGFNVL  YY+K++QLVG   +SPDKTS
Sbjct: 199 DNGFNVLQNYYRKIVQLVGNPLNSPDKTS 227

>Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR001C
          Length = 351

 Score =  291 bits (745), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 172/226 (76%), Gaps = 4/226 (1%)

Query: 42  QTSSQIMLPDEFLKCSRTALVVLISRMLSSLIQMNDSMCKDKNLKLTRFHSRVPPGISVY 101
           Q   +  LP +FL CSRT LVVLISRMLSSLI++ND+  +   L+LTRFHSRVPP ISVY
Sbjct: 18  QPVPEFRLPRKFLDCSRTHLVVLISRMLSSLIRLNDAYTESNTLQLTRFHSRVPPSISVY 77

Query: 102 NYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRFLLTATTVASKGLSDSF 161
           +YLIRL KYSSLE  VL+A+VYYIDLLSSV+P F L+SLTVHRFLLTATTVASKGL DSF
Sbjct: 78  DYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVHRFLLTATTVASKGLCDSF 137

Query: 162 CTNVHYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQQGVF----ITFPL 217
           CTN HYAKVGGVQC+ELNVLE EFL RVNYRI+PRD+NI  C  E+Q+G F    I    
Sbjct: 138 CTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCSREHQEGTFSFANIPADA 197

Query: 218 ADKIKGPNNGFNVLDTYYKKMIQLVGPSNSSPDKTSKVSYVLEPSE 263
               K   N F+VL+ YY +MI L+G  ++SPDK+  +++ LE  E
Sbjct: 198 EQDQKSEENRFDVLENYYHRMIHLIGNLDASPDKSYDLNFTLEEPE 243

>Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {ON}
           complement(72024..73127) [1104 nt, 368 aa]
          Length = 367

 Score =  286 bits (732), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 151/257 (58%), Positives = 178/257 (69%), Gaps = 29/257 (11%)

Query: 22  KNSSNSTPVEQRQCLTQAPEQTSSQIMLPDEFLKCSRTALVVLISRMLSSLIQMNDSMCK 81
           KN SN   +E     T         I LP +F+ CSR+ LV LI+RMLS LI+MND+   
Sbjct: 30  KNVSNENKIEIENIET---------ITLPPKFIDCSRSDLVALIARMLSFLIEMNDNDPA 80

Query: 82  DKN-----------LKLTRFHSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSS 130
           + N           + LTRFHSRVPP ISVYNYLIRL KYSSLE  VL++ VYYIDLLSS
Sbjct: 81  NTNYLNEEPNNRSVMNLTRFHSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSS 140

Query: 131 VYPSFTLNSLTVHRFLLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVN 190
           VYP F +NSLTVHRFLLTATT+ASKGL DSFCTN HY+KVGGV CSELN+LETEFL+RVN
Sbjct: 141 VYPEFKINSLTVHRFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVN 200

Query: 191 YRIIPRDDNIFNCKEEYQQGVFITFPLAD--------KIKGPNNGFNVLDTYYKKMIQLV 242
           YRIIPRDDNI  CK E+QQ  F T   +D        +    N+GFN+LD YY K++QLV
Sbjct: 201 YRIIPRDDNIKLCKIEHQQNKF-TMDFSDLSMVGMTVQSNHQNSGFNILDIYYHKIVQLV 259

Query: 243 GPSNSSPDKTSKVSYVL 259
           G  ++S DK+ K +Y L
Sbjct: 260 GSFSASSDKSRKANYTL 276

>ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 382

 Score =  284 bits (727), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 169/226 (74%), Gaps = 13/226 (5%)

Query: 47  IMLPDEFLKCSRTALVVLISRMLSSLIQMNDSMCK---DKNLKLTRFHSRVPPGISVYNY 103
           ++LP  F +CSRT LV+LISRML+ LIQMNDS      D    LT+FHS+VPPGISVYNY
Sbjct: 45  VILPKRFSECSRTDLVILISRMLTFLIQMNDSSSTSALDSVTNLTKFHSKVPPGISVYNY 104

Query: 104 LIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRFLLTATTVASKGLSDSFCT 163
           L+RL KYSSL+  VL+AAVYYIDL+SSVYP+FTLNSLTVHRFLLTATTVASKGL DSFCT
Sbjct: 105 LMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTVHRFLLTATTVASKGLCDSFCT 164

Query: 164 NVHYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQQGVFI--------TF 215
           N HYAKVGGV CSELNVLE E L+R+NYRIIPRDDNI  C  E Q   F+          
Sbjct: 165 NTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIAWCNLESQHRHFVLDTQDGDDWT 224

Query: 216 PLADKIKG--PNNGFNVLDTYYKKMIQLVGPSNSSPDKTSKVSYVL 259
           P+   + G   N+G+NVLDTYY K++QLVG   S+ DK+  V+Y  
Sbjct: 225 PILSNLSGNRNNSGYNVLDTYYNKIVQLVGSLKSTQDKSKLVNYTF 270

>TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON}
           Anc_6.26 YOL001W
          Length = 356

 Score =  279 bits (713), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 145/242 (59%), Positives = 178/242 (73%), Gaps = 29/242 (11%)

Query: 47  IMLPDEFLKCSRTALVVLISRMLSSLIQMND--SMCKDKN------------------LK 86
           IMLP  FLKCSR+ LVVLISRML+ LIQ+ND   +  + N                  + 
Sbjct: 35  IMLPTSFLKCSRSDLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVNNKNNNNMIN 94

Query: 87  LTRFHSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRFL 146
           LTRFHSRVPP ISV NYLIRL KY+SLE +VL++++YYIDLLSSVYP F +NSLTVHRFL
Sbjct: 95  LTRFHSRVPPNISVNNYLIRLTKYASLEHSVLLSSLYYIDLLSSVYPEFKINSLTVHRFL 154

Query: 147 LTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEE 206
           L ATTVASKGLSDSFCTN HYAKVGGV+CSELN+LET+FL+R+NYRIIPRDDNI  CK E
Sbjct: 155 LAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDNIKLCKLE 214

Query: 207 YQQGVFITFPLAD--------KIKGPNNGFNVLDTYYKKMIQLVGPSNSSPDKTSKVSYV 258
            +   F T  L D        ++  PN+G+NVL+ YY+KM+Q+VG   +S DK+ KV+Y+
Sbjct: 215 KKSSQF-TLDLGDLLAANIQPELTHPNSGYNVLNIYYRKMVQIVGLLKNSTDKSKKVNYI 273

Query: 259 LE 260
           ++
Sbjct: 274 IQ 275

>YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cyclin,
           interacts with cyclin-dependent kinase Pho85p; regulates
           the response to nutrient levels and environmental
           conditions, including the response to phosphate
           limitation and stress-dependent calcium signaling
          Length = 293

 Score =  274 bits (700), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 171/234 (73%), Gaps = 12/234 (5%)

Query: 41  EQTSSQIMLPDEFLKCSRTALVVLISRMLSSLIQMNDSMC---KDKNLKLTRFHSRVPPG 97
           +Q   +++LP +F KCSRT LVVLISRML SLI +N++      D  + LTR+HS++PP 
Sbjct: 15  DQGIPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSDDQITLTRYHSKIPPN 74

Query: 98  ISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRFLLTATTVASKGL 157
           IS++NY IRL K+SSLE  VL+ ++YYIDLL +VYP FTLNSLT HRFLLTATTVA+KGL
Sbjct: 75  ISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAHRFLLTATTVATKGL 134

Query: 158 SDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQQGVFITFPL 217
            DSF TN HYAKVGGV+C ELN+LE +FLKRVNYRIIPRD NI  C  E +Q  F+    
Sbjct: 135 CDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVIDKN 194

Query: 218 A---------DKIKGPNNGFNVLDTYYKKMIQLVGPSNSSPDKTSKVSYVLEPS 262
           A           +  P +G+NVLD YY++++QLVG  N+SPDK+ KV YVL P+
Sbjct: 195 ALGSLDLDSYSYVNRPKSGYNVLDKYYRRIVQLVGSFNASPDKSRKVDYVLPPN 248

>Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W
           (REAL)
          Length = 293

 Score =  273 bits (699), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 138/245 (56%), Positives = 175/245 (71%), Gaps = 20/245 (8%)

Query: 41  EQTSSQIMLPDEFLKCSRTALVVLISRMLSSLIQMNDSMCK---DKNLKLTRFHSRVPPG 97
            Q   +++LP EF KCSRT LVVLISRML SLI +N++      D  + LTR+HS+VPP 
Sbjct: 15  HQGIPKVILPAEFYKCSRTDLVVLISRMLVSLIAINENSTTKKPDDQITLTRYHSKVPPN 74

Query: 98  ISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRFLLTATTVASKGL 157
           IS++NY IRL K+SSLE  VL+ ++YYIDLL + YP FTLNSLT HRFLLTATTVA+KGL
Sbjct: 75  ISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAKGL 134

Query: 158 SDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQQGVFITFPL 217
            DSF TN HYAKVGGV+C ELN+LE +FLKRVNYRIIPRD NI  C  E +Q  F+    
Sbjct: 135 CDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFV---- 190

Query: 218 ADK-------------IKGPNNGFNVLDTYYKKMIQLVGPSNSSPDKTSKVSYVLEPSEQ 264
           ADK             +  P +G+NVLD YY++++QLVG  N+SPDK+ KV YVL  +  
Sbjct: 191 ADKNAPGSFDLDSYSYVSRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKKVDYVLPSNID 250

Query: 265 QESQT 269
           +++++
Sbjct: 251 KDTES 255

>KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26
           YOL001W
          Length = 324

 Score =  273 bits (697), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 141/242 (58%), Positives = 168/242 (69%), Gaps = 28/242 (11%)

Query: 47  IMLPDEFLKCSRTALVVLISRMLSSLIQMNDSMCKDKN---------------------L 85
           + LP  F  CSR  L+ LISRML  LIQ+ND   + K                       
Sbjct: 24  VSLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQKKTGLADSGKGEATDAADTDGSSET 83

Query: 86  KLTRFHSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRF 145
           KLTRFHS VPP ISVYNYLIRL KYS+LEP+VL+ ++YYIDLLSSVYP+FT+NSLTVHRF
Sbjct: 84  KLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTINSLTVHRF 143

Query: 146 LLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKE 205
           LLTATTVASKGL DSFCTN HYAKVGGVQ SELN+LE+EFLK++NYR++PRDDNI  CK 
Sbjct: 144 LLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVLPRDDNITWCKY 203

Query: 206 EYQQGVFITFPLA--DKIKGP-----NNGFNVLDTYYKKMIQLVGPSNSSPDKTSKVSYV 258
           E++   F  +  A    +  P     N+G+NVL  YY K+IQLVG  +SS DK+ K +YV
Sbjct: 204 EHRAHEFTIYNKAALTNVSKPTHTQRNSGYNVLQMYYHKIIQLVGKFSSSLDKSKKANYV 263

Query: 259 LE 260
            E
Sbjct: 264 FE 265

>Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W
           (REAL)
          Length = 291

 Score =  270 bits (689), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 132/244 (54%), Positives = 176/244 (72%), Gaps = 18/244 (7%)

Query: 41  EQTSSQIMLPDEFLKCSRTALVVLISRMLSSLIQMND---SMCKDKNLKLTRFHSRVPPG 97
           +Q   +++LP +F KCSRT LVVLISRML SLI +N+   S   +  + LTR+HS++PP 
Sbjct: 15  DQGIQKVILPTDFNKCSRTDLVVLISRMLVSLIAINENSVSKIPENQITLTRYHSKIPPN 74

Query: 98  ISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRFLLTATTVASKGL 157
           IS++NY IRL K+SSLE  VL+ ++YYIDLL + YP FTLNSLT HRFLLTATT+A+KGL
Sbjct: 75  ISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTIATKGL 134

Query: 158 SDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQQGVFI---- 213
            DSF TN HYAKVGGV+C ELN+LE +FLKRVNYRIIPRD NI  C  E +Q  F+    
Sbjct: 135 CDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLCSIEQKQKKFVIDKN 194

Query: 214 --------TFPLADKIKGPNNGFNVLDTYYKKMIQLVGPSNSSPDKTSKVSYVLEPSEQQ 265
                   ++   D+   P +G+NVLD YY++++QLVG  N+SPDK+ K+ YVL  +  +
Sbjct: 195 ALGSFDLDSYSYTDR---PKSGYNVLDKYYRRIVQLVGSFNASPDKSKKIDYVLPSNIDK 251

Query: 266 ESQT 269
           ++++
Sbjct: 252 DNES 255

>Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W
           (REAL)
          Length = 295

 Score =  268 bits (685), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 133/247 (53%), Positives = 177/247 (71%), Gaps = 18/247 (7%)

Query: 41  EQTSSQIMLPDEFLKCSRTALVVLISRMLSSLIQMNDSMCK---DKNLKLTRFHSRVPPG 97
           +Q+  +I+LP EF KCSRT LVVLISRML SLI +N++      D  + LTR+HS++PP 
Sbjct: 15  DQSIPKIILPSEFKKCSRTDLVVLISRMLVSLIAINENSSTKRPDDQITLTRYHSKIPPN 74

Query: 98  ISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRFLLTATTVASKGL 157
           IS++NY IRL K+SSLE  VLI ++YYIDLL + YP FTLNSLT HRFLLTATTVA+KGL
Sbjct: 75  ISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAKGL 134

Query: 158 SDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQQGVFI---- 213
            DSF TN HY+KVGGV+C ELN+LE +FLKRVNYRI+PRD NI  C  E +Q  F+    
Sbjct: 135 CDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLCSIEQKQKTFVIDKN 194

Query: 214 --------TFPLADKIKGPNNGFNVLDTYYKKMIQLVGPSNSSPDKTSKVSYVLEPSEQQ 265
                   ++  A++ K    G+NVLD YY++++QLVG  ++SPDK+ +V+Y L  +  +
Sbjct: 195 ALGSVDLGSYSYANRSKS---GYNVLDKYYQRIVQLVGSFDASPDKSRRVNYALPSNFDE 251

Query: 266 ESQTRKR 272
           +++   R
Sbjct: 252 DNEGSAR 258

>CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001w PHO80
           cyclin
          Length = 342

 Score =  269 bits (688), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 136/226 (60%), Positives = 167/226 (73%), Gaps = 12/226 (5%)

Query: 47  IMLPDEFLKCSRTALVVLISRMLSSLIQMNDSMCKDKNLK--LTRFHSRVPPGISVYNYL 104
           I LP +FLKC +  LV+LI+RML  +IQ+NDS  K+   K  LTRFHS++ P ISV+NY 
Sbjct: 17  IKLPRDFLKCPKGDLVILIARMLQFIIQINDSNIKENERKYGLTRFHSKIAPNISVFNYF 76

Query: 105 IRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRFLLTATTVASKGLSDSFCTN 164
            RL KYS LE +VL++AVYYIDLLS+VYP+F LNSLT HRFLLTATT+ASKGL DSFCTN
Sbjct: 77  TRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLTATTIASKGLCDSFCTN 136

Query: 165 VHYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQQGVFITFPLADKIKGP 224
            HY+KVGGVQC+ELNVLE EFL++VNYRIIPRD+NI  CK E Q+  FI     +    P
Sbjct: 137 THYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQKNFFILPESIESDLAP 196

Query: 225 ----------NNGFNVLDTYYKKMIQLVGPSNSSPDKTSKVSYVLE 260
                     N G+NVL  YY K+I++VG  +SSPDKT KV+Y ++
Sbjct: 197 SLRQGYSSISNAGYNVLTRYYYKIIEVVGKYSSSPDKTKKVNYDID 242

>TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6.26
           YOL001W
          Length = 268

 Score =  256 bits (655), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 167/234 (71%), Gaps = 20/234 (8%)

Query: 47  IMLPDEFLKCSRTALVVLISRMLSSLIQMNDSMCKDKN--------LKLTRFHSRVPPGI 98
           ++L   F+KCS+  L+ LISRMLS  I +NDS     N        L LTRFHS+VPP I
Sbjct: 12  VVLDQNFMKCSKIDLITLISRMLSFFIDINDSHNIHGNVTNNRLSPLFLTRFHSKVPPNI 71

Query: 99  SVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRFLLTATTVASKGLS 158
           S+++YLIRL KYSSLE +VLI +VYYIDLLS+VYP F+LNSLTVHR+LLTATT+ASKGL 
Sbjct: 72  SIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYLLTATTIASKGLC 131

Query: 159 DSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQQGVFITFPLA 218
           DSFCTN HYAKVGG++C+ELNVLETEFL+RV YR+IPRD+ I  CK EY+       P+ 
Sbjct: 132 DSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLEYKYS-----PIE 186

Query: 219 D---KIKGP----NNGFNVLDTYYKKMIQLVGPSNSSPDKTSKVSYVLEPSEQQ 265
           D    I  P    N+G+NVL TYY KM+QLVG   SS +    V+Y+   ++ +
Sbjct: 187 DINNDIHIPDELQNSGYNVLSTYYNKMVQLVGNCKSSKNSFRNVNYIFSINQDE 240

>NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {ON}
           Anc_6.26 YOL001W
          Length = 427

 Score =  223 bits (568), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 125/260 (48%), Positives = 166/260 (63%), Gaps = 24/260 (9%)

Query: 23  NSSNSTPVEQRQ----CLTQAPEQTSSQIMLPDEFLKCSRTALVVLISRMLSSLIQMNDS 78
           N+S+ TP  Q       +T A      +I LP +F++C R  LVVLISRML +LI++ND+
Sbjct: 29  NTSSDTPSTQSHSTPNVITDAENPKHVKITLPIKFMECPRRDLVVLISRMLVTLIKINDT 88

Query: 79  MCKDKNLK---LTRFHSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSF 135
              D NL     TRFHSRV PGIS+ NYL+RL K+  L+P+VL+ AVYYIDLLS+V+PSF
Sbjct: 89  KANDNNLPSNYATRFHSRVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSF 148

Query: 136 TLNSLTVHRFLLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRIIP 195
           + NSLT HRF+LTA  VASK L DS  +  HYAK GGVQ +EL +LE  FLK + YR++P
Sbjct: 149 SFNSLTAHRFILTAVIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVLP 208

Query: 196 RDDNIFNCKEEYQQGVFITFPLAD-KIKG----------PNNGFNVLDTYYKKMIQLVG- 243
           RD N   C  EY    F TF L D +IK           P++G+NVL  YY+++I ++G 
Sbjct: 209 RDKNTDLCSMEYH---FDTFALNDGQIKESGTSFSYRQLPHSGYNVLHMYYRRIIDIIGV 265

Query: 244 --PSNSSPDKTSKVSYVLEP 261
             P + SPD  +   +++ P
Sbjct: 266 QRPISPSPDAVTVDYFLMRP 285

>NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26
          Length = 369

 Score =  217 bits (552), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 114/231 (49%), Positives = 154/231 (66%), Gaps = 20/231 (8%)

Query: 33  RQCLTQAPEQTSSQIM-LPDEFLKCSRTALVVLISRMLSSLIQMND------SMCKDKNL 85
           ++   ++P  +  Q++ +P E++KCSR+ LVVL+SRML  LIQ ND      +   D N+
Sbjct: 14  KESTAESPMTSKIQVIEVPYEYIKCSRSDLVVLVSRMLVLLIQSNDMTSNTSNSSSDSNM 73

Query: 86  KLTRFHSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRF 145
            LTRFHSR+PP IS++NYL RL KY  +E  VL++ +YYIDL ++ YP+FT NSLT HRF
Sbjct: 74  HLTRFHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNSLTAHRF 133

Query: 146 LLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKE 205
           LLTA TVA KGL DSFCT   YAK+GGVQ  ELN+LET FL+ VNYRIIPR  N+   K 
Sbjct: 134 LLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNVTLIKL 193

Query: 206 EYQQGVF-----------ITFPLADKIKGPNNGFNVLDTYYKKMIQLVGPS 245
           E    VF           ++F   D +  P+NG++VL+ YY+ ++++ G S
Sbjct: 194 ERGNQVFTLDHLDMKDPKLSFLSYDYL--PDNGYSVLNIYYQNIVRITGAS 242

>Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 79.0 bits (193), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 81/160 (50%), Gaps = 22/160 (13%)

Query: 57  SRTALVVLISRMLSSLIQMNDS-------MCKDKNLKLTR----FHSRVPPGISVYNYLI 105
           S   L+ +IS +L+ ++  ND        + KD   +L      F+ +  P ISV  YL 
Sbjct: 106 STDELIQMISALLNRIVTANDEYAEISQQVSKDNQDELLAPILAFYGKSVPEISVVQYLE 165

Query: 106 RLAKYSSLEPAVLIAAVYYIDLLSSVYPSFT-----------LNSLTVHRFLLTATTVAS 154
           R+ KY      + ++ + Y D +S  Y  F+           ++S  +HR L+T  T+ +
Sbjct: 166 RIQKYCPTTNDIFLSLLVYFDRISKKYGHFSDRNAHTKQMFGMDSGNIHRLLITGITICT 225

Query: 155 KGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRII 194
           K LSD F +N  YAKVGG+   ELN LE +FL   +++++
Sbjct: 226 KFLSDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLL 265

>Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W
           (REAL)
          Length = 286

 Score = 78.6 bits (192), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 82/156 (52%), Gaps = 22/156 (14%)

Query: 61  LVVLISRMLSSLIQMNDS-------MCKDKNLKLTR----FHSRVPPGISVYNYLIRLAK 109
           L++++S +L+ +++ ND        + +D   +L      F+ +  P I+V  YL R+ K
Sbjct: 111 LILMVSALLNKIVKANDETTDPSQQVVEDGEDELLAPVLAFYGKNVPEIAVVQYLERIQK 170

Query: 110 YSSLEPAVLIAAVYYIDLLSSVYPS-----------FTLNSLTVHRFLLTATTVASKGLS 158
           Y      + ++ + Y D +S  Y S           F ++S  +HR L+T  T+ +K +S
Sbjct: 171 YCPTTNDIFLSLLVYFDRISKNYGSSPDRNGHVRQIFVMDSGNIHRLLITGITICTKFMS 230

Query: 159 DSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRII 194
           D F +N  YAKVGG+   ELN LE +FL   +++++
Sbjct: 231 DFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLL 266

>Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 78.6 bits (192), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 81/156 (51%), Gaps = 22/156 (14%)

Query: 61  LVVLISRMLSSLIQMNDSMC----------KDKNLK-LTRFHSRVPPGISVYNYLIRLAK 109
           L++++S +L+ +I +ND+            ++K L  +  F+ +  P I V  YL R+ K
Sbjct: 110 LIIMVSALLNKIITVNDATTDISQQVPGDTEEKFLTPILAFYGKNVPEIDVVQYLERIQK 169

Query: 110 YSSLEPAVLIAAVYYIDLLSSVYPS-----------FTLNSLTVHRFLLTATTVASKGLS 158
           Y      + ++ + Y D +S  Y             F ++S  +HR L+T  T+ +K LS
Sbjct: 170 YCPTTNDIFLSLLVYFDRISKNYGHSPEENGHSKQLFVMDSGNIHRLLITGITICTKFLS 229

Query: 159 DSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRII 194
           D F +N  YAKVGG+   ELN LE +FL   +++++
Sbjct: 230 DFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLL 265

>YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p
           cyclin of the Pho80p subfamily, forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p; involved in glycogen
           metabolism, expression is cell-cycle regulated
          Length = 285

 Score = 78.2 bits (191), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 88/176 (50%), Gaps = 25/176 (14%)

Query: 41  EQTSSQIMLPDEFLKCSRTALVVLISRMLSSLIQMNDSMC----------KDKNLK-LTR 89
           EQT  +I+   +F       L+++IS +L+ +I  ND             +D+ L  +  
Sbjct: 93  EQTDVKILNIADF---PTDELILMISALLNRIITANDETTDVSQQVSDETEDELLTPILA 149

Query: 90  FHSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPS-----------FTLN 138
           F+ +  P I+V  YL R+ KY      + ++ + Y D +S  Y             F ++
Sbjct: 150 FYGKNVPEIAVVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGHSSERNGCAKQLFVMD 209

Query: 139 SLTVHRFLLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRII 194
           S  +HR L+T  T+ +K LSD F +N  YAKVGG+   ELN LE +FL   +++++
Sbjct: 210 SGNIHRLLITGVTICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLILCDFKLL 265

>KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.240
           YIL050W
          Length = 438

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 86/169 (50%), Gaps = 31/169 (18%)

Query: 61  LVVLISRMLSSLIQMND----SMCKDKNLK------LTRFHSRVPPGISVYNYLIRLAKY 110
           L  L+ +++SS  ++N+    + C+DK         +T F+ +  P I++  YL+R+ KY
Sbjct: 247 LTALLDKIVSSNDELNNGGPPAGCEDKQQDHDTINAITSFYGKHVPQITIEQYLLRIQKY 306

Query: 111 SSLEPAVLIAAVYYIDLLS--------------------SVYPSFTLNSLTVHRFLLTAT 150
                 + ++ + + D +S                    + + +F ++S  +HR L+   
Sbjct: 307 CPTTNDIFLSLLVFFDRISKKFNIHQQKQQSNVSDSDEQAPHQTFVMDSYNIHRLLIAGV 366

Query: 151 TVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYR-IIPRDD 198
           TV++K  SD F +N  YA+VGG+   E+N LE +FL   +++ +IP D+
Sbjct: 367 TVSTKFFSDFFYSNARYARVGGISLQEMNHLELQFLILCDFKLLIPIDE 415

>NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {ON}
           Anc_7.240
          Length = 341

 Score = 72.8 bits (177), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 56/188 (29%), Positives = 81/188 (43%), Gaps = 45/188 (23%)

Query: 52  EFLKCSRTALVVLISRMLSSLIQMNDSM-----------CKDKNL---KLTR----FHSR 93
           +  K S   L+ +IS +L  LI+ ND +             D N    KL R    F  +
Sbjct: 128 DITKLSTKKLIKMISTILEKLIKSNDELRERNETSLNDRTDDDNSDESKLVRSIKSFRGK 187

Query: 94  VPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVY--------------------- 132
             P I +  Y  R+ KY      VL+A + Y D +S V                      
Sbjct: 188 HIPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNISTHHHLLRN 247

Query: 133 ------PSFTLNSLTVHRFLLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFL 186
                   F L+S  +HR +++A TV++K  SD F +N  YAKVGG+   E+N LE +FL
Sbjct: 248 YDCKIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNYLELQFL 307

Query: 187 KRVNYRII 194
              N+ +I
Sbjct: 308 LISNFDLI 315

>KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {ON}
           similar to uniprot|P40186 Saccharomyces cerevisiae
           YIL050W PCL7 Pho85p cyclin of the Pho80p subfamily forms
           a functional kinase complex with Pho85p which
           phosphorylates Mmr1p and is regulated by Pho81p involved
           in glycogen metabolism expression is cell-cycle
           regulated and weakly similar to YER059W uniprot|P40038
           Saccharomyces cerevisiae YER059W PCL6 Pho85p cyclin of
           the Pho80p subfamily forms the major Glc8p kinase
           together with Pcl7p and Pho85p involved in the control
           of glycogen storage by Pho85p stabilized by Elongin C
           binding
          Length = 409

 Score = 72.0 bits (175), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 95/202 (47%), Gaps = 47/202 (23%)

Query: 61  LVVLISRMLSSLIQMNDSM--------CKDKNLKLTR----FHSRVPPGISVYNYLIRLA 108
           L+ +++ +L+ +I+ NDS+         + KN+ L R    F  +  PGI++  Y  R+ 
Sbjct: 199 LLDMLTGLLTKIIKSNDSLGSTPNFETSQGKNIPLMREILSFRGKQVPGITLKQYFQRIQ 258

Query: 109 KYSSLEPAVLIAAVYYIDLLS------------SVYPS----------------FTLNSL 140
           KY      VL++ + + D ++            SV  +                F ++S 
Sbjct: 259 KYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVVSTPDKTTASLAHQSSPQLFVMDSH 318

Query: 141 TVHRFLLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNI 200
            +HR ++ A TV++K +SD F +N  YA+VGG+   ELN LE +FL   ++R+I      
Sbjct: 319 NIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQELNHLELQFLILCDFRLII----- 373

Query: 201 FNCKEEYQQGVFITFPLADKIK 222
               EE Q+   + +   DK K
Sbjct: 374 --SVEELQRYADLLYKFWDKEK 393

>SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 474

 Score = 70.9 bits (172), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 75/153 (49%), Gaps = 19/153 (12%)

Query: 61  LVVLISRMLSSLIQMND---------SMCKDKNLKLTRFHSRVPPGISVYNYLIRLAKYS 111
           L+ +++ +L+ +++ ND         S   D   ++  F  +  P IS+  Y  R+ KY 
Sbjct: 299 LLNMLTSLLNKIVKSNDQLRNTNVQESAFNDYTSQVLSFRGKHVPAISLDQYFQRIQKYC 358

Query: 112 SLEPAVLIAAVYYIDLLS----------SVYPSFTLNSLTVHRFLLTATTVASKGLSDSF 161
                V ++ + Y D ++               F ++S  +HR ++ A TV++K  SD F
Sbjct: 359 PTTNDVFLSLLVYFDRIAKRCNINEEGEDGQQLFVMDSYNIHRLIIAAVTVSTKFFSDFF 418

Query: 162 CTNVHYAKVGGVQCSELNVLETEFLKRVNYRII 194
            +N  YA+VGG+   ELN LE +FL   ++ +I
Sbjct: 419 YSNSRYARVGGISLQELNRLELQFLILCDFELI 451

>Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}
           similar to Ashbya gossypii ADL075W
          Length = 385

 Score = 70.1 bits (170), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 79/149 (53%), Gaps = 15/149 (10%)

Query: 61  LVVLISRMLSSLIQMNDSMCK------DKNLK----LTRFHSRVPPGISVYNYLIRLAKY 110
           L+ +++ +L  +I+ ND +        D N K    +  F  +  P I++ +Y  R+ KY
Sbjct: 195 LLEMLTSLLYKIIKSNDRLKSFEQEKHDINSKYVAHVLSFRGKHIPAITLGDYFARIQKY 254

Query: 111 SSLEPAVLIAAVYYIDLLS----SVYPS-FTLNSLTVHRFLLTATTVASKGLSDSFCTNV 165
             +   V ++ + Y D ++    ++ P  F ++S  +HR ++ A TV++K  SD F +N 
Sbjct: 255 CPITNDVFLSLLVYFDRIAKRCNAMDPQLFVMDSYNIHRLIIAAVTVSTKFFSDFFYSNS 314

Query: 166 HYAKVGGVQCSELNVLETEFLKRVNYRII 194
            YA+VGG+   ELN LE +F    ++ +I
Sbjct: 315 RYARVGGISLHELNRLELQFSILCDFELI 343

>Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL050W
           (PCL7) - PHO85 cyclin [contig 11] FULL
          Length = 465

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 77/163 (47%), Gaps = 29/163 (17%)

Query: 61  LVVLISRMLSSLIQMNDSMCKDKNL------------------------KLTRFHSRVPP 96
           L+ +++ +L  +++ ND + +D+                          ++  F  +  P
Sbjct: 271 LLSMLTALLDKIVKSNDQLNRDRPFDEDQFLASARTEDADNDTRPNIASEILSFRGKHVP 330

Query: 97  GISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPS-----FTLNSLTVHRFLLTATT 151
            I++  Y  R+ KY      V ++ + Y D ++          F ++S  +HR +++A T
Sbjct: 331 AITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHGKEQLFVMDSYNIHRLIISAVT 390

Query: 152 VASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRII 194
           V++K  SD F +N  YA+VGG+   ELN LE +FL   ++ +I
Sbjct: 391 VSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFELI 433

>KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 580

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 65/122 (53%), Gaps = 7/122 (5%)

Query: 80  CKDKNL--KLTRFHSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPS--- 134
           C   +L  ++  F  +  P I+++ Y  R+ KY      V ++ + Y D ++        
Sbjct: 423 CAGHDLAAEILSFRGKHVPAITLHQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHAKE 482

Query: 135 --FTLNSLTVHRFLLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYR 192
             F ++S  +HR +++A TV++K  SD F +N  YA+VGG+   ELN LE +FL   ++ 
Sbjct: 483 QLFVMDSYNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFE 542

Query: 193 II 194
           +I
Sbjct: 543 LI 544

>KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.240
           YIL050W
          Length = 325

 Score = 68.6 bits (166), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 59/115 (51%), Gaps = 10/115 (8%)

Query: 90  FHSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPS----------FTLNS 139
           FH +  P I++  Y  R+ KY      V +  +   D ++    +          F ++S
Sbjct: 181 FHGKHVPDITIEKYFNRIQKYCPTTNDVFLLLLIAFDRIAKRCNTDSFGNKSQQLFVMDS 240

Query: 140 LTVHRFLLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRII 194
             +HRF++   TV +K LSD F +N  YAKVGG+   E+N LE +FL   ++++I
Sbjct: 241 YNIHRFIIAGVTVCTKFLSDFFYSNSRYAKVGGISVHEMNNLELQFLVLCDFKLI 295

>ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL050W (PCL7) and
           YER059W (PCL6)
          Length = 207

 Score = 66.6 bits (161), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 79/149 (53%), Gaps = 15/149 (10%)

Query: 61  LVVLISRMLSSLIQMNDSMC------KDKNLK----LTRFHSRVPPGISVYNYLIRLAKY 110
           L+ +++ +L  +I+ ND +        D N K    +  F  +  P I++ +Y  R+ KY
Sbjct: 26  LLEMLTGLLYKIIKSNDRLKPFDQEKHDINNKYVAHVLSFRGKHIPTITLGDYFARIQKY 85

Query: 111 SSLEPAVLIAAVYYIDLLS----SVYPS-FTLNSLTVHRFLLTATTVASKGLSDSFCTNV 165
             +   V ++ + Y D ++    ++ P  F ++S  +HR ++ A TV++K  SD F +N 
Sbjct: 86  CPITNDVFLSLLVYFDRIAKRCNALDPQLFVMDSYNIHRLIIAAVTVSTKFFSDFFYSNS 145

Query: 166 HYAKVGGVQCSELNVLETEFLKRVNYRII 194
            YA+VGG+   ELN LE +F    ++ +I
Sbjct: 146 RYARVGGISLEELNRLELQFSILCDFELI 174

>CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa]
           {ON} weakly similar to uniprot|P40038 Saccharomyces
           cerevisiae YER059w PCL6 cyclin like protein interacting
           with PHO85P
          Length = 457

 Score = 68.2 bits (165), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 66/129 (51%), Gaps = 15/129 (11%)

Query: 81  KDKNLK-LTRFHSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLS---------- 129
           K+K LK +  F  +  P I++Y Y  R+ KY      V ++ + Y D +S          
Sbjct: 295 KEKYLKSILSFKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSES 354

Query: 130 -SVYPS---FTLNSLTVHRFLLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEF 185
               P+   F ++S  +HR ++   TV +K  SD F +N  YA+VGG+  SELN LE +F
Sbjct: 355 ADTSPADQLFVMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQF 414

Query: 186 LKRVNYRII 194
           L   ++ ++
Sbjct: 415 LVLCDFELL 423

>KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.240
           YIL050W
          Length = 313

 Score = 64.7 bits (156), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 64/132 (48%), Gaps = 19/132 (14%)

Query: 90  FHSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPS------------FTL 137
           F  +  P I++  Y  R+ KY      V ++ + Y D + +   S            F +
Sbjct: 175 FKGKHIPQINLEQYFKRIQKYCPTTNDVFLSLLIYFDRIFNKCNSKFDNYGHDNPQIFVM 234

Query: 138 NSLTVHRFLLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRIIPRD 197
           +S  +HR ++   TV++K LSD F +N  YAKVGG+   ELN LE +FL       I  D
Sbjct: 235 DSYNIHRLIIAGVTVSTKFLSDFFYSNSRYAKVGGISLKELNYLELQFL-------ILCD 287

Query: 198 DNIFNCKEEYQQ 209
            N+    EEY++
Sbjct: 288 FNLLISIEEYER 299

>NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa]
           {ON} Anc_7.240
          Length = 448

 Score = 65.1 bits (157), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 59/120 (49%), Gaps = 15/120 (12%)

Query: 90  FHSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLS-----SVYPS---------- 134
           F  +  P IS++ Y  R+ KY      V ++ + Y D +S     SV             
Sbjct: 283 FRGKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDSPTNKSQL 342

Query: 135 FTLNSLTVHRFLLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRII 194
           F ++S  +HR ++   TV +K  SD F +N  YA+VGGV   ELN LE +FL   ++ ++
Sbjct: 343 FVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELM 402

>TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {ON}
           Anc_7.240 YIL050W
          Length = 385

 Score = 62.4 bits (150), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 63/141 (44%), Gaps = 36/141 (25%)

Query: 90  FHSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSS------------------- 130
           F  +  P IS+  Y  R+ KY  +   V ++ + Y D +S                    
Sbjct: 208 FRGKHVPQISLEQYFQRIQKYCPITNDVFLSLLVYFDRISKKCNNINLEKENVISNDADE 267

Query: 131 ----------------VYPS-FTLNSLTVHRFLLTATTVASKGLSDSFCTNVHYAKVGGV 173
                           V P  F ++S  +HR ++TA TV++K  SD F +N  YA+VGG+
Sbjct: 268 SQNNVKQMKDENNSSIVKPQVFVMDSFNIHRLIITAVTVSTKFFSDLFYSNSRYARVGGI 327

Query: 174 QCSELNVLETEFLKRVNYRII 194
              ELN LE +FL   +++++
Sbjct: 328 SLQELNHLELQFLILCDFQLM 348

>NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.240
           YER059W
          Length = 503

 Score = 62.0 bits (149), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 58/119 (48%), Gaps = 14/119 (11%)

Query: 90  FHSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPS--------------F 135
           F  +  P I+++ Y  R+ KY      V ++ + Y D +S    S              F
Sbjct: 352 FKGKHVPQITLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSTPTTNSINDNNSQMF 411

Query: 136 TLNSLTVHRFLLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRII 194
            ++S  +HR ++   TV +K  SD F +N  YA+VGG+   ELN LE +FL   ++ ++
Sbjct: 412 VMDSYNIHRLIIAGITVCTKFFSDFFYSNSRYARVGGISLQELNHLELQFLILCDFELM 470

>KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7.240
           YIL050W
          Length = 354

 Score = 61.2 bits (147), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 75/179 (41%), Gaps = 37/179 (20%)

Query: 53  FLKCSRTALVVLISRMLSSLIQMNDSMCKDKNLKLTR---------------------FH 91
            +  S   L+ +++ +L  ++Q ND +    +  L +                     F 
Sbjct: 153 LIGLSSDKLIKMLTALLDKIVQANDRLETPDSATLLKVNDDARDTDGYYESAVNAILSFK 212

Query: 92  SRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPS----------------F 135
            +  P I++  Y  R+ KY      V ++ + Y D +S    S                F
Sbjct: 213 GKHIPQITLEQYFHRIQKYCPTTNDVFLSLLIYFDRISEKCNSIPRGGDDDKVQDDTLLF 272

Query: 136 TLNSLTVHRFLLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRII 194
            +NS  +HR ++    V++K  SD F +N  YAKVGG+   E+N LE +FL   ++ ++
Sbjct: 273 VMNSYNIHRLIIAGVAVSTKFSSDFFYSNARYAKVGGISLREMNYLELQFLVLCDFSLL 331

>TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa]
           {ON} Anc_7.240 YIL050W
          Length = 661

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 39/60 (65%)

Query: 135 FTLNSLTVHRFLLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRII 194
           F ++S  +HR ++   TVA+K  SD F +N  YAKVGG+   ELN LE +FL   +++++
Sbjct: 578 FVMDSYNIHRLIIAGVTVATKFFSDYFYSNARYAKVGGITLQELNHLELQFLLLCDFKLL 637

>TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {ON}
           Anc_7.240 YIL050W
          Length = 363

 Score = 58.2 bits (139), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 59/136 (43%), Gaps = 31/136 (22%)

Query: 90  FHSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLS-------------------- 129
           F  +  P IS+ +Y  R+ KY      V ++ + Y D +S                    
Sbjct: 196 FRGKHIPQISLEHYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSNNNDTTNDNDLQYDM 255

Query: 130 -----------SVYPSFTLNSLTVHRFLLTATTVASKGLSDSFCTNVHYAKVGGVQCSEL 178
                          +F ++S  +HR L+   TV++K  SD F +N  YA+VGG+   EL
Sbjct: 256 PAKQQQQTQQTQQQQAFVMDSHNIHRLLIAGVTVSTKFFSDFFYSNSRYARVGGISLQEL 315

Query: 179 NVLETEFLKRVNYRII 194
           N LE +FL   ++ ++
Sbjct: 316 NHLELQFLVLCDFELL 331

>ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 405

 Score = 58.2 bits (139), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 67/161 (41%), Gaps = 42/161 (26%)

Query: 76  NDSMCKDKNLK-LTRFHSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPS 134
           +D +  D  L+ +  F  +  P IS+ +Y  R+ KY      V ++ + Y D +S    S
Sbjct: 219 HDGITNDSCLRSVLSFRGKHIPQISLEHYFQRIQKYCPTSNDVFLSLLVYFDRISRKCNS 278

Query: 135 -----------------------------------------FTLNSLTVHRFLLTATTVA 153
                                                    F ++S  +HR ++  TTV+
Sbjct: 279 SSRLHHENTSANDAGNNNNGHDNVKQQVHNNQQPIPAPQQQFVMDSHNIHRLIIAGTTVS 338

Query: 154 SKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRII 194
           +K  SD F +N  YA+VGG+   ELN LE +FL   ++ ++
Sbjct: 339 TKFFSDFFYSNSRYARVGGISLQELNYLELQFLILCDFELL 379

>Kpol_2000.14 s2000 (24019..24951) [933 bp, 310 aa] {ON}
           (24019..24951) [933 nt, 311 aa]
          Length = 310

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 82/158 (51%), Gaps = 17/158 (10%)

Query: 68  MLSSLIQMNDSMCKDKNLKLTRFHSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDL 127
           M+  L    DS+ +   LK +   + +P   S++ ++  L K+S+++ + L+A+  Y+  
Sbjct: 19  MICFLASTTDSIIQ---LKPSSNEANIP---SIFEFIKGLIKHSNVQTSTLMASTVYLTK 72

Query: 128 LSSVYPS--FTLNSLTVHRFLLTATTVASKGLSDSFCTNVHYAKV--GGVQCSELNVLET 183
           L S+ P+  + + S T HR  L    +A+K L+DS   N H+ K   G +  +++N +E 
Sbjct: 73  LRSILPANVYGIES-TKHRIFLGCLILAAKSLNDSSPLNKHWTKYTNGLLNLADVNTIER 131

Query: 184 EFLKRVNYRIIPRDDNIFNCKEEYQQGVFITFPLADKI 221
           E L  +N+  I + +++  C   + +      P+ DK+
Sbjct: 132 ELLAYLNWDTIIKQEDLIGCLSSFLK------PIQDKL 163

>Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON}
           (30454..31206) [753 nt, 251 aa]
          Length = 250

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 38/60 (63%)

Query: 135 FTLNSLTVHRFLLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRII 194
           F ++S  +HR ++   TV++K  SD F +N  YA+VGG+   ELN LE +FL   ++ ++
Sbjct: 163 FVMDSYNIHRLIIAGVTVSTKFFSDLFYSNSRYARVGGISLQELNNLELQFLLMCDFHLL 222

>TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa]
           {ON} Anc_7.289 YDL179W
          Length = 368

 Score = 55.5 bits (132), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 75/160 (46%), Gaps = 13/160 (8%)

Query: 51  DEFLKCSRTA----LVVLISRMLSSLIQMNDSMCKDKNLKLTRFHSRVPPGISVYNYLIR 106
           D  LK  R A    ++  +S   +S IQ+  +   D NL      S +PP   +Y ++  
Sbjct: 6   DALLKFKRKAVTGEMIQFLSNCAASAIQIRPT--SDSNLTNESI-SNIPP---LYTFIKN 59

Query: 107 LAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLN-SLTVHRFLLTATTVASKGLSDSFCTNV 165
           L  +S+++   L+  V Y+  L ++ PS       T HR  L    +A+K L+DS   N 
Sbjct: 60  LVAHSNVQTPTLMTTVVYLKKLKAIIPSNVYGIETTRHRMFLGCLIIAAKTLNDSSPLNK 119

Query: 166 HYAKV--GGVQCSELNVLETEFLKRVNYRIIPRDDNIFNC 203
           H+AK   G +Q  E+N +E E L    + +    +++  C
Sbjct: 120 HWAKYTNGLLQLREVNTIEREILTYFKWDLQITVNDLLTC 159

>Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W
           (REAL)
          Length = 424

 Score = 55.5 bits (132), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 39/60 (65%)

Query: 135 FTLNSLTVHRFLLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRII 194
           F ++S  +HR ++   TV++K LSD F +N  Y++VGG+   ELN LE +FL   ++ ++
Sbjct: 334 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 393

>Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W
           (REAL)
          Length = 415

 Score = 55.1 bits (131), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 39/60 (65%)

Query: 135 FTLNSLTVHRFLLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRII 194
           F ++S  +HR ++   TV++K LSD F +N  Y++VGG+   ELN LE +FL   ++ ++
Sbjct: 325 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 384

>YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p
           cyclin of the Pho80p subfamily; forms the major Glc8p
           kinase together with Pcl7p and Pho85p; involved in the
           control of glycogen storage by Pho85p; stabilized by
           Elongin C binding
          Length = 420

 Score = 54.7 bits (130), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 39/60 (65%)

Query: 135 FTLNSLTVHRFLLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRII 194
           F ++S  +HR ++   TV++K LSD F +N  Y++VGG+   ELN LE +FL   ++ ++
Sbjct: 330 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 389

>Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W
           (REAL)
          Length = 420

 Score = 54.7 bits (130), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 39/60 (65%)

Query: 135 FTLNSLTVHRFLLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRII 194
           F ++S  +HR ++   TV++K LSD F +N  Y++VGG+   ELN LE +FL   ++ ++
Sbjct: 330 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 389

>NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7.240
           YER059W
          Length = 303

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 36/57 (63%)

Query: 137 LNSLTVHRFLLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRI 193
           +NS TVHR +L   TV+SK LSD   +N  YA+  G+   ELN LE +FL+  N+ +
Sbjct: 227 VNSCTVHRLILAGITVSSKFLSDFTYSNKRYAQASGLTLEELNYLEFQFLRLTNFNL 283

>CAGL0E02233g Chr5 (215934..216734) [801 bp, 266 aa] {ON} similar to
           uniprot|P24867 Saccharomyces cerevisiae YNL289w PCL1
           cyclin
          Length = 266

 Score = 51.2 bits (121), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 60/110 (54%), Gaps = 4/110 (3%)

Query: 99  SVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYP-SFTLNSLTVHRFLLTATTVASKGL 157
           S+  ++ RL +Y+++    L+A V Y++ L  + P   T    T+HR  L    ++SK  
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLATVCYLNKLKRILPKDATGLPSTIHRLFLACLILSSKCH 113

Query: 158 SDSFCTNVHYAKV--GGVQCSELNVLETEFLKRVNYRI-IPRDDNIFNCK 204
           +DS   NVH+A+   G     ++N++E + L+ +N+ I +  DD I + +
Sbjct: 114 NDSSPKNVHWARYTDGLFSLEDINLMERQLLQLLNWDINVSEDDLILDLR 163

>YDL127W Chr4 (234927..235853) [927 bp, 308 aa] {ON}  PCL2Cyclin,
           interacts with cyclin-dependent kinase Pho85p; member of
           the Pcl1,2-like subfamily, involved in the regulation of
           polarized growth and morphogenesis and progression
           through the cell cycle; localizes to sites of polarized
           cell growth
          Length = 308

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 56/111 (50%), Gaps = 3/111 (2%)

Query: 96  PGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLN-SLTVHRFLLTATTVAS 154
           P   +  ++ RL K+S+++   L+A   Y+  L S+ PS       T HR  L    +A+
Sbjct: 45  PAPPLTKFINRLIKHSNVQTPTLMATSVYLAKLRSIIPSNVYGIETTRHRIFLGCLILAA 104

Query: 155 KGLSDSFCTNVHYAKV--GGVQCSELNVLETEFLKRVNYRIIPRDDNIFNC 203
           K L+DS   N H+A+   G +   E+N +E E L+  ++ +    D++  C
Sbjct: 105 KTLNDSSPLNKHWAEYTDGLLILREVNTIERELLEYFDWDVTISTDDLITC 155

>NCAS0A13770 Chr1 complement(2704299..2705237) [939 bp, 312 aa] {ON}
           Anc_7.289
          Length = 312

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 56/108 (51%), Gaps = 3/108 (2%)

Query: 99  SVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLN-SLTVHRFLLTATTVASKGL 157
           ++ N++  L K+S+++   L+A   Y+  L S+ P        T HR  L    +A+K L
Sbjct: 49  TLSNFIKALIKHSNVQTPTLMATTVYLSKLKSIIPCNVYGIETTRHRIFLGCLILAAKTL 108

Query: 158 SDSFCTNVHYAKV--GGVQCSELNVLETEFLKRVNYRIIPRDDNIFNC 203
           +DS   N H+A+   G +Q  E+N +E E L+  ++ +  +  ++  C
Sbjct: 109 NDSSPMNKHWAQYTDGLLQIREVNTIERELLEYFDWDVTIKTKDLIIC 156

>Smik_4.110 Chr4 (211556..212482) [927 bp, 308 aa] {ON} YDL127W
           (REAL)
          Length = 308

 Score = 48.9 bits (115), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 59/119 (49%), Gaps = 3/119 (2%)

Query: 96  PGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLN-SLTVHRFLLTATTVAS 154
           P   +  ++ RL K+S+++   L+A   Y+  L S+ PS       T HR  L    +A+
Sbjct: 45  PAPPLTEFINRLIKHSNVQTPTLMATSVYLAKLRSLIPSKVYGIETTRHRIFLGCLILAA 104

Query: 155 KGLSDSFCTNVHYAKV--GGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQQGV 211
           K L+DS   N H+A+   G +   E+N +E E L+  ++ +    +++  C   + + +
Sbjct: 105 KTLNDSSPLNKHWAEYTDGLLLLREVNTIERELLEYFDWDVTISTEDLITCLSPFLKKI 163

>ZYRO0C09284g Chr3 complement(706160..707095) [936 bp, 311 aa] {ON}
           some similarities with uniprot|P25693 Saccharomyces
           cerevisiae YDL127W PCL2 G1 cyclin associates with Pho85p
           cyclin-dependent kinase (Cdk) to contribute to entry
           into the mitotic cell cycle essential for cell
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 311

 Score = 48.9 bits (115), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 58/120 (48%), Gaps = 5/120 (4%)

Query: 96  PGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPS--FTLNSLTVHRFLLTATTVA 153
           P   +  ++  L  YS+++   L+A   Y+  L S+ P+  F + + T HR  L    +A
Sbjct: 43  PAPPLMRFIKTLISYSNVQTPTLMATTVYLTKLRSIIPANVFGIET-TRHRIFLGCLILA 101

Query: 154 SKGLSDSFCTNVHYAKV--GGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQQGV 211
           +K L+DS   N H+A    G +   E+N +E E L+  ++ +    + +  C   + Q +
Sbjct: 102 AKTLNDSSPLNKHWASYTDGLLHIREVNTIERELLEYFDWNVCITTEELVACLSPFLQSI 161

>TDEL0H01550 Chr8 (266510..267439) [930 bp, 309 aa] {ON} Anc_7.289
           YDL179W
          Length = 309

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 56/119 (47%), Gaps = 3/119 (2%)

Query: 96  PGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLN-SLTVHRFLLTATTVAS 154
           P  S+ N++  L  +S+++   L+A   Y+  L S+ P        T HR  L    +A+
Sbjct: 45  PAPSLTNFIKGLVLHSNVQTPTLMATAVYLAKLRSIIPGNVYGIETTRHRIFLGCLILAA 104

Query: 155 KGLSDSFCTNVHYAKV--GGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQQGV 211
           K L+DS   N H+A    G +   E+N +E E L+  ++ +     ++  C   + Q +
Sbjct: 105 KTLNDSSPLNKHWALYTDGLLHIHEVNTIERELLEYFDWNVTVTTKDLITCLAPFLQPI 163

>Kpol_1020.8 s1020 (18215..19105) [891 bp, 296 aa] {ON}
           (18215..19105) [891 nt, 297 aa]
          Length = 296

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 62/123 (50%), Gaps = 11/123 (8%)

Query: 103 YLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPS--FTLNSLTVHRFLLTATTVASKGLSDS 160
           ++  L   S+++   L+A   Y+  L ++ P   + + S T HR  L    +ASK L+DS
Sbjct: 52  FITNLCLKSNVQTPTLMATTVYLKKLKNIIPPNVYGIES-TRHRIFLGCLILASKTLNDS 110

Query: 161 FCTNVHYAKV--GGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQQGVFITFPLA 218
              N H+A+   G +Q  E+N +E E L+  ++ I    D++ +  E + Q      P+ 
Sbjct: 111 SPLNKHWARYTSGILQLREVNTIERELLEYFDWNIQITTDDLVSSLEHFIQ------PIK 164

Query: 219 DKI 221
           +KI
Sbjct: 165 EKI 167

>Suva_14.50 Chr14 (84601..85440) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 57/105 (54%), Gaps = 6/105 (5%)

Query: 92  SRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYP-SFTLNSLTVHRFLLTAT 150
           +R+P   S+  ++ RL +Y+++    L+ AV Y++ L  + P   T    T+HR  L   
Sbjct: 50  ARLP---SLMTFITRLVRYTNVYTPTLLTAVCYLNKLKRILPKDATGLPSTIHRIFLACL 106

Query: 151 TVASKGLSDSFCTNVHYAKV--GGVQCSELNVLETEFLKRVNYRI 193
            +++K  +DS   N H+AK   G     ++N++E + L+ +N+ +
Sbjct: 107 ILSAKFHNDSSPLNKHWAKYTDGLFTLEDINLMERQLLQLLNWDL 151

>SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 335

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 58/113 (51%), Gaps = 3/113 (2%)

Query: 98  ISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLN-SLTVHRFLLTATTVASKG 156
           +S+ +++  L  +S+++   L++ V Y+  L S+ P+       T HR  L    +A+K 
Sbjct: 42  VSLVDFIKGLITHSNVQTPTLMSTVVYLTRLRSIIPATVYGIETTRHRIFLGCLILAAKN 101

Query: 157 LSDSFCTNVHYAKV--GGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEY 207
           L+DS   N H+++   G +   E+N +E E L+  ++++     ++  C   +
Sbjct: 102 LNDSSPLNKHWSRYTNGLLDIREVNTIERELLEYFDWKLRIDTQDLITCLSSF 154

>TPHA0P00810 Chr16 complement(165632..166375) [744 bp, 247 aa] {ON}
           Anc_7.289 YDL179W
          Length = 247

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 56/106 (52%), Gaps = 4/106 (3%)

Query: 99  SVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTV-HRFLLTATTVASKGL 157
           S+ +++  + KYS ++   L+A+  +++ L  + P +     T  HR  L    +ASK L
Sbjct: 44  SLTSFICDVVKYSKVKTPTLMASTVFLNRLRCIIPGYVEGIATATHRLFLGCLILASKTL 103

Query: 158 SDSFCTNVHYAKV--GGVQCSELNVLETEFLKRVNYRI-IPRDDNI 200
           +DS   N H+ K   G +   E+N +E E L+ +++ + I  +D I
Sbjct: 104 NDSSPFNKHWEKYCRGLLSLMEINTIERELLEYMSWNVRISTEDLI 149

>AFR159C Chr6 complement(723082..724008) [927 bp, 308 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL127W
           (PCL2) and YDL179W (PCL9)
          Length = 308

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 58/113 (51%), Gaps = 3/113 (2%)

Query: 98  ISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTV-HRFLLTATTVASKG 156
           +S+ +++  L K S+++   L++ V Y+  L S+ P+      T  HR  L    +A+K 
Sbjct: 43  LSLVDFIKGLVKRSNVQTPTLMSTVVYLARLRSIIPANVYGIETSRHRMFLGCLILAAKN 102

Query: 157 LSDSFCTNVHYAKV--GGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEY 207
           L+DS   N H+ +   G +   E+N +E E L+  N+ +   + ++ +C   +
Sbjct: 103 LNDSSPMNKHWCRYTDGLLSLREVNTIERELLEYFNWNLRITNQDLISCLSHF 155

>YDL179W Chr4 (138291..139205) [915 bp, 304 aa] {ON}  PCL9Cyclin,
           forms a functional kinase complex with Pho85p
           cyclin-dependent kinase (Cdk), expressed in late M/early
           G1 phase, activated by Swi5p
          Length = 304

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 58/105 (55%), Gaps = 11/105 (10%)

Query: 95  PPGISVY--NYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPS--FTLNSLTVHRFLLTAT 150
           PP +S++  N +I+    S+++   L+A   Y++ L SV P   + +N+ T HR  L   
Sbjct: 46  PPDLSIFIKNVVIQ----SNVQTPTLMATSVYLNKLKSVIPKNVYGINT-TRHRIFLGCL 100

Query: 151 TVASKGLSDSFCTNVHYAKV--GGVQCSELNVLETEFLKRVNYRI 193
            +A+K L+DS   N H+     G ++  E+N +E E L+ +N+ +
Sbjct: 101 ILAAKTLNDSSPWNKHWTTYTEGLLRIREVNTIERELLEYLNWDV 145

>Kwal_23.6006 s23 complement(1411337..1412251) [915 bp, 304 aa] {ON}
           YDL127W (PCL2) - G1 cyclin [contig 12] FULL
          Length = 304

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 51/99 (51%), Gaps = 3/99 (3%)

Query: 98  ISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLN-SLTVHRFLLTATTVASKG 156
           +S+ N++  L   S+++   L++   Y+  L S+ P+  L    T HR  L    +A+K 
Sbjct: 45  VSLENFIKGLVVQSNVQTPTLMSTAVYLAKLRSIIPANVLGIETTRHRMFLGCLIIAAKN 104

Query: 157 LSDSFCTNVHYAKV--GGVQCSELNVLETEFLKRVNYRI 193
           L+DS   N H+A    G +   E+N +E E L+  ++ +
Sbjct: 105 LNDSSPMNKHWASYTNGLLDTREVNTIERELLEYFDWNL 143

>CAGL0J09328g Chr10 (920703..921596) [894 bp, 297 aa] {ON} similar
           to uniprot|P25693 Saccharomyces cerevisiae YDL127w PCL2
           and similar to uniprot|Q12477 Saccharomyces cerevisiae
           YDL179w PCL9
          Length = 297

 Score = 45.1 bits (105), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 50/94 (53%), Gaps = 3/94 (3%)

Query: 103 YLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLN-SLTVHRFLLTATTVASKGLSDSF 161
           ++ +L KYS+++   L+A   ++  L S+ P+       T HR  L    +++K L+DS 
Sbjct: 52  FIKKLVKYSNVQTPTLMATTVFLTKLRSIIPANVYGIETTRHRIFLGCLILSAKTLNDSS 111

Query: 162 CTNVHYAKV--GGVQCSELNVLETEFLKRVNYRI 193
             N H+A+   G +   E+N +E E L+  ++ +
Sbjct: 112 PLNKHWAQYTDGLLHLKEVNTIERELLEYFDWNL 145

>Skud_4.128 Chr4 (230632..231558) [927 bp, 308 aa] {ON} YDL127W
           (REAL)
          Length = 308

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 55/111 (49%), Gaps = 7/111 (6%)

Query: 94  VPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLN-SLTVHRFLLTATTV 152
            PP     N LI   K+S+++   L+A   Y+  L S+ PS       T HR  L    +
Sbjct: 46  APPLTKFINGLI---KHSNVQTPTLMATSVYLAKLRSIIPSNVYGIETTRHRIFLGCLIL 102

Query: 153 ASKGLSDSFCTNVHYAKV--GGVQCSELNVLETEFLKRVNYRI-IPRDDNI 200
           A+K L+DS   N H+A+   G +   E+N +E E L+  ++ + I  DD I
Sbjct: 103 AAKTLNDSSPLNKHWAEYTDGLLVLREVNTIERELLEYFDWDVTISTDDLI 153

>Suva_4.68 Chr4 (125518..126435) [918 bp, 305 aa] {ON} YDL179W
           (REAL)
          Length = 305

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 53/106 (50%), Gaps = 5/106 (4%)

Query: 91  HSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLN-SLTVHRFLLTA 149
           H   PP +S++  + ++   S+++   L+A   Y++ L S+ P        T HR  L  
Sbjct: 41  HGCPPPELSIF--IKKVVVQSNVQTPTLMATTVYLNKLKSIIPKNVYGIETTRHRIFLGC 98

Query: 150 TTVASKGLSDSFCTNVHYAKV--GGVQCSELNVLETEFLKRVNYRI 193
             +A+K L+DS   N H+     G ++  E+N +E E L+  N+ +
Sbjct: 99  LILAAKTLNDSSPWNKHWTTYTEGLLKVREVNTIERELLEYFNWDV 144

>TBLA0A07890 Chr1 (1943543..1944628) [1086 bp, 361 aa] {ON} Anc_3.70
           YNL289W
          Length = 361

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 56/103 (54%), Gaps = 3/103 (2%)

Query: 94  VPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLN-SLTVHRFLLTATTV 152
           +P   S+  ++ R+ +Y++++ + L+  V Y++ L  + P+  +    T+HR  L    +
Sbjct: 55  IPKLPSLMTFITRIVRYTNVQVSTLLMTVCYLNKLKKLLPADAVGIPSTIHRLFLACLIL 114

Query: 153 ASKGLSDSFCTNVHYAKV--GGVQCSELNVLETEFLKRVNYRI 193
           ++K  +DS   NVH+A    G     ++N++E + L  +++ +
Sbjct: 115 SAKFHNDSSPLNVHWANYTNGLFSVKDVNLMERQLLSLLDWNL 157

>YNL289W Chr14 (87897..88736) [840 bp, 279 aa] {ON}  PCL1Cyclin,
           interacts with cyclin-dependent kinase Pho85p; member of
           the Pcl1,2-like subfamily, involved in the regulation of
           polarized growth and morphogenesis and progression
           through the cell cycle; localizes to sites of polarized
           cell growth
          Length = 279

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 55/103 (53%), Gaps = 6/103 (5%)

Query: 92  SRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYP-SFTLNSLTVHRFLLTAT 150
           +R+P   S+  ++ RL +Y+++    L+ A  Y++ L  + P   T    T+HR  L   
Sbjct: 50  TRLP---SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPRDATGLPSTIHRIFLACL 106

Query: 151 TVASKGLSDSFCTNVHYAKV--GGVQCSELNVLETEFLKRVNY 191
            +++K  +DS   N H+A+   G     ++N++E + L+ +N+
Sbjct: 107 ILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>Smik_14.42 Chr14 (72224..73063) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 55/103 (53%), Gaps = 6/103 (5%)

Query: 92  SRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYP-SFTLNSLTVHRFLLTAT 150
           +R+P   S+  ++ RL +Y+++    L+ A  Y++ L  + P   T    T+HR  L   
Sbjct: 50  ARLP---SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPKDATGLPSTIHRIFLACL 106

Query: 151 TVASKGLSDSFCTNVHYAKV--GGVQCSELNVLETEFLKRVNY 191
            +++K  +DS   N H+A+   G     ++N++E + L+ +N+
Sbjct: 107 ILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>TPHA0A00580 Chr1 (101866..102735) [870 bp, 289 aa] {ON} Anc_3.70
           YNL289W
          Length = 289

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 61/114 (53%), Gaps = 8/114 (7%)

Query: 92  SRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSL--TVHRFLLTA 149
           S++P   S+  ++ +L +Y+++  + L+    Y+  L  + P    N L  T+HR  L  
Sbjct: 53  SKLP---SLKTFITKLVRYTNVYTSTLLTTACYLKKLQRILPK-DANGLPSTIHRIFLAC 108

Query: 150 TTVASKGLSDSFCTNVHYAKV--GGVQCSELNVLETEFLKRVNYRIIPRDDNIF 201
             +++K  +DS   N H+A+   G     ++N++E + L  +N+ I  +++++F
Sbjct: 109 LILSAKFHNDSSPLNKHWAEYTDGLFSLEDVNLMEVQLLALLNWDIRIKEEDLF 162

>Skud_14.48 Chr14 (81435..82274) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 56/105 (53%), Gaps = 6/105 (5%)

Query: 92  SRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYP-SFTLNSLTVHRFLLTAT 150
           +R+P   S+  ++ RL +Y+++    L+ A  Y++ L  + P   T    T+HR  L   
Sbjct: 50  ARLP---SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPKDATGLPSTIHRIFLACL 106

Query: 151 TVASKGLSDSFCTNVHYAKV--GGVQCSELNVLETEFLKRVNYRI 193
            +++K  +DS   N H+A+   G     ++N++E + L+ +N+ +
Sbjct: 107 ILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNWDL 151

>NCAS0D04070 Chr4 (764711..766132) [1422 bp, 473 aa] {ON} Anc_6.236
          Length = 473

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/173 (19%), Positives = 72/173 (41%), Gaps = 17/173 (9%)

Query: 27  STPVEQRQCLTQAPEQTSSQIMLPDEFLKCSRTALVVLISRMLSSLIQMNDSMCK----- 81
           +TP+E+   L    E   +     ++F + +    +  +   +  ++QM++         
Sbjct: 276 NTPIEEYTSLLTPKEIDEAS----EKFQELNTDEAITNMRESIEEILQMSNRELSIDEPL 331

Query: 82  DKNLKLTRFHSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPS------- 134
           D+ +  + F  + PP +S  +++ R+      +P V + A Y +  L  +          
Sbjct: 332 DEMIAFSNFKMKSPPSLSYADFIQRIQNKCEYDPHVYLIATYLLQTLLLIREEHSRKLKL 391

Query: 135 -FTLNSLTVHRFLLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFL 186
            F      VHR ++    +A+K L D   ++ ++ KV G+    L+ LE   L
Sbjct: 392 RFKFEKSDVHRLIIATVRIATKLLEDHVHSHEYFCKVSGISKKLLSKLEVSLL 444

>Ecym_8038 Chr8 complement(87401..88345) [945 bp, 314 aa] {ON}
           similar to Ashbya gossypii AFR159C
          Length = 314

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 55/111 (49%), Gaps = 3/111 (2%)

Query: 96  PGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLN-SLTVHRFLLTATTVAS 154
           P +S+ +++  L   S+++   L++ V Y+  L S+ P        T HR  L    +AS
Sbjct: 41  PILSLVDFIKGLINKSNVQTPTLMSTVVYLTRLRSIIPPNVHGIETTRHRIFLGCLILAS 100

Query: 155 KGLSDSFCTNVHYAKVGGVQCS--ELNVLETEFLKRVNYRIIPRDDNIFNC 203
           K L+DS   N H+ +      S  E+N +E E L+  N+ ++  + ++  C
Sbjct: 101 KNLNDSSPMNKHWCQYTNSLLSLREVNTVERELLEYFNWDLLITNKDLITC 151

>NDAI0A02270 Chr1 (511135..512127) [993 bp, 330 aa] {ON} Anc_7.289
          Length = 330

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 54/121 (44%), Gaps = 6/121 (4%)

Query: 94  VPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLN-SLTVHRFLLTATTV 152
           +PP   + N++  L  +S+++   L+A   Y+  L  + P        T HR  L    +
Sbjct: 50  IPP---LSNFIKNLVMHSNVQTPTLMATSVYLSKLRLIIPKNVYGMETTRHRIFLGCLIL 106

Query: 153 ASKGLSDSFCTNVHYAKV--GGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQQG 210
           A+K L+DS   N H+ K   G +   E+N +E E L+   + +      +  C   + Q 
Sbjct: 107 AAKTLNDSSPLNKHWTKYTDGLLHIREVNTIERELLEYFEWNVTITTSELIKCLSPFLQP 166

Query: 211 V 211
           +
Sbjct: 167 I 167

>KNAG0A01490 Chr1 (62182..62970) [789 bp, 262 aa] {ON} Anc_3.70
           YNL289W
          Length = 262

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 63/122 (51%), Gaps = 6/122 (4%)

Query: 88  TRFHSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYP--SFTLNSLTVHRF 145
           T    + P   S+  ++ +L +Y+++    L+  V Y++ L  + P  +  L S T+HR 
Sbjct: 48  TELSGKEPRLPSLRTFITKLVRYTNVYTPTLLTTVCYLNKLKRILPKDAKGLPS-TIHRL 106

Query: 146 LLTATTVASKGLSDSFCTNVHYAKV--GGVQCSELNVLETEFLKRVNYRI-IPRDDNIFN 202
            L    +++K  +DS   N H+AK   G     ++N++E + L  +N+ + + ++D I +
Sbjct: 107 FLACLILSAKYHNDSSPLNKHWAKYTDGLFSLEDINLMERQLLNLLNWDLRVEQEDLILD 166

Query: 203 CK 204
            +
Sbjct: 167 LQ 168

>Suva_4.118 Chr4 (223497..224426) [930 bp, 309 aa] {ON} YDL127W
           (REAL)
          Length = 309

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 57/117 (48%), Gaps = 3/117 (2%)

Query: 96  PGISVYNYLIRLAKYSSLE-PAVLIAAVYYIDLLSSVYPSFTLNSLTVHRFLLTATTVAS 154
           P   +  ++ RL K+S+++ P ++  +VY + L S +  +      T HR  L    +A+
Sbjct: 45  PAPPLVKFINRLIKHSNVQTPTLMATSVYLVKLRSIIPSNVYGIETTRHRIFLGCLILAA 104

Query: 155 KGLSDSFCTNVHYAKV--GGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQQ 209
           K L+DS   N H+A+   G +   E+N +E E L   ++ +    D++      + Q
Sbjct: 105 KTLNDSSPLNKHWAEYTDGLLLLREVNTIERELLGYFDWDVTISTDDLITSLSPFLQ 161

>TBLA0J00650 Chr10 complement(152884..153975) [1092 bp, 363 aa] {ON}
           Anc_7.289 YDL179W
          Length = 363

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 56/112 (50%), Gaps = 3/112 (2%)

Query: 103 YLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLN-SLTVHRFLLTATTVASKGLSDSF 161
           ++ RL  +S+++   L++ + Y+  L  + PS  +    T HR  +    +A+K L+DS 
Sbjct: 50  FIKRLIVHSNVQTPTLMSTLVYLTKLREIIPSDVVGIETTRHRIFIGCLILAAKSLNDSS 109

Query: 162 CTNVHYAKV--GGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQQGV 211
             N H+ +   G  +  E+N +E E L+  N+ +  +  +++     + Q +
Sbjct: 110 PLNRHWTQYTNGLFKIQEINTIERELLEYFNWDVTIKLPDLYTSLSAFLQPI 161

>Skud_4.79 Chr4 (134241..135170) [930 bp, 309 aa] {ON} YDL179W
           (REAL)
          Length = 309

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 55/111 (49%), Gaps = 3/111 (2%)

Query: 100 VYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLN-SLTVHRFLLTATTVASKGLS 158
           ++ ++ ++   S+++   L+A   Y++ L ++ P+       T HR  L    +A+K L+
Sbjct: 48  LFTFIKKVVIQSNVQTPTLMATTVYLNKLKNIIPTNVYGIETTRHRIFLGCLILAAKTLN 107

Query: 159 DSFCTNVHYAKV--GGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEY 207
           DS   N H++    G ++  E+N +E E L+  N+ +     ++ N    +
Sbjct: 108 DSSPWNKHWSTYTEGLLKVREVNTIERELLEYFNWDVKITSSDLINALAHF 158

>KLTH0A05346g Chr1 complement(445174..446079) [906 bp, 301 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 301

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 53/109 (48%), Gaps = 3/109 (2%)

Query: 98  ISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLN-SLTVHRFLLTATTVASKG 156
           +S+ +++  L   S+++   L++   Y+  L S+ P+       T HR  L    +A+K 
Sbjct: 43  VSLVDFIKGLVVQSNVQTPTLMSTAVYLSKLRSIIPANVHGMETTRHRVFLGCLIIAAKN 102

Query: 157 LSDSFCTNVHYAKV--GGVQCSELNVLETEFLKRVNYRIIPRDDNIFNC 203
           L+DS   N H+A    G +   E+N +E E L+  ++ +     ++  C
Sbjct: 103 LNDSSPMNKHWASYTNGLLNTREVNTIERELLEYFDWNLRISTQDLVTC 151

>Skud_7.139 Chr7 (260060..261364) [1305 bp, 434 aa] {ON} YGL134W
           (REAL)
          Length = 434

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 51/106 (48%), Gaps = 9/106 (8%)

Query: 90  FHSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLL---------SSVYPSFTLNSL 140
           F+ +  P +S  ++L R+      EPAV + A + +D L         +++     L   
Sbjct: 300 FYMKSKPSLSSVDFLRRIQDKCEYEPAVYLVATFLMDTLFLTRNERNNNALQLKLKLQEK 359

Query: 141 TVHRFLLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFL 186
            VHR ++ +  +++K L D   ++ +++KV GV    L+ LE   L
Sbjct: 360 EVHRVIIASVRLSTKLLEDFVHSHEYFSKVCGVSKRLLSKLEISLL 405

>ZYRO0C02068g Chr3 complement(163475..164467) [993 bp, 330 aa] {ON}
           similar to uniprot|P24867 Saccharomyces cerevisiae
           YNL289W PCL1 Pho85 cyclin of the Pcl1 2-like subfamily
           involved in entry into the mitotic cell cycle and
           regulation of morphogenesis localizes to sites of
           polarized cell growth
          Length = 330

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 65/118 (55%), Gaps = 9/118 (7%)

Query: 92  SRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYP--SFTLNSLTVHRFLLTA 149
           S++P   S+ +++ RL +++++  + L+    Y++ L  + P  +  L S T+HR  L  
Sbjct: 83  SKLP---SLMSFISRLVRHTNVYTSTLLVTACYLNRLKCILPKDASGLPS-TIHRMFLAC 138

Query: 150 TTVASKGLSDSFCTNVHYAKV--GGVQCSELNVLETEFLKRVNYRI-IPRDDNIFNCK 204
             +++K  +DS   N H+AK   G     ++N++E + ++ +N+ + +  DD I + +
Sbjct: 139 LILSAKFHNDSSPLNKHWAKYTDGLFSVEDVNLMERQLVQLLNWDLRVTNDDLILDLR 196

>Kpol_1020.16 s1020 complement(33477..34325) [849 bp, 282 aa] {ON}
           complement(33477..34325) [849 nt, 283 aa]
          Length = 282

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 61/117 (52%), Gaps = 9/117 (7%)

Query: 93  RVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYP--SFTLNSLTVHRFLLTAT 150
           R+P   S+  ++ +L +Y+++  + L+    Y+  L  + P  +  L S T+HR  L   
Sbjct: 51  RLP---SLMTFITKLVRYTNVYTSTLLTTTCYLKKLQRILPKDATGLPS-TIHRMFLACL 106

Query: 151 TVASKGLSDSFCTNVHYAKV--GGVQCSELNVLETEFLKRVNYRI-IPRDDNIFNCK 204
            +++K  +DS   N H+A+   G     ++N++E + L  +N+ + I  +D I + +
Sbjct: 107 IISAKYHNDSSPLNKHWAEYTDGLFSLEDVNLMEMQLLALLNWDLRINENDLILDLR 163

>KLLA0E13223g Chr5 (1170139..1170987) [849 bp, 282 aa] {ON} similar
           to uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 282

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 51/100 (51%), Gaps = 6/100 (6%)

Query: 91  HSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLN-SLTVHRFLLTA 149
           H+ VP   S+  ++ RL +Y+++  + L+  V Y++ L  + PS       T HR  L  
Sbjct: 53  HNGVP---SLMTFISRLVRYTNVYTSTLLTTVVYLNRLRELLPSDAAGLPTTCHRIFLAC 109

Query: 150 TTVASKGLSDSFCTNVHYAKV--GGVQCSELNVLETEFLK 187
             +++K  +DS   N H+ K   G     ++N++E + L+
Sbjct: 110 LILSAKYHNDSSPLNKHWTKYTDGMFTLRDVNLMERQLLQ 149

>KNAG0B02930 Chr2 (563319..564257) [939 bp, 312 aa] {ON} Anc_7.289
           YDL179W
          Length = 312

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 50/102 (49%), Gaps = 3/102 (2%)

Query: 95  PPGISVYNYLIRLAKYSSL-EPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRFLLTATTVA 153
           PP  ++  ++  L   S +  P ++ + VY + L   + P+      T HR  L    +A
Sbjct: 44  PPIPTLVEFIAGLVTNSKVGTPTLMASTVYLVRLKDILPPNIIGIETTRHRLFLGCLIIA 103

Query: 154 SKGLSDSFCTNVHYAKVGG--VQCSELNVLETEFLKRVNYRI 193
           +K L+D+   N H++K     +   E+N++E E L  + +R+
Sbjct: 104 AKTLNDNSPLNKHWSKHTNNLLPNREINIIERELLSYLRWRV 145

>CAGL0J06336g Chr10 complement(602954..603898) [945 bp, 314 aa] {ON}
           similar to uniprot|Q12477 Saccharomyces cerevisiae
           YDL179w PCL9 or uniprot|P25693 Saccharomyces cerevisiae
           YDL127w
          Length = 314

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 65/141 (46%), Gaps = 10/141 (7%)

Query: 68  MLSSLIQMNDSMCKDKNLKLTRFHSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDL 127
           ML+ LI   +SM K K        +  P  + +  ++  L   S ++ + L+A   Y+D 
Sbjct: 30  MLTFLISKTNSMIKIKK-------TNSPKPVELSLFVEELVASSKVQASTLMATAVYLDR 82

Query: 128 LSSVYPSFTLN-SLTVHRFLLTATTVASKGLSDSFCTNVHYAKV--GGVQCSELNVLETE 184
           LS + PS       T HR  L    ++SK L DS   N H+ K   G +   E+N +E E
Sbjct: 83  LSRIIPSNVCGIETTKHRMFLGCLILSSKSLDDSSLFNKHWTKYCNGLLTLKEVNSIERE 142

Query: 185 FLKRVNYRIIPRDDNIFNCKE 205
            L   N+ I  + + ++N  E
Sbjct: 143 LLSYFNWDINIQIEELYNTLE 163

>Smik_4.60 Chr4 (115068..115985) [918 bp, 305 aa] {ON} YDL179W
           (REAL)
          Length = 305

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 52/104 (50%), Gaps = 9/104 (8%)

Query: 95  PPGISVY--NYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLN-SLTVHRFLLTATT 151
           PP +S +  N +I+    S+++   L+A   Y++ L ++ P        T HR  L    
Sbjct: 47  PPDLSTFIKNVVIQ----SNVQTPTLMATSVYLNKLRNIIPRNVYGIETTRHRIFLGCLI 102

Query: 152 VASKGLSDSFCTNVHYAKV--GGVQCSELNVLETEFLKRVNYRI 193
           +A+K L+DS   N H+     G ++  E+N +E E L+  N+ +
Sbjct: 103 LAAKTLNDSSPWNKHWTTYTEGLLRVREVNTIERELLEYFNWDV 146

>TDEL0E00790 Chr5 (163333..164097) [765 bp, 254 aa] {ON} Anc_3.70
           YNL289W
          Length = 254

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 57/110 (51%), Gaps = 12/110 (10%)

Query: 95  PPGI-------SVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYP--SFTLNSLTVHRF 145
           PPG        S+ +++ RL +++++  + L+    Y++ L  + P  +  L S TVHR 
Sbjct: 40  PPGSPKGNKLPSLMSFISRLVRHTNVYTSTLLTTACYLNKLKCILPKDASGLPS-TVHRI 98

Query: 146 LLTATTVASKGLSDSFCTNVHYAKVGG--VQCSELNVLETEFLKRVNYRI 193
            L    +++K  +DS   N H+AK         ++N++E + ++ +N+ +
Sbjct: 99  FLACLILSAKFHNDSSPLNRHWAKYTDELFTLEDINLMERQLIQLLNWDL 148

>Suva_16.87 Chr16 (146154..147659) [1506 bp, 501 aa] {ON} YPL219W
           (REAL)
          Length = 501

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 46/114 (40%), Gaps = 8/114 (7%)

Query: 86  KLTRFHSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLL--------SSVYPSFTL 137
           K   F  + PP +S  +++ R+         V + A Y + L+          +     L
Sbjct: 361 KFVNFTMKNPPSLSFKDFIDRIQNKCMFGAIVYLGATYLLQLVFLTRDELDGPIKLKAKL 420

Query: 138 NSLTVHRFLLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNY 191
                HR +++   +A+K L D   +  +  KV G+    L  LE  FL  VN+
Sbjct: 421 QEDQTHRIIISTIRIATKLLEDFVHSQNYICKVFGISKRLLTKLEISFLASVNF 474

>Skud_16.60 Chr16 (110205..111707) [1503 bp, 500 aa] {ON} YPL219W
           (REAL)
          Length = 500

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 46/114 (40%), Gaps = 8/114 (7%)

Query: 86  KLTRFHSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLL--------SSVYPSFTL 137
           K   F  + PP +S  +++ R+         V + A Y + L+          V     L
Sbjct: 360 KFVNFIMKNPPSLSFKDFIDRIQNKCMFGSVVYLGATYLLQLVFLTRDEMNGPVKLKAKL 419

Query: 138 NSLTVHRFLLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNY 191
                HR +++A  + +K L D   +  +  KV G+    L  LE  F+  VN+
Sbjct: 420 QEDQAHRVIISAIRITTKLLEDFVHSQNYICKVFGISKRLLTKLEISFMASVNF 473

>YPL219W Chr16 (136750..138228) [1479 bp, 492 aa] {ON}  PCL8Cyclin,
           interacts with Pho85p cyclin-dependent kinase (Cdk) to
           phosphorylate and regulate glycogen synthase, also
           activates Pho85p for Glc8p phosphorylation
          Length = 492

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 46/114 (40%), Gaps = 8/114 (7%)

Query: 86  KLTRFHSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLL--------SSVYPSFTL 137
           K   F  + PP +S  +++ R+         V + A Y + L+          +     L
Sbjct: 352 KFVNFVMKNPPSLSFRDFIDRIQNKCMFGAVVYLGATYLLQLVFLTRDEMDGPIKLKAKL 411

Query: 138 NSLTVHRFLLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNY 191
                HR +++   +A+K L D   +  +  KV G+    L  LE  F+  VN+
Sbjct: 412 QEDQAHRIIISTIRIATKLLEDFVHSQNYICKVFGISKRLLTKLEISFMASVNF 465

>SAKL0C12100g Chr3 complement(1083684..1084628) [945 bp, 314 aa]
           {ON} similar to gnl|GLV|CAGL0E02233g Candida glabrata
           CAGL0E02233g and some similarites with YNL289W
           uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 314

 Score = 37.7 bits (86), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 22/98 (22%), Positives = 52/98 (53%), Gaps = 3/98 (3%)

Query: 99  SVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYP-SFTLNSLTVHRFLLTATTVASKGL 157
           S+  ++ +L +Y+++  + L+  V Y+  L ++ P   T    T HR  L    +++K  
Sbjct: 55  SLMTFITKLVRYTNVYTSTLLTTVCYLSKLKTILPRDATGLPSTTHRIFLACLILSAKFH 114

Query: 158 SDSFCTNVHYAKV--GGVQCSELNVLETEFLKRVNYRI 193
           +DS   N H+++   G     ++N++E + L+ +++ +
Sbjct: 115 NDSSPLNAHWSRYTDGLFSLEDVNLMERQLLQLLHWDL 152

>SAKL0A03938g Chr1 (367076..368581) [1506 bp, 501 aa] {ON} weakly
           similar to uniprot|Q6B153 Saccharomyces cerevisiae
           YPL219W PCL8 Cyclin interacts with Pho85p
           cyclin-dependent kinase (Cdk) to phosphorylate and
           regulate glycogen synthase also activates Pho85p for
           Glc8p phosphorylation
          Length = 501

 Score = 37.7 bits (86), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 40/85 (47%), Gaps = 7/85 (8%)

Query: 96  PGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLL-------SSVYPSFTLNSLTVHRFLLT 148
           P +S   YL R+       P V + A Y +  L       S +  SF L    +HR ++ 
Sbjct: 374 PSLSYEEYLERIHSKLMFSPVVYLTATYLLHELTLTRQQDSKLALSFPLKITQIHRIIIA 433

Query: 149 ATTVASKGLSDSFCTNVHYAKVGGV 173
           +  +A+K L D   ++ +++KV GV
Sbjct: 434 SIRLAAKLLEDFVHSHAYFSKVCGV 458

>KLLA0F05654g Chr6 (552056..552991) [936 bp, 311 aa] {ON} weakly
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p
           cyclin-dependent kinase (Cdk) to contribute to entry
           into the mitotic cell cycle essential for cell
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 311

 Score = 37.4 bits (85), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 48/99 (48%), Gaps = 3/99 (3%)

Query: 98  ISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLN-SLTVHRFLLTATTVASKG 156
           +S+ +++  L ++S+++   L+A   Y+  L S+ P        T HR  +    +A+K 
Sbjct: 44  VSLVDFIKSLIRHSNVQTPTLMATTVYLTKLRSILPHDVCGIETTRHRIFIGCLILAAKN 103

Query: 157 LSDSFCTNVHYAKV--GGVQCSELNVLETEFLKRVNYRI 193
           L+DS   N H+     G     ++N +E E L   ++ +
Sbjct: 104 LNDSSPLNKHWTNYTDGLFTLEDVNTIERELLSLFSWNL 142

>KAFR0A08280 Chr1 complement(1661106..1661831) [726 bp, 241 aa] {ON}
           Anc_3.70 YNL289W
          Length = 241

 Score = 37.0 bits (84), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 45/94 (47%), Gaps = 3/94 (3%)

Query: 103 YLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLN-SLTVHRFLLTATTVASKGLSDSF 161
           ++ +L +Y+ +    L+  + Y++ L  + P        T+HR  L    +++K  +DS 
Sbjct: 59  FICKLVEYTHVYTPTLLMTISYLNRLRRILPKGAAGIPSTLHRIFLACLIISAKNHNDSS 118

Query: 162 CTNVHYAKV--GGVQCSELNVLETEFLKRVNYRI 193
             N H+ K   G     ++N++E   L  +N+ +
Sbjct: 119 PLNRHWTKYTDGLFTLEDVNLMERHLLDLLNWNL 152

>Smik_6.424 Chr6 complement(686097..687575) [1479 bp, 492 aa] {ON}
           YPL219W (REAL)
          Length = 492

 Score = 37.4 bits (85), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 46/114 (40%), Gaps = 8/114 (7%)

Query: 86  KLTRFHSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLL--------SSVYPSFTL 137
           K   F  + PP +S  +++ R+         V + A Y + L+          +     L
Sbjct: 352 KFVNFVMKNPPSLSFRDFIDRIQNKCMFGAVVYLGATYLLQLVFLTRDEMNGPIKLKTKL 411

Query: 138 NSLTVHRFLLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNY 191
                HR +++   +A+K L D   +  +  KV G+    L  LE  F+  VN+
Sbjct: 412 QEDQAHRIIISTIRIATKLLEDFVHSQNYICKVFGISKRLLTKLEISFMACVNF 465

>KNAG0F01870 Chr6 (356849..358300) [1452 bp, 483 aa] {ON} Anc_6.236
           YGL134W
          Length = 483

 Score = 37.0 bits (84), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 46/94 (48%), Gaps = 8/94 (8%)

Query: 88  TRFHSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLL--------SSVYPSFTLNS 139
           +RF  +  P +S  +++ R+      +  V ++A Y + +L        +S+   F L  
Sbjct: 349 SRFIMKNIPSLSFVDFIKRIHDKCHFDTPVYLSATYLLQILFLERSAESNSLELKFKLQR 408

Query: 140 LTVHRFLLTATTVASKGLSDSFCTNVHYAKVGGV 173
             +HR ++    +++K L D   ++ +++KV GV
Sbjct: 409 DGLHRLIIALVRISTKLLEDQIHSHDYFSKVCGV 442

>TBLA0B08440 Chr2 complement(2023101..2023907) [807 bp, 268 aa] {ON}
           Anc_3.70 YNL289W
          Length = 268

 Score = 36.6 bits (83), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 56/114 (49%), Gaps = 4/114 (3%)

Query: 99  SVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLN-SLTVHRFLLTATTVASKGL 157
           S+  ++ RL  Y+++    L+    Y++ L  + P+       T HR  L    +++K  
Sbjct: 46  SLQTFITRLVNYTNVPSGTLLTTAVYLNRLKQLLPAEASGIQSTRHRIFLACLILSAKYN 105

Query: 158 SDSFCTNVHYAK-VGGVQC-SELNVLETEFLKRVNYRI-IPRDDNIFNCKEEYQ 208
           +DS   N+H+      + C +++N++E + LK +N+ + I   D I + K   Q
Sbjct: 106 NDSSPLNIHWMNHTNDLFCLNDINLMERQLLKLLNWDLSITEHDLIKDLKNLIQ 159

>AEL195W Chr5 (266347..267060) [714 bp, 237 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL289W (PCL1)
          Length = 237

 Score = 36.2 bits (82), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 53/108 (49%), Gaps = 9/108 (8%)

Query: 99  SVYNYLIRLAKYSSLEPAVLIA-AVYYIDLLSSVYPSFTLNSLTVHRFLLTATTVASKGL 157
           S++ ++ RL +Y+++  A L+  AVY   L   +    T    T HR  L    +++K  
Sbjct: 53  SIHMFITRLVRYTNVYTATLLTTAVYLERLRLLLPRDATGIPSTAHRIFLACLILSAKFH 112

Query: 158 SDSFCTNVHYAKV--GGVQCSELNVLETEFLK------RVNYRIIPRD 197
           +DS   N H+ K   G     ++N++E + L+      RV +R + RD
Sbjct: 113 NDSSPLNKHWTKYTDGLFTTQDVNLMERQLLRLFDWNVRVGHRDLCRD 160

>NDAI0C01980 Chr3 complement(445212..445892) [681 bp, 226 aa] {ON}
           Anc_5.347 YHR071W
          Length = 226

 Score = 36.2 bits (82), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 52/100 (52%), Gaps = 4/100 (4%)

Query: 99  SVYNYLIRLAKYS-SLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVH---RFLLTATTVAS 154
           S+  YL+ + K S S    V++A+ Y+  L +SV  +   N   VH   R  L+   ++ 
Sbjct: 87  SIKTYLMEILKRSQSSRNNVIVASFYFQKLYNSVQLNQDPNPEFVHCSKRIFLSCLILSH 146

Query: 155 KGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRII 194
           K L+D   +   ++ + G+   +L++LE   L R+NY ++
Sbjct: 147 KFLNDKTFSMKAWSLISGISKRDLSILERWCLMRLNYHLV 186

>TPHA0A03250 Chr1 (717085..717954) [870 bp, 289 aa] {ON} Anc_7.289
           YDL179W
          Length = 289

 Score = 36.2 bits (82), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 54/111 (48%), Gaps = 7/111 (6%)

Query: 95  PPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPS--FTLNSLTVHRFLLTATTV 152
           PP ++   ++  +   S+++   L+A    ++ L  + PS  + + S T HR  L    +
Sbjct: 46  PPPLA--KFIKNICVKSNVQTPTLMATTVLLEKLKKIIPSNVYGIES-TRHRIFLGCLIL 102

Query: 153 ASKGLSDSFCTNVHYAKV--GGVQCSELNVLETEFLKRVNYRIIPRDDNIF 201
           ++K L+DS   N H+AK     +   E+N +E E L   ++ +    + +F
Sbjct: 103 SAKSLNDSSPLNKHWAKYTESYIHLREVNTIERELLNYFDWNVSISQEELF 153

>NCAS0A09870 Chr1 complement(1974028..1974912) [885 bp, 294 aa] {ON}
           Anc_3.70
          Length = 294

 Score = 35.8 bits (81), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 47/93 (50%), Gaps = 6/93 (6%)

Query: 93  RVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYP-SFTLNSLTVHRFLLTATT 151
           R+P   S+  ++ RL +Y+++    L+  V Y++ L  + P   T    T+HR  L    
Sbjct: 51  RLP---SLMTFITRLVRYTNVYTPTLLTTVCYLNKLKRILPKDATGLPSTIHRIFLACLI 107

Query: 152 VASKGLSDSFCTNVHYAKV--GGVQCSELNVLE 182
           +++K  +DS   N H+ K   G     ++N++E
Sbjct: 108 LSAKFHNDSSPLNKHWVKYTDGLFTLEDVNLME 140

>Kpol_1005.17 s1005 (29070..30029) [960 bp, 319 aa] {ON}
           (29070..30029) [960 nt, 320 aa]
          Length = 319

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 68/156 (43%), Gaps = 24/156 (15%)

Query: 61  LVVLISRMLSSL---IQMNDSMCKDKNLKLTRFHSRVPPGISVYNYLIRLAKYSSLEPAV 117
            +V I+++LS++   +  NDS   +        ++ VP       +++ +   S     V
Sbjct: 122 FIVHIAKLLSTITSSLSANDSTINNS------VNTIVP-------FIVEIIDRSKCNKNV 168

Query: 118 LIAAVYYIDLLSSVYPSFTLNSLT--------VHRFLLTATTVASKGLSDSFCTNVHYAK 169
           L+ A YY   + S+ P  T NS +          R  L    ++ K L+D+  T   +  
Sbjct: 169 LLLATYYFKQIYSLNPISTKNSKSPLPTFSHCAKRIFLCCLIISHKFLNDNTFTMKSWHC 228

Query: 170 VGGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKE 205
           + G+  + L+++E   L R+NY +    D +   +E
Sbjct: 229 ISGLPQTHLSLMERWCLTRLNYNLNVHQDALLQLEE 264

>KAFR0C01560 Chr3 complement(320148..320951) [804 bp, 267 aa] {ON}
           Anc_3.70 YNL289W
          Length = 267

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 49/94 (52%), Gaps = 8/94 (8%)

Query: 93  RVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYP--SFTLNSLTVHRFLLTAT 150
           R+P   S+  ++ RL +Y+++    L+  V Y++ L  + P  +  L S T+HR  L   
Sbjct: 56  RLP---SLRTFITRLVRYTNVYTPTLLTTVCYLNKLKRILPKDAKGLPS-TIHRLFLACL 111

Query: 151 TVASKGLSDSFCTNVHYAKV--GGVQCSELNVLE 182
            +++K  +DS   N H+ +   G     ++N++E
Sbjct: 112 IISAKFHNDSSPLNKHWTRYTDGLFSLEDINLME 145

>KAFR0L01200 Chr12 complement(225099..225938) [840 bp, 279 aa] {ON}
           Anc_7.289 YDL179W
          Length = 279

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 48/95 (50%), Gaps = 3/95 (3%)

Query: 102 NYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYP-SFTLNSLTVHRFLLTATTVASKGLSDS 160
           +++  L   S +  + L++   +++ L  + P + +    T HR  L    +++K L+D 
Sbjct: 49  DFICNLVIRSRVNTSTLMSTTVFLNKLKEILPRNVSGMETTRHRIFLGCLILSAKTLNDC 108

Query: 161 FCTNVHYAK--VGGVQCSELNVLETEFLKRVNYRI 193
             TN ++++   G +   E+N +E E LK  N+ +
Sbjct: 109 SPTNKYWSQHCDGLISVREINKIERELLKYFNWDV 143

>Kwal_23.5231 s23 complement(1069167..1069937) [771 bp, 256 aa] {ON}
           YNL289W (PCL1) - G(sub)1 cyclin that associates with
           PHO85 [contig 8] FULL
          Length = 256

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 51/96 (53%), Gaps = 7/96 (7%)

Query: 91  HSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYP--SFTLNSLTVHRFLLT 148
           H R  P  S+  ++ RL +Y+++  + L+ A  Y++ L  + P  +  L S T HR  L 
Sbjct: 53  HKRTLP--SLMTFVTRLVRYTNVYTSTLLTATCYLEKLRRLLPRDAHGLPS-TSHRIFLA 109

Query: 149 ATTVASKGLSDSFCTNVHYAK-VGGVQCSE-LNVLE 182
              +++K  +DS   N H+A    G+ C E +N++E
Sbjct: 110 CLILSAKFHNDSSPQNKHWAAYTDGLFCLEDVNLME 145

>NDAI0A06050 Chr1 complement(1372672..1373532) [861 bp, 286 aa] {ON}
           Anc_3.70
          Length = 286

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 47/96 (48%), Gaps = 6/96 (6%)

Query: 90  FHSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYP-SFTLNSLTVHRFLLT 148
           +  R+P   S+  ++  L +Y+++    L+  V Y++ L  + P   T    T+HR  L 
Sbjct: 48  YQPRLP---SLMTFITNLVRYTNVYTPTLLTTVCYLNKLKRLLPKDATGLPSTIHRIFLA 104

Query: 149 ATTVASKGLSDSFCTNVHYAKV--GGVQCSELNVLE 182
              +++K  +DS   N H+ K   G     ++N++E
Sbjct: 105 CLILSAKFHNDSSPLNKHWVKYTDGLFTLEDVNLME 140

>KLTH0A01584g Chr1 (141289..142134) [846 bp, 281 aa] {ON} similar to
           uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 281

 Score = 33.5 bits (75), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 48/88 (54%), Gaps = 5/88 (5%)

Query: 99  SVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYP--SFTLNSLTVHRFLLTATTVASKG 156
           S+  ++ RL +Y+++  + L+ A  Y++ L  + P  +  L S T HR  L    +++K 
Sbjct: 87  SLMTFITRLVRYTNVYTSTLLTATCYLEKLRRLLPRDAHGLPS-TGHRIFLACLILSAKY 145

Query: 157 LSDSFCTNVHYAK-VGGVQC-SELNVLE 182
            +DS   N H+A    G+ C  ++N++E
Sbjct: 146 HNDSSPQNKHWAAYTDGLFCLDDVNLME 173

>NCAS0A10920 Chr1 (2171372..2175973) [4602 bp, 1533 aa] {ON} Anc_3.321
          Length = 1533

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 25/50 (50%)

Query: 212  FITFPLADKIKGPNNGFNVLDTYYKKMIQLVGPSNSSPDKTSKVSYVLEP 261
             I + +AD I  P N FN    Y+K M++ +    S       ++Y++EP
Sbjct: 1256 LIHYEVADTISHPTNDFNDFQYYFKHMLKSINRIKSGSFTMKHLNYLIEP 1305

>TPHA0B00420 Chr2 complement(88557..91859) [3303 bp, 1100 aa] {ON}
           Anc_4.343 YML075C
          Length = 1100

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 3/64 (4%)

Query: 99  SVYNYLIRLAKYSSLEPA-VLIAAVYYIDLLSSVYPSFTLNSLTVHRFLLTATTVASKGL 157
           S+YN L  + ++S  EP  +LI  V Y+ +L +VY  F   S T  +F L+  T+ + G 
Sbjct: 179 SIYNNL--MTRFSESEPFDILIILVAYLMVLQTVYSLFVEMSKTGSKFWLSLATICNSGC 236

Query: 158 SDSF 161
           +  F
Sbjct: 237 AFFF 240

>NCAS0H01650 Chr8 complement(316598..317230) [633 bp, 210 aa] {ON}
           Anc_5.347 YHR071W
          Length = 210

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 43/98 (43%), Gaps = 10/98 (10%)

Query: 103 YLIRLAKYSSLEPAVLIAAVYYIDLLSSVY-------PSFTLNSLTVHRFLLTATTVASK 155
           YL  + K S     V+  A  Y+D + S +       P F   +  V R  L+   +A K
Sbjct: 81  YLKEVCKRSRSTKTVVFLAAIYLDKIYSNWEPMLGDIPKF---ARCVKRVFLSCLIIAHK 137

Query: 156 GLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRI 193
             +D   +   ++ + G+   EL ++E + L  +NY +
Sbjct: 138 FANDKTFSMRSWSSISGLGRKELTIMEKKCLLEINYEL 175

>ADR383C Chr4 complement(1393399..1395552) [2154 bp, 717 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR354C
           (MSC6)
          Length = 717

 Score = 31.2 bits (69), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 40/86 (46%), Gaps = 10/86 (11%)

Query: 98  ISVYNYLIRLAKYSSL-----EPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRFLLTATTV 152
           I+V+  L  +A +S+L     EP+ L     Y  L S VY +     L       TAT V
Sbjct: 558 INVHTLLPLIAGFSNLILRNNEPSFLSKLDTYWQLASRVYKTIPFEFLNK-----TATAV 612

Query: 153 ASKGLSDSFCTNVHYAKVGGVQCSEL 178
           AS  L ++  T+ HY  +  V  SEL
Sbjct: 613 ASLCLKEAKLTDEHYNFINAVVMSEL 638

>Smik_16.454 Chr16 complement(779609..781579) [1971 bp, 656 aa] {ON}
           YPR190C (REAL)
          Length = 656

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 55/118 (46%), Gaps = 7/118 (5%)

Query: 135 FTLNSLTVHRFLLTATTVASKGLSDSFCTNVHYAKVGG-VQCSELNVLETE----FLKRV 189
            +L SLTV  +L + T+ ++K    S    V   ++G  +Q S+L+    E    FL   
Sbjct: 164 ISLGSLTVEDYLSSVTSDSTKYTISSLF--VQLCEMGYLIQISKLHYTPIEDLWQFLYDK 221

Query: 190 NYRIIPRDDNIFNCKEEYQQGVFITFPLADKIKGPNNGFNVLDTYYKKMIQLVGPSNS 247
           +Y+ IPR+  + + K+  Q  +      A  I  PN    +L    K  +++V P+ S
Sbjct: 222 HYKAIPRNSPLSDLKKRSQAKMNAKTDFAKIINKPNELSQILTIDPKTSLRIVKPTVS 279

>TDEL0E02800 Chr5 complement(539086..539685) [600 bp, 199 aa] {ON}
           Anc_5.347 YHR071W
          Length = 199

 Score = 29.6 bits (65), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 18/79 (22%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 122 VYYIDLLSSVYPSFTLNSLTVHRFLLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVL 181
           +Y   L +   P F   S    R  L+   +A K L+D+  T   +  + G+  ++L ++
Sbjct: 93  IYDGQLWNGKLPDFARCS---KRIFLSCLILAHKYLNDNSFTMKTWNMISGLSQNDLCLM 149

Query: 182 ETEFLKRVNYRIIPRDDNI 200
           E   L++++YR++  ++++
Sbjct: 150 ERWGLEKLDYRLLVAEEDL 168

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.130    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,532,325
Number of extensions: 1276296
Number of successful extensions: 5266
Number of sequences better than 10.0: 135
Number of HSP's gapped: 5367
Number of HSP's successfully gapped: 135
Length of query: 307
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 198
Effective length of database: 40,982,805
Effective search space: 8114595390
Effective search space used: 8114595390
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)