Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E01364g6.22ON54154126320.0
KLLA0D01221g6.22ON56652620420.0
Kwal_56.224376.22ON53653420190.0
KLTH0C11176g6.22ON53653120170.0
KAFR0A050706.22ON56454019920.0
Kpol_1037.276.22ON54654419830.0
NCAS0D021606.22ON56354419570.0
TDEL0G044706.22ON54253919530.0
Ecym_30276.22ON54953919540.0
ZYRO0C07744g6.22ON54753519450.0
Suva_15.1776.22ON54454319150.0
CAGL0E02629g6.22ON54854719110.0
KNAG0F028906.22ON56353919060.0
Skud_15.1636.22ON54454319020.0
Smik_15.1716.22ON54454319010.0
YOR002W (ALG6)6.22ON54454318950.0
NDAI0C026306.22ON58054318910.0
TPHA0J003506.22ON55952618810.0
ACR004W6.22ON56352818810.0
TBLA0G009706.22ON55954218680.0
KLTH0F17666g5.669ON5554182881e-26
Kwal_55.217425.669ON5554172881e-26
TPHA0J013805.669ON5752582882e-26
YOR067C (ALG8)5.669ON5773742749e-25
TBLA0A093105.669ON5464012712e-24
CAGL0L10450g5.669ON5504292684e-24
Smik_15.2475.669ON5773742622e-23
ZYRO0A11506g5.669ON5562582604e-23
Kpol_1018.735.669ON6214162581e-22
Suva_8.1185.669ON5762592571e-22
NDAI0F005105.669ON5704192561e-22
Skud_15.2345.669ON5773742561e-22
KLLA0F16621g5.669ON5612482542e-22
NCAS0G004505.669ON5704242472e-21
TDEL0B025405.669ON5693732436e-21
SAKL0G00836g5.669ON5612662428e-21
ADR210C5.669ON5722652401e-20
KAFR0D024405.669ON5754192373e-20
Ecym_40515.669ON6045352321e-19
KNAG0L019205.669ON5682662276e-19
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E01364g
         (541 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E01364g Chr5 (103009..104634) [1626 bp, 541 aa] {ON} simila...  1018   0.0  
KLLA0D01221g Chr4 complement(106736..108436) [1701 bp, 566 aa] {...   791   0.0  
Kwal_56.22437 s56 complement(127493..129103) [1611 bp, 536 aa] {...   782   0.0  
KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} simila...   781   0.0  
KAFR0A05070 Chr1 complement(1007657..1009351) [1695 bp, 564 aa] ...   771   0.0  
Kpol_1037.27 s1037 complement(65544..67184) [1641 bp, 546 aa] {O...   768   0.0  
NCAS0D02160 Chr4 complement(401973..403664) [1692 bp, 563 aa] {O...   758   0.0  
TDEL0G04470 Chr7 (810734..812362) [1629 bp, 542 aa] {ON} Anc_6.2...   756   0.0  
Ecym_3027 Chr3 complement(52360..54009) [1650 bp, 549 aa] {ON} s...   757   0.0  
ZYRO0C07744g Chr3 (587374..589017) [1644 bp, 547 aa] {ON} highly...   753   0.0  
Suva_15.177 Chr15 (303845..305479) [1635 bp, 544 aa] {ON} YOR002...   742   0.0  
CAGL0E02629g Chr5 (250010..251656) [1647 bp, 548 aa] {ON} highly...   740   0.0  
KNAG0F02890 Chr6 complement(547204..548895) [1692 bp, 563 aa] {O...   738   0.0  
Skud_15.163 Chr15 (289416..291050) [1635 bp, 544 aa] {ON} YOR002...   737   0.0  
Smik_15.171 Chr15 (296715..298349) [1635 bp, 544 aa] {ON} YOR002...   736   0.0  
YOR002W Chr15 (329417..331051) [1635 bp, 544 aa] {ON}  ALG6Alpha...   734   0.0  
NDAI0C02630 Chr3 (609993..611735) [1743 bp, 580 aa] {ON} Anc_6.2...   733   0.0  
TPHA0J00350 Chr10 complement(77974..79653) [1680 bp, 559 aa] {ON...   729   0.0  
ACR004W Chr3 (360904..362595) [1692 bp, 563 aa] {ON} Syntenic ho...   729   0.0  
TBLA0G00970 Chr7 (246516..248195) [1680 bp, 559 aa] {ON} Anc_6.2...   724   0.0  
KLTH0F17666g Chr6 complement(1425802..1427469) [1668 bp, 555 aa]...   115   1e-26
Kwal_55.21742 s55 complement(960476..962143) [1668 bp, 555 aa] {...   115   1e-26
TPHA0J01380 Chr10 complement(321431..323158) [1728 bp, 575 aa] {...   115   2e-26
YOR067C Chr15 complement(451729..453462) [1734 bp, 577 aa] {ON} ...   110   9e-25
TBLA0A09310 Chr1 (2297508..2299148) [1641 bp, 546 aa] {ON} Anc_5...   108   2e-24
CAGL0L10450g Chr12 complement(1117959..1119611) [1653 bp, 550 aa...   107   4e-24
Smik_15.247 Chr15 complement(417710..419443) [1734 bp, 577 aa] {...   105   2e-23
ZYRO0A11506g Chr1 complement(925282..926952) [1671 bp, 556 aa] {...   104   4e-23
Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa] ...   103   1e-22
Suva_8.118 Chr8 complement(214797..216527) [1731 bp, 576 aa] {ON...   103   1e-22
NDAI0F00510 Chr6 (118893..120605) [1713 bp, 570 aa] {ON} Anc_5.6...   103   1e-22
Skud_15.234 Chr15 complement(413571..415304) [1734 bp, 577 aa] {...   103   1e-22
KLLA0F16621g Chr6 complement(1531745..1533430) [1686 bp, 561 aa]...   102   2e-22
NCAS0G00450 Chr7 (77781..79493) [1713 bp, 570 aa] {ON} Anc_5.669...   100   2e-21
TDEL0B02540 Chr2 (459825..461534) [1710 bp, 569 aa] {ON} Anc_5.6...    98   6e-21
SAKL0G00836g Chr7 (77387..79072) [1686 bp, 561 aa] {ON} highly s...    98   8e-21
ADR210C Chr4 complement(1070234..1071952) [1719 bp, 572 aa] {ON}...    97   1e-20
KAFR0D02440 Chr4 (489816..491543) [1728 bp, 575 aa] {ON} Anc_5.6...    96   3e-20
Ecym_4051 Chr4 (109310..111124) [1815 bp, 604 aa] {ON} similar t...    94   1e-19
KNAG0L01920 Chr12 complement(344454..346160) [1707 bp, 568 aa] {...    92   6e-19

>SAKL0E01364g Chr5 (103009..104634) [1626 bp, 541 aa] {ON} similar
           to uniprot|Q12001 Saccharomyces cerevisiae YOR002W ALG6
           Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 541

 Score = 1018 bits (2632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/541 (95%), Positives = 514/541 (95%)

Query: 1   MSSKRKPYSRKIVKESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSFSG 60
           MSSKRKPYSRKIVKESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSFSG
Sbjct: 1   MSSKRKPYSRKIVKESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSFSG 60

Query: 61  MNVPPMHGDFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDP 120
           MNVPPMHGDFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDP
Sbjct: 61  MNVPPMHGDFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDP 120

Query: 121 TWFQLGVSRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAA 180
           TWFQLGVSRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAA
Sbjct: 121 TWFQLGVSRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAA 180

Query: 181 ILFQPSLILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPI 240
           ILFQPSLILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPI
Sbjct: 181 ILFQPSLILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPI 240

Query: 241 XXXXXXXXXXXXXXXNLPRLLAVAAATLISFAAMFFPLYMWGGIRNVLQSIHRIFPFSRG 300
                          NLPRLLAVAAATLISFAAMFFPLYMWGGIRNVLQSIHRIFPFSRG
Sbjct: 241 FFSYLLSKSLFSPLFNLPRLLAVAAATLISFAAMFFPLYMWGGIRNVLQSIHRIFPFSRG 300

Query: 301 IFEDKVANFWCFSNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHLIPYAL 360
           IFEDKVANFWCFSNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHLIPYAL
Sbjct: 301 IFEDKVANFWCFSNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHLIPYAL 360

Query: 361 TACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVSWINNMAFFTLWPLLKKDG 420
           TACSMSFFLFSFQVHEK            YTSTDWNVLSMVSWINNMAFFTLWPLLKKDG
Sbjct: 361 TACSMSFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSMVSWINNMAFFTLWPLLKKDG 420

Query: 421 LVLQYATLLLLSNWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIFWKLII 480
           LVLQYATLLLLSNWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIFWKLII
Sbjct: 421 LVLQYATLLLLSNWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIFWKLII 480

Query: 481 VASYISMGILHLLDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRNKTLYD 540
           VASYISMGILHLLDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRNKTLYD
Sbjct: 481 VASYISMGILHLLDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRNKTLYD 540

Query: 541 F 541
           F
Sbjct: 541 F 541

>KLLA0D01221g Chr4 complement(106736..108436) [1701 bp, 566 aa] {ON}
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002W ALG6 Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease,
          Length = 566

 Score =  791 bits (2042), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/526 (69%), Positives = 430/526 (81%)

Query: 15  ESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSFSGMNVPPMHGDFEAQR 74
           E+FFASP++DFL+PFRPV NQWCAKY+IV+FALIIRC VGLG +SGMN PPM GDFEAQR
Sbjct: 40  EAFFASPMYDFLTPFRPVGNQWCAKYVIVIFALIIRCAVGLGGYSGMNTPPMFGDFEAQR 99

Query: 75  HWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDPTWFQLGVSRGQESM 134
           HWME+T +LP+ +WYWYDL YWGLDYPPLTAYHSY+LGKLG  F   WF L  SRG ES+
Sbjct: 100 HWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKLGSFFREGWFDLESSRGYESL 159

Query: 135 DLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAILFQPSLILIDHGH 194
           +LKSYMRFTV++SELLLYIP VIYF KW+GK+R Q+PIGQYIAAAAILFQP+LIL+DHGH
Sbjct: 160 NLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPALILVDHGH 219

Query: 195 FQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPIXXXXXXXXXXXXXX 254
           FQYN VMLG+TVY +NNLLD +YA  AICFVLS+CFKQMALYY+PI              
Sbjct: 220 FQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLLSKSTYSPG 279

Query: 255 XNLPRLLAVAAATLISFAAMFFPLYMWGGIRNVLQSIHRIFPFSRGIFEDKVANFWCFSN 314
            NLPRL A++ +T ++F   F P+Y++GG +N++QS+HRIFPF+RGIFEDKVANFWC SN
Sbjct: 280 INLPRLFAISVSTALAFIGSFGPIYIFGGYKNLVQSMHRIFPFARGIFEDKVANFWCVSN 339

Query: 315 IFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHLIPYALTACSMSFFLFSFQV 374
           IFIKY+ L+TQ  LQ+YSL AT +G LP+FI+ F YPK+HL+PYAL ACSMSFFLFSFQV
Sbjct: 340 IFIKYRNLFTQKDLQLYSLLATVIGLLPSFIITFLYPKRHLLPYALAACSMSFFLFSFQV 399

Query: 375 HEKXXXXXXXXXXXXYTSTDWNVLSMVSWINNMAFFTLWPLLKKDGLVLQYATLLLLSNW 434
           HEK            YTS DWNVLS+V WINN+A FTLWPLLKKD LVLQY  + + SNW
Sbjct: 400 HEKTILLPLLPITLLYTSRDWNVLSLVCWINNVALFTLWPLLKKDNLVLQYGVMFMFSNW 459

Query: 435 LIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIFWKLIIVASYISMGILHLLD 494
           LIGNFSFVTPRFLPKFLTPGPS SD+  +YRR SLLP ++ W+LIIV SYI+MGI+H LD
Sbjct: 460 LIGNFSFVTPRFLPKFLTPGPSISDIDVDYRRASLLPKSLIWRLIIVGSYIAMGIIHFLD 519

Query: 495 FYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRNKTLYD 540
           +YV PP+KYPDLWVL NCSLGF  F  FW+WN YK+F +RN TL D
Sbjct: 520 YYVSPPSKYPDLWVLANCSLGFSCFVTFWIWNNYKLFEMRNSTLQD 565

>Kwal_56.22437 s56 complement(127493..129103) [1611 bp, 536 aa] {ON}
           YOR002W (ALG6) - glucosyltransferase [contig 185] FULL
          Length = 536

 Score =  782 bits (2019), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/534 (70%), Positives = 433/534 (81%), Gaps = 1/534 (0%)

Query: 9   SRKIVK-ESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSFSGMNVPPMH 67
            +K+ K E FFASPL+DFLSPFRPVANQ+ A+Y+IV+FAL+IRC VGLGSFSG N  P+H
Sbjct: 3   GKKVSKNEPFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGENSGPIH 62

Query: 68  GDFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDPTWFQLGV 127
           GDFEAQRHWMELT +LPLSQWYWYDL YWGLDYPPLTAYHSY+LGKLG + +  WF L  
Sbjct: 63  GDFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEWFALLS 122

Query: 128 SRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAILFQPSL 187
           SRG E+ D+K+YMRFTV+LSE  LYIP V+YF KW G  R Q+PIGQYIAAAAILFQPSL
Sbjct: 123 SRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSL 182

Query: 188 ILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPIXXXXXXX 247
           ILIDHGHFQYNSVMLGLTVY+INNLLD YY PAAICFVLS+CFKQMALYY+P+       
Sbjct: 183 ILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYLLS 242

Query: 248 XXXXXXXXNLPRLLAVAAATLISFAAMFFPLYMWGGIRNVLQSIHRIFPFSRGIFEDKVA 307
                   N+PR L+VA +T+ISF  +F PLY++GG +NVLQSIHRIFPFSRGIFEDKVA
Sbjct: 243 ECLISPSLNVPRFLSVAFSTVISFCIIFSPLYVFGGTKNVLQSIHRIFPFSRGIFEDKVA 302

Query: 308 NFWCFSNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHLIPYALTACSMSF 367
           NFWC SN+  KY   YTQ +LQ +S+ ATA GFLP+F+++  YPKKH+IP+AL ACSM+F
Sbjct: 303 NFWCVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIPFALAACSMAF 362

Query: 368 FLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVSWINNMAFFTLWPLLKKDGLVLQYAT 427
           FLFSFQVHEK            Y STDWNVLSMVSWINN+A FTLWPLLKKD L LQY  
Sbjct: 363 FLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDHLTLQYGI 422

Query: 428 LLLLSNWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIFWKLIIVASYISM 487
           L+LLSNWLIGNFSFVTPRFLPKF+TPGPS S VSE YRRRS LPDN FWKLIIVASY+ M
Sbjct: 423 LMLLSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWKLIIVASYLIM 482

Query: 488 GILHLLDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRNKTLYDF 541
             +H+LDF+V  P   PDLWVLLNC+LGFF F +FW+W +YK+FT+RN  L DF
Sbjct: 483 AAIHILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTNLQDF 536

>KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} similar
           to uniprot|Q12001 Saccharomyces cerevisiae YOR002W ALG6
           Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 536

 Score =  781 bits (2017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/531 (69%), Positives = 431/531 (81%)

Query: 10  RKIVKESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSFSGMNVPPMHGD 69
           + + KESFFASPL+DFLSPFRPVANQ+ A+Y+IV+FAL+IRC VGLGSFSG    PMHGD
Sbjct: 5   KSLPKESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVPMHGD 64

Query: 70  FEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDPTWFQLGVSR 129
           FEAQRHWMELTTNLPLSQWYW+DL YWGLDYPPLTAYHSY LGKLG + +P WF LG SR
Sbjct: 65  FEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALGSSR 124

Query: 130 GQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAILFQPSLIL 189
           G E+ +LK+YMRFTV+LSE  LYIP V+YF KW G  R Q+PIGQYIAAAAILFQPSLIL
Sbjct: 125 GNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLIL 184

Query: 190 IDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPIXXXXXXXXX 249
           IDHGHFQYNSVMLGLTVYAINNLLD ++ PAAICF+LS+CFKQMAL+Y+PI         
Sbjct: 185 IDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLSRS 244

Query: 250 XXXXXXNLPRLLAVAAATLISFAAMFFPLYMWGGIRNVLQSIHRIFPFSRGIFEDKVANF 309
                    R ++VA +T+I+F  MF PLY++GG++NVLQSIHRIFPFSRGIFEDKVANF
Sbjct: 245 LFSPSFKFSRFMSVALSTVITFCLMFSPLYVFGGMKNVLQSIHRIFPFSRGIFEDKVANF 304

Query: 310 WCFSNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHLIPYALTACSMSFFL 369
           WC SN+ +KY   +TQ QLQ  S  ATA GFLP+F L+  YPKKH+IPY L ACSM+FFL
Sbjct: 305 WCVSNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSMAFFL 364

Query: 370 FSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVSWINNMAFFTLWPLLKKDGLVLQYATLL 429
           F FQVHEK            + STDWNVL++VSWINN+A FTLWPLLKKD L LQY  ++
Sbjct: 365 FGFQVHEKSILVPLLPISLLFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQYGIMM 424

Query: 430 LLSNWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIFWKLIIVASYISMGI 489
           LLSNWLIGNFSFVTPRFLP F+TPGPS S+V+E YRRRS LP+NI WK++I+ SYI M +
Sbjct: 425 LLSNWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYIVMAV 484

Query: 490 LHLLDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRNKTLYD 540
           +H+LD +VQPPAK PDLWVL+NC+LGF  F +FW+WN YK+FT+RNK++ D
Sbjct: 485 IHILDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSILD 535

>KAFR0A05070 Chr1 complement(1007657..1009351) [1695 bp, 564 aa]
           {ON} Anc_6.22 YOR002W
          Length = 564

 Score =  771 bits (1992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/540 (67%), Positives = 429/540 (79%), Gaps = 2/540 (0%)

Query: 3   SKRKPYSRKIVKESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSFSGMN 62
            K    + + ++E F+ASPL+DFL PFRP  NQW A+YIIV FALIIRC +GLGS+SGM 
Sbjct: 24  KKASKLNNEAIEEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGLGSYSGMG 83

Query: 63  VPPMHGDFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDPTW 122
             PM GDFEAQRHWME+T +LP+S+WYW+DL YWGLDYPPLTAYHSYILGK+G    P W
Sbjct: 84  HSPMFGDFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKW 143

Query: 123 FQLGVSRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAIL 182
           F L  SRG E   +KSYMR TVL+SE + Y P +IYF+KW GKHR Q+PIGQYIAA AIL
Sbjct: 144 FTLNDSRGIEMEGIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAIL 203

Query: 183 FQPSLILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPIXX 242
           FQPSL+LIDHGHFQYNSVMLGLTVYAINNLLD++Y+ A++CFVLS+CFKQM+LYYAPI  
Sbjct: 204 FQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFF 263

Query: 243 XXXXXXXXXX-XXXNLPRLLAVAAATLISFAAMFFPLYMWGG-IRNVLQSIHRIFPFSRG 300
                         N+PRL+ +AA T+++F AM+ PLY++GG + N++QS+HRIFPF+RG
Sbjct: 264 GYLLSKSLFFPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSVHRIFPFARG 323

Query: 301 IFEDKVANFWCFSNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHLIPYAL 360
           IFEDKVANFWC +NI IKYK+ +TQ QLQ+YSL AT LGFLPA ++I  YPKKHL+PYAL
Sbjct: 324 IFEDKVANFWCVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHLLPYAL 383

Query: 361 TACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVSWINNMAFFTLWPLLKKDG 420
            ACSMSFFLFSFQVHEK            YTSTDWNVLSMV WINN+A FTLWPLLKKDG
Sbjct: 384 AACSMSFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSMVCWINNVALFTLWPLLKKDG 443

Query: 421 LVLQYATLLLLSNWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIFWKLII 480
           L+LQYA    LSNWL+GNFSFVTP+FLPK LTPGPS S + ENY RRSLLP NI WK++I
Sbjct: 444 LILQYAVCFALSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNILWKVVI 503

Query: 481 VASYISMGILHLLDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRNKTLYD 540
           V+SY+SM + H LDF+V+PP  YPD+W+ LNC +GF SF  FW+W YY +FTLRNKTL D
Sbjct: 504 VSSYLSMAVFHYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRNKTLMD 563

>Kpol_1037.27 s1037 complement(65544..67184) [1641 bp, 546 aa] {ON}
           complement(65544..67184) [1641 nt, 547 aa]
          Length = 546

 Score =  768 bits (1983), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/544 (67%), Positives = 441/544 (81%), Gaps = 7/544 (1%)

Query: 1   MSSKRKPYSR--KIVKESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSF 58
           M+SK+K  SR  K V+ESFFASPL+DFLSPFRPV+NQW  +YIIV+FALI+RC +GLGS+
Sbjct: 1   MASKKK-ISRINKPVEESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGLGSY 59

Query: 59  SGMNVPPMHGDFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIF 118
           SGM  PPM GDFEAQRHWME+T +LP+S+WY++DL YWGLDYPPLTAYHSY+LG +G   
Sbjct: 60  SGMGNPPMFGDFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFL 119

Query: 119 DPTWFQLGVSRGQESM--DLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYI 176
           + +WF L  SRG ES   DLK+YMR TV++SE++ YIPGVIYF KW+G+HR Q+ IGQYI
Sbjct: 120 NKSWFALNDSRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYI 179

Query: 177 AAAAILFQPSLILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALY 236
           AAAAILFQPSL+LIDHGHFQYNSVMLGLTVYAINNLLDE+YAPAA+CFVLS+CFKQMALY
Sbjct: 180 AAAAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALY 239

Query: 237 YAPIXXXXXX-XXXXXXXXXNLPRLLAVAAATLISFAAMFFPLYMWGG-IRNVLQSIHRI 294
           YAPI                N+ R L++A +T+ +F +M+ PLY++GG +RNV+QS+HRI
Sbjct: 240 YAPIFFGYLLGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVIQSVHRI 299

Query: 295 FPFSRGIFEDKVANFWCFSNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKH 354
           FPF+RG+FEDKVANFWC +NIFIKYK+LYTQ +LQ+YSL AT +GFLPA + I FYPKKH
Sbjct: 300 FPFARGLFEDKVANFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKH 359

Query: 355 LIPYALTACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVSWINNMAFFTLWP 414
           L+PYAL ACSMSF+LFSFQVHEK            YTSTDWNVLS VSW+NN+  FTLWP
Sbjct: 360 LLPYALAACSMSFYLFSFQVHEKTILVPLLPITLLYTSTDWNVLSFVSWVNNVGLFTLWP 419

Query: 415 LLKKDGLVLQYATLLLLSNWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNI 474
           LLKKDGL LQY     LSNWLIGNFSF+TP+FLPK LTPGP   +  + Y RRSLLP NI
Sbjct: 420 LLKKDGLTLQYGVCFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNI 479

Query: 475 FWKLIIVASYISMGILHLLDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLR 534
            WK+IIV+SYI M ++HL + +V PP +YPD+WVL+NC LGF  F LFW+WNYYK+FTL 
Sbjct: 480 LWKIIIVSSYIVMLLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLA 539

Query: 535 NKTL 538
           NKTL
Sbjct: 540 NKTL 543

>NCAS0D02160 Chr4 complement(401973..403664) [1692 bp, 563 aa] {ON}
           Anc_6.22 YOR002W
          Length = 563

 Score =  758 bits (1957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/544 (67%), Positives = 431/544 (79%), Gaps = 6/544 (1%)

Query: 2   SSKRKPYSRK--IVKESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSFS 59
           S K K  S+K  I +ESF+ASPL+D L PFRP  +QW  +Y IVLF+LIIRC VGLG FS
Sbjct: 18  SGKTKETSKKHDIPEESFYASPLYDLLYPFRPAGSQWMTEYTIVLFSLIIRCAVGLGPFS 77

Query: 60  GMNVPPMHGDFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFD 119
           G  VPPM GDFEAQRHWME+T +LP+ +WYW+DL YWGLDYPPLTAYHSYI GK+G  F+
Sbjct: 78  GYGVPPMFGDFEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFN 137

Query: 120 PTWFQLGVSRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAA 179
           P WF L  SRG E+ DLK++MR TVL+SE L YIPGV+YF KW+GKHR Q+PIGQ+IAAA
Sbjct: 138 PNWFALDSSRGYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAA 197

Query: 180 AILFQPSLILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAP 239
           AIL QPSLILIDHGHFQYNSV LGLTVYAINNLLDE+YA AA+CFVLS+CFKQM LYY+P
Sbjct: 198 AILLQPSLILIDHGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSP 257

Query: 240 IXXXXXXXXXXXX-XXXNLPRLLAVAAATLISFAAMFFPLYMWGG---IRNVLQSIHRIF 295
           I                N+PR LA+A AT+ SF  M+ PLY++GG   + NVLQSIHRIF
Sbjct: 258 IFFAYLLSKSLFTPKLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQGLNNVLQSIHRIF 317

Query: 296 PFSRGIFEDKVANFWCFSNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHL 355
           PF+RGIFEDKVANFWC +N+  KYK+L+TQ +LQ+YSL  T +GFLPA ++I FYPKK+L
Sbjct: 318 PFARGIFEDKVANFWCVTNVIFKYKMLFTQQELQLYSLVLTVVGFLPAMMIILFYPKKYL 377

Query: 356 IPYALTACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVSWINNMAFFTLWPL 415
           +PYAL+ACSM+F+LFSFQVHEK            YTSTD NVLS VSW+NN+  FTLWPL
Sbjct: 378 LPYALSACSMAFYLFSFQVHEKTILMPLLPITLLYTSTDRNVLSRVSWMNNIGLFTLWPL 437

Query: 416 LKKDGLVLQYATLLLLSNWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIF 475
           LKKDGL LQY   LLLSNWLIGNFSF+TP FLPK LTPGPS S + ENY  RSLLP NIF
Sbjct: 438 LKKDGLTLQYWVCLLLSNWLIGNFSFITPNFLPKVLTPGPSVSMIGENYHYRSLLPRNIF 497

Query: 476 WKLIIVASYISMGILHLLDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRN 535
           WK+IIV SYI+MG +H+LD +V PP  YPDLWV+LNC+LGF  FFLFW+WNYYK+F++  
Sbjct: 498 WKVIIVLSYIAMGAIHVLDAFVNPPVAYPDLWVILNCTLGFGCFFLFWIWNYYKLFSMIK 557

Query: 536 KTLY 539
           K+L+
Sbjct: 558 KSLH 561

>TDEL0G04470 Chr7 (810734..812362) [1629 bp, 542 aa] {ON} Anc_6.22
           YOR002W
          Length = 542

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/539 (66%), Positives = 427/539 (79%), Gaps = 1/539 (0%)

Query: 1   MSSKRKPYSRKIVKESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSFSG 60
           M+ K K   R  V+ESF+ASPL+DFL PFRP  +QW  +Y+IVLFALII C VG GS+SG
Sbjct: 1   MAPKNKEAKRNTVEESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGHGSYSG 60

Query: 61  MNVPPMHGDFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDP 120
              PPM GDFEAQRHWME+T +L  SQWYW+DL YWGLDYPPLTAYHSY+LGK+G    P
Sbjct: 61  QFSPPMFGDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIKP 120

Query: 121 TWFQLGVSRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAA 180
            WF+L  SRG E+ DLK++MRFTVLLSE L YIP V+YF KW+GKHR ++PIGQ+I+AAA
Sbjct: 121 EWFELNESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAA 180

Query: 181 ILFQPSLILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPI 240
           ILFQPSL+LIDHGHFQYN VMLGLTVYAIN+L +E+YA AAICFVLS+CFKQMALYYAPI
Sbjct: 181 ILFQPSLMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPI 240

Query: 241 XXXXXXXXXXXXXXXNLPRLLAVAAATLISFAAMFFPLYMWGG-IRNVLQSIHRIFPFSR 299
                          N PRL A+A AT++SFAAM+ PLY++GG + NV+QS+HRIFPF+R
Sbjct: 241 FFAYLLSKSLFSPRFNFPRLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVHRIFPFAR 300

Query: 300 GIFEDKVANFWCFSNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHLIPYA 359
           GIFEDKVANFWC +N+F KYK ++ Q QLQ+YSL AT LGFLPA I+IF YPKKH+I YA
Sbjct: 301 GIFEDKVANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIICYA 360

Query: 360 LTACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVSWINNMAFFTLWPLLKKD 419
           L  CSMSF+LFSFQVHEK            YTS++W+VLSM +WINN+  FTL+PLLKKD
Sbjct: 361 LATCSMSFYLFSFQVHEKTILVPLLPITLLYTSSNWDVLSMANWINNVGLFTLYPLLKKD 420

Query: 420 GLVLQYATLLLLSNWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIFWKLI 479
           GL LQY     LSNWL+GNFSFVTP+FLPKFLTPGPS S V  NYRRRS LP N+ WK+I
Sbjct: 421 GLTLQYFVCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVIWKII 480

Query: 480 IVASYISMGILHLLDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRNKTL 538
           IV+SY +MG+LH++DF + PP  YPDLWVLLNC+LGF  F LFW+W+YY +FT+  KTL
Sbjct: 481 IVSSYTAMGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPRKTL 539

>Ecym_3027 Chr3 complement(52360..54009) [1650 bp, 549 aa] {ON}
           similar to Ashbya gossypii ACR004W
          Length = 549

 Score =  757 bits (1954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/539 (66%), Positives = 427/539 (79%)

Query: 2   SSKRKPYSRKIVKESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSFSGM 61
           S K +   R  V+ESFFASPL+DFL P RPVANQW AKYII++FALI+R  VGLG +SG 
Sbjct: 10  SEKGQDTRRSCVEESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLAVGLGGYSGK 69

Query: 62  NVPPMHGDFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDPT 121
              P+ GDFEAQRHWME+TT LP+S+WY+YDL YWGLDYPPLTAYHSYILG+LG   + T
Sbjct: 70  GKGPLFGDFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNAT 129

Query: 122 WFQLGVSRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAI 181
           WF+L  SRG ES+DLKS+MR TVLLSEL+ YIP V+YF +WIG+HR Q+PIGQY+A AAI
Sbjct: 130 WFKLNTSRGFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAI 189

Query: 182 LFQPSLILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPIX 241
           LFQPSLILIDHGHFQYN VMLGL VY INNLLDE+Y  AAICFVLS+ FKQMALYY+P+ 
Sbjct: 190 LFQPSLILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVI 249

Query: 242 XXXXXXXXXXXXXXNLPRLLAVAAATLISFAAMFFPLYMWGGIRNVLQSIHRIFPFSRGI 301
                         N PR   +A ATL++F A++ PL ++G  RN++QS++R+FPFSRGI
Sbjct: 250 FAYLFSRSAYYPRFNFPRFAGIAIATLLTFGALYAPLCLFGDFRNIIQSVYRVFPFSRGI 309

Query: 302 FEDKVANFWCFSNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHLIPYALT 361
           FEDKVANFWC +N+ IKY+ LYTQ QLQ Y L  TA+   PAFI+IF YPKK L+PYAL 
Sbjct: 310 FEDKVANFWCVTNVIIKYRELYTQKQLQFYCLLTTAIAQFPAFIIIFLYPKKFLLPYALA 369

Query: 362 ACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVSWINNMAFFTLWPLLKKDGL 421
           ACSM+FFLFSFQVHEK            + ST+W+VLSMV+WINN+A FTLWPLLKKDGL
Sbjct: 370 ACSMAFFLFSFQVHEKTILVPLLPITLLHISTNWDVLSMVAWINNVALFTLWPLLKKDGL 429

Query: 422 VLQYATLLLLSNWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIFWKLIIV 481
           +LQYA + LLSNWL+GNFSFVTP FLPKFLTPGPS SDV+++YRRRSLLP NIFW++IIV
Sbjct: 430 LLQYAIMFLLSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPKNIFWRIIIV 489

Query: 482 ASYISMGILHLLDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRNKTLYD 540
           +SY+ M  +HLLD YVQPP  YPD+WVL  C+LGF  F  FW+WNYY+++ +RN +L +
Sbjct: 490 SSYVCMAFIHLLDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYRMRNSSLNE 548

>ZYRO0C07744g Chr3 (587374..589017) [1644 bp, 547 aa] {ON} highly
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002W ALG6 Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 547

 Score =  753 bits (1945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/535 (67%), Positives = 430/535 (80%), Gaps = 1/535 (0%)

Query: 5   RKPYSRKIVKESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSFSGMNVP 64
            K  +    +ESF+ASPL+DFL PF+PV +QW  +YII+LFA+IIRC +GLG +SG +V 
Sbjct: 10  EKAQADNTAEESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIGLGPYSGQSVK 69

Query: 65  PMHGDFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDPTWFQ 124
           PMHGDFEAQRHW+E+T +LP+SQWY++DL YWGLDYPPLTAYHSYILGKLG + +P WF 
Sbjct: 70  PMHGDFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSLINPDWFA 129

Query: 125 LGVSRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAILFQ 184
           L VSRG ES DLK+YMRFTV+LSE++ YIP V+YF KW+G+HRG +P+GQ+IAAAAILFQ
Sbjct: 130 LNVSRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAILFQ 189

Query: 185 PSLILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPIXXXX 244
           P+L+LIDHGHFQYN VMLG TVYAIN+L+DE+YAPAA CFVLS+CFKQMALYY+PI    
Sbjct: 190 PALMLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFFAY 249

Query: 245 XXXXXXXXXXXNLPRLLAVAAATLISFAAMFFPLYMWG-GIRNVLQSIHRIFPFSRGIFE 303
                        PR L++A AT+ +F  M+ PLY+ G G +NVLQS+HRIFPF+RGIFE
Sbjct: 250 LLGRCVFKTGIRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHRIFPFARGIFE 309

Query: 304 DKVANFWCFSNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHLIPYALTAC 363
           DKVANFWC +NIF+KYK L+TQ QLQ+YSL ATALGFLPA +L+  YPKKHL+P+AL AC
Sbjct: 310 DKVANFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKKHLVPFALAAC 369

Query: 364 SMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVSWINNMAFFTLWPLLKKDGLVL 423
           SMSFFLFSFQVHEK            YTST+W+VLS+VSWINN+  FTLWPLLKKDGL L
Sbjct: 370 SMSFFLFSFQVHEKTILVPLLPITLLYTSTNWDVLSLVSWINNVGLFTLWPLLKKDGLAL 429

Query: 424 QYATLLLLSNWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIFWKLIIVAS 483
           QY       NWLIGNFSFVTP FLPKFLTPGPS S V  NYRRRSLLP +I WKLIIV S
Sbjct: 430 QYCVCFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKSIIWKLIIVGS 489

Query: 484 YISMGILHLLDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRNKTL 538
           YISMG +H+LD +V PP  YPDLWV+LNC+LGF  F LFW+WNYYK+F+L  ++L
Sbjct: 490 YISMGAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSLAGQSL 544

>Suva_15.177 Chr15 (303845..305479) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  742 bits (1915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/543 (65%), Positives = 426/543 (78%), Gaps = 3/543 (0%)

Query: 1   MSSKRKPYSRKIVKESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSFSG 60
           M+  ++    K  +ESF+ASP++DFL PFRPV NQW  +YII + A+I+RC +GLG +SG
Sbjct: 1   MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSG 60

Query: 61  MNVPPMHGDFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDP 120
              PP+HGDFEAQRHWME+T +LPLS+WYWYDL YWGLDYPPLTA+HSY+LG +G  F+P
Sbjct: 61  KATPPLHGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGTFFNP 120

Query: 121 TWFQLGVSRGQESMD--LKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAA 178
           +WF L  SRG ES D  LK+YMR TV++S++L Y P VIYF KW+G++R Q+PIGQ IAA
Sbjct: 121 SWFALDKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAA 180

Query: 179 AAILFQPSLILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYA 238
           AAILFQPSL+LIDHGHFQYNSVMLGLT YAINNLLDEYYA AA+CFVLS+CFKQMALYYA
Sbjct: 181 AAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAMCFVLSICFKQMALYYA 240

Query: 239 PIXXXXXXXXXXXXXXXNLPRLLAVAAATLISFAAMFFPLY-MWGGIRNVLQSIHRIFPF 297
           PI               N+ RL  +A ATL +F+ MF PLY + GG+RN+ Q IHR+FPF
Sbjct: 241 PIFFAYLLSRSLFFPKFNIARLTVIAFATLATFSLMFAPLYFLGGGLRNIYQCIHRMFPF 300

Query: 298 SRGIFEDKVANFWCFSNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHLIP 357
           +RGIFEDKVANFWC SNIF+KYK  ++  QLQ+YSL AT LGFLPA ++   +PKKHL+P
Sbjct: 301 ARGIFEDKVANFWCVSNIFVKYKERFSIQQLQLYSLVATVLGFLPAMMMTLLHPKKHLLP 360

Query: 358 YALTACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVSWINNMAFFTLWPLLK 417
           Y L ACSMSFFLFSFQVHEK            Y+STDWNVLS+VSWINN+A FTLWPLLK
Sbjct: 361 YVLIACSMSFFLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLK 420

Query: 418 KDGLVLQYATLLLLSNWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIFWK 477
           KDGL LQY    LL+NWLIGNFSF+TPRFLPK LTPGPS S ++ +YRRRSLLP N+ WK
Sbjct: 421 KDGLHLQYVVSFLLTNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK 480

Query: 478 LIIVASYISMGILHLLDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRNKT 537
             I+ +YI+MG+ H LD +V PP KYPDLWVLLNC++GF  F +FW+W+YYK+FT  NK+
Sbjct: 481 SFIIGTYIAMGLYHFLDLFVAPPKKYPDLWVLLNCAVGFICFSIFWIWSYYKIFTSGNKS 540

Query: 538 LYD 540
           + D
Sbjct: 541 MKD 543

>CAGL0E02629g Chr5 (250010..251656) [1647 bp, 548 aa] {ON} highly
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002w ALG6 glucosyltransferase
          Length = 548

 Score =  740 bits (1911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/547 (63%), Positives = 427/547 (78%), Gaps = 7/547 (1%)

Query: 1   MSSKRK------PYSRKIVKESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVG 54
           MSS++K       +  +  +ESF+ASPL+DFL PFRP  +QW  ++II++FA+IIRC +G
Sbjct: 1   MSSEKKDKKAVSKFESEQGEESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAIG 60

Query: 55  LGSFSGMNVPPMHGDFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKL 114
           LG +SG    PMHGDFEAQRHWME+T +LP+S+WY+YDL YWGLDYPPLTA+HSY+LGKL
Sbjct: 61  LGPYSGYKDGPMHGDFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKL 120

Query: 115 GDIFDPTWFQLGVSRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQ 174
           G   +P WF L  SRG E+  LK+YMRFTVLLSE + Y+P V+YF KW+G+ R Q+PIGQ
Sbjct: 121 GTFCNPDWFALDSSRGIETQGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQ 180

Query: 175 YIAAAAILFQPSLILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMA 234
           +IAAAAILFQPSL+LIDHGHFQYNS+MLG TVYAINNLLDE+YAPAAICFVLS+CFKQM+
Sbjct: 181 FIAAAAILFQPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMS 240

Query: 235 LYYAPIXXXXXXXXXXXX-XXXNLPRLLAVAAATLISFAAMFFPLYMWGGIRNVLQSIHR 293
           LYYAPI                N+PR ++++ ATL++F AMF P Y++GG+  + Q++ R
Sbjct: 241 LYYAPIFFAYLLGRSMFFPKLFNIPRFISISIATLVTFTAMFSPFYIFGGLDGLAQTVRR 300

Query: 294 IFPFSRGIFEDKVANFWCFSNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKK 353
           IFPF+RGIFEDKVANFWC  N  +K+KVL+T  QL+MYSL  T +GF PA ILI  YP+K
Sbjct: 301 IFPFARGIFEDKVANFWCVVNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRK 360

Query: 354 HLIPYALTACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVSWINNMAFFTLW 413
           HL+PYAL ACSMSF+LFSFQVHEK            +TS DWNVLSMVSWINN+A FTLW
Sbjct: 361 HLLPYALAACSMSFYLFSFQVHEKTILVPLLPITLLFTSRDWNVLSMVSWINNVALFTLW 420

Query: 414 PLLKKDGLVLQYATLLLLSNWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDN 473
           PLLK++GL LQY     LSNWLIGNFSF+TPRFLPKF+TPGPS S VS+NYRRRSLLP +
Sbjct: 421 PLLKREGLYLQYFVCFFLSNWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHS 480

Query: 474 IFWKLIIVASYISMGILHLLDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTL 533
           IFWKLIIV+SYI M   H LD +++ P ++PDLWV+LNC++GF SF LFW+W YYK  TL
Sbjct: 481 IFWKLIIVSSYIGMTAYHFLDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTL 540

Query: 534 RNKTLYD 540
             K + D
Sbjct: 541 LKKNIQD 547

>KNAG0F02890 Chr6 complement(547204..548895) [1692 bp, 563 aa] {ON}
           Anc_6.22 YOR002W
          Length = 563

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/539 (64%), Positives = 424/539 (78%), Gaps = 1/539 (0%)

Query: 3   SKRKPYSRKIVKESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSFSGMN 62
            + K  +   V+E F+ASP++DFL PFR   +QW  +YIIV+F LII+  +GLGS+SG  
Sbjct: 24  QRNKDEAAPEVEECFYASPIYDFLYPFRSPGSQWVTEYIIVVFLLIIKSAIGLGSYSGFQ 83

Query: 63  VPPMHGDFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDPTW 122
            PPM GDFEAQRHWME+T +LP+SQWYW+DL YWGLDYPP TAYHSY+LGK+G    P W
Sbjct: 84  TPPMFGDFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPW 143

Query: 123 FQLGVSRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAIL 182
           F+L  SRG E+  +KSYMRFTVLLSE + YIP ++YF KW+G+ + Q+PIGQ++AAAAIL
Sbjct: 144 FELDASRGMETDGIKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAIL 203

Query: 183 FQPSLILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPIXX 242
           FQP+L+LIDHGHFQYN VMLGLTVYAINNLLD +YA AA+CFVLS+CFKQMALYYAPI  
Sbjct: 204 FQPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFF 263

Query: 243 XXXXXXXXXX-XXXNLPRLLAVAAATLISFAAMFFPLYMWGGIRNVLQSIHRIFPFSRGI 301
                         N+PR L+VA ATL S   MF PLY++GG+ NVLQSIHRIFPF+RGI
Sbjct: 264 AVLLSKSLFFPRLFNIPRFLSVAFATLASLFVMFAPLYIFGGVGNVLQSIHRIFPFARGI 323

Query: 302 FEDKVANFWCFSNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHLIPYALT 361
           FEDKVANFWC +N+F KYK ++TQS+LQ YSL AT +GF PAF+++ FYPKK LIPY L 
Sbjct: 324 FEDKVANFWCVTNVFFKYKTMFTQSELQFYSLVATVVGFFPAFMIMIFYPKKFLIPYGLA 383

Query: 362 ACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVSWINNMAFFTLWPLLKKDGL 421
           ACSM+FFLFSFQVHEK            +TST+WN LSMV W+NN+A FTLWPLLKKDGL
Sbjct: 384 ACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWPLLKKDGL 443

Query: 422 VLQYATLLLLSNWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIFWKLIIV 481
            LQY   L++ NWL+GNFSF+TPRFLPK LTPGPS S+++ENYRRRSLLP NI WK+II+
Sbjct: 444 WLQYCVCLVMYNWLLGNFSFITPRFLPKILTPGPSISNIAENYRRRSLLPHNIIWKIIIL 503

Query: 482 ASYISMGILHLLDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRNKTLYD 540
            SY+ M ++H+L++ +  P++YPDLWV LNC++GF  F LFW+W YYK+ TLRNKT+ +
Sbjct: 504 VSYLCMLMIHVLEYTIAAPSQYPDLWVQLNCTVGFGCFVLFWMWTYYKLITLRNKTIQE 562

>Skud_15.163 Chr15 (289416..291050) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  737 bits (1902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/543 (64%), Positives = 426/543 (78%), Gaps = 3/543 (0%)

Query: 1   MSSKRKPYSRKIVKESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSFSG 60
           M+  ++    K  +ESF+ASP++DFL PFRPV NQW  +YII + A+I+RC +GLG +SG
Sbjct: 1   MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSG 60

Query: 61  MNVPPMHGDFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDP 120
            + PP+HGDFEAQRHWME+T +LPLS+WYWYDL YWGLDYPPLTA+HS + G +G  F+P
Sbjct: 61  KDSPPLHGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNP 120

Query: 121 TWFQLGVSRGQESMD--LKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAA 178
           +WF L  SRG ES D  LK+YMR TV++S++L Y P VIYF KW+G++R Q+PIGQ IAA
Sbjct: 121 SWFALDKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAA 180

Query: 179 AAILFQPSLILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYA 238
           AAILFQPSL+LIDHGHFQYNSVMLGLT YAINNLLDEYYA AA+CFVLS+CFKQMALYYA
Sbjct: 181 AAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYA 240

Query: 239 PIXXXXXXXXXXXXXXXNLPRLLAVAAATLISFAAMFFPLY-MWGGIRNVLQSIHRIFPF 297
           PI               N+ RL  +A ATL +F+ +  PLY + GG+RN+ Q I+RIFPF
Sbjct: 241 PIFFAYLLSRSLLFPKFNIARLTVIAFATLATFSVILAPLYFLGGGLRNIHQCIYRIFPF 300

Query: 298 SRGIFEDKVANFWCFSNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHLIP 357
           SRGIFEDKVANFWC +NIF+KYK  +T  QLQ+YSL AT +GFLPA I+   +PKKHL+P
Sbjct: 301 SRGIFEDKVANFWCVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLP 360

Query: 358 YALTACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVSWINNMAFFTLWPLLK 417
           Y L ACSMSFFLFSFQVHEK            Y+STDWNVLS+VSWINN+A FTLWPLLK
Sbjct: 361 YVLIACSMSFFLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLK 420

Query: 418 KDGLVLQYATLLLLSNWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIFWK 477
           KDGL LQY    LLSNWLIGNFSF+TPRFLPK LTPGPS S ++ +YRRRSLLP N+ WK
Sbjct: 421 KDGLHLQYTVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK 480

Query: 478 LIIVASYISMGILHLLDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRNKT 537
             I+ +YI+MG+ HLLD +V PP+KYPDLWVLLNC++GF  F +FW+W+YYK+FT  NK+
Sbjct: 481 SFIIGTYIAMGVYHLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKS 540

Query: 538 LYD 540
           + D
Sbjct: 541 VKD 543

>Smik_15.171 Chr15 (296715..298349) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/543 (64%), Positives = 427/543 (78%), Gaps = 3/543 (0%)

Query: 1   MSSKRKPYSRKIVKESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSFSG 60
           M+  ++    K  +ESF+ASP++DFL PFRPV NQW  +YII + A+I+RC +GLG +SG
Sbjct: 1   MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCTIGLGPYSG 60

Query: 61  MNVPPMHGDFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDP 120
              PP+HGDFEAQRHWME+T +LPLS+WYWYDL YWGLDYPPLTA+HSY+LG +G  F+P
Sbjct: 61  KGSPPLHGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNP 120

Query: 121 TWFQLGVSRGQESMD--LKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAA 178
           +WF L  SRG ES D  LK+YMR TV++S++L Y P VIYF KW+G++R Q+PIGQ IAA
Sbjct: 121 SWFALDKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAA 180

Query: 179 AAILFQPSLILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYA 238
           +AILFQPSL+LIDHGHFQYNSVMLGLT YAINNLLDEYYA AA+CFVLS+CFKQMALYYA
Sbjct: 181 SAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAMCFVLSICFKQMALYYA 240

Query: 239 PIXXXXXXXXXXXXXXXNLPRLLAVAAATLISFAAMFFPLY-MWGGIRNVLQSIHRIFPF 297
           PI               N+ RL  ++ ATL +FA M  PLY + GG++N+ Q IHRIFPF
Sbjct: 241 PIFFAYLLSRSLLFPKFNIARLTVISFATLATFALMLAPLYFLGGGLKNIYQCIHRIFPF 300

Query: 298 SRGIFEDKVANFWCFSNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHLIP 357
           +RGIFEDKVANFWC +N+F+KYK  ++  QLQ+YSL AT +GFLPA ++   +PKKHL+P
Sbjct: 301 ARGIFEDKVANFWCVTNVFVKYKERFSVQQLQLYSLVATVIGFLPAMVMTLLHPKKHLLP 360

Query: 358 YALTACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVSWINNMAFFTLWPLLK 417
           Y L ACSMSFFLFSFQVHEK            Y+STDWNVLS+VSWINN+A FTLWPLLK
Sbjct: 361 YVLIACSMSFFLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLK 420

Query: 418 KDGLVLQYATLLLLSNWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIFWK 477
           +DGL LQYA   LLSNWLIGNFSF+TPRFLPK LTPGPS S ++ +YRRRSLLP N+ WK
Sbjct: 421 RDGLHLQYAVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK 480

Query: 478 LIIVASYISMGILHLLDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRNKT 537
             I+ +YI+MG+ H LD +V PP+KYPDLWVLLNC++GF  F +FWVW+YYK+FT  +K+
Sbjct: 481 SFIIGTYIAMGLYHFLDLFVAPPSKYPDLWVLLNCTVGFTCFSIFWVWSYYKIFTSGSKS 540

Query: 538 LYD 540
           + D
Sbjct: 541 MKD 543

>YOR002W Chr15 (329417..331051) [1635 bp, 544 aa] {ON}  ALG6Alpha
           1,3 glucosyltransferase, involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation; mutations in human ortholog are
           associated with disease
          Length = 544

 Score =  734 bits (1895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/543 (64%), Positives = 427/543 (78%), Gaps = 3/543 (0%)

Query: 1   MSSKRKPYSRKIVKESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSFSG 60
           M+  ++    K  +ESF+ASP++DFL PFRPV NQW  +YII + A+I+RC +GLG +SG
Sbjct: 1   MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSG 60

Query: 61  MNVPPMHGDFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDP 120
              PP++GDFEAQRHWME+T +LPLS+WYWYDL YWGLDYPPLTA+HSY+LG +G  F+P
Sbjct: 61  KGSPPLYGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNP 120

Query: 121 TWFQLGVSRGQESMD--LKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAA 178
           +WF L  SRG ES D  LK+YMR TV++S++L Y P VIYF KW+G++R Q+PIGQ IAA
Sbjct: 121 SWFALEKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAA 180

Query: 179 AAILFQPSLILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYA 238
           +AILFQPSL+LIDHGHFQYNSVMLGLT YAINNLLDEYYA AA+CFVLS+CFKQMALYYA
Sbjct: 181 SAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYA 240

Query: 239 PIXXXXXXXXXXXXXXXNLPRLLAVAAATLISFAAMFFPLY-MWGGIRNVLQSIHRIFPF 297
           PI               N+ RL  +A ATL +FA +F PLY + GG++N+ Q IHRIFPF
Sbjct: 241 PIFFAYLLSRSLLFPKFNIARLTVIAFATLATFAIIFAPLYFLGGGLKNIHQCIHRIFPF 300

Query: 298 SRGIFEDKVANFWCFSNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHLIP 357
           +RGIFEDKVANFWC +N+F+KYK  +T  QLQ+YSL AT +GFLPA I+   +PKKHL+P
Sbjct: 301 ARGIFEDKVANFWCVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLP 360

Query: 358 YALTACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVSWINNMAFFTLWPLLK 417
           Y L ACSMSFFLFSFQVHEK            Y+STDWNVLS+VSWINN+A FTLWPLLK
Sbjct: 361 YVLIACSMSFFLFSFQVHEKTILIPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLK 420

Query: 418 KDGLVLQYATLLLLSNWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIFWK 477
           KDGL LQYA   LLSNWLIGNFSF+TPRFLPK LTPGPS S ++ +YRRRSLLP N+ WK
Sbjct: 421 KDGLHLQYAVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK 480

Query: 478 LIIVASYISMGILHLLDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRNKT 537
             I+ +YI+MG  H LD +V PP+KYPDLWVLLNC++GF  F +FW+W+YYK+FT  +K+
Sbjct: 481 SFIIGTYIAMGFYHFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKS 540

Query: 538 LYD 540
           + D
Sbjct: 541 MKD 543

>NDAI0C02630 Chr3 (609993..611735) [1743 bp, 580 aa] {ON} Anc_6.22
           YOR002W
          Length = 580

 Score =  733 bits (1891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/543 (63%), Positives = 420/543 (77%), Gaps = 5/543 (0%)

Query: 3   SKRKPYSRKIVKESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSFSGMN 62
           +  +P   +  KESF+ASPL+DFL PFRP  +QW  +YIIVLFA+IIRC VGLG +SG N
Sbjct: 37  NNNQPLETETSKESFYASPLYDFLYPFRPAGSQWMTEYIIVLFAIIIRCAVGLGPYSGFN 96

Query: 63  VPPMHGDFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDPTW 122
            PPM GDFEAQRHWME+T  LP+SQWYW+DL YWGLDYPPLTA+HSY+ GK+G  F P W
Sbjct: 97  TPPMFGDFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNW 156

Query: 123 FQLGVSRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAIL 182
           F LG SRG E  DLK++MR TVL SE L YIP V+YF KW+GK R Q+PIGQ+IA AAIL
Sbjct: 157 FTLGDSRGYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAIL 216

Query: 183 FQPSLILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPIXX 242
           FQPSLILIDHGHFQ+NSVMLGLTVY +NNLLDE+YA AA+CFVLS+CFKQMALYY+PI  
Sbjct: 217 FQPSLILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFF 276

Query: 243 XXXXXXXXXX-XXXNLPRLLAVAAATLISFAAMFFPLYMW----GGIRNVLQSIHRIFPF 297
                         N+PR  A++ AT+ +FA+MF P+Y +    GGI N+LQSI RIFPF
Sbjct: 277 AYLLSKSLFHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLLQSIKRIFPF 336

Query: 298 SRGIFEDKVANFWCFSNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHLIP 357
           +RGIFEDKVANFWC +N+  KYK  +TQ QLQ+YSL  T + FLPA ++I  YP+K+L+ 
Sbjct: 337 ARGIFEDKVANFWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYPRKYLLL 396

Query: 358 YALTACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVSWINNMAFFTLWPLLK 417
           YAL+ACSMSF+LFSFQVHEK            YTSTD NVLS VSW+NN+  FTLWPLLK
Sbjct: 397 YALSACSMSFYLFSFQVHEKTILMPLLPITLLYTSTDRNVLSRVSWMNNIGLFTLWPLLK 456

Query: 418 KDGLVLQYATLLLLSNWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIFWK 477
           KDGL LQY   L+LSNWLIGNFSF+TPRFLPK LTPGPS   + ENYRR +LLP N  WK
Sbjct: 457 KDGLSLQYWVCLILSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPTLLPSNWIWK 516

Query: 478 LIIVASYISMGILHLLDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRNKT 537
           +IIV SY+ MG++H +D++++PP+ YPDLWV+LNC+LGF  F LFW+WNYYK+F++  K 
Sbjct: 517 VIIVLSYVMMGVIHFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYYKLFSMTKKN 576

Query: 538 LYD 540
           ++ 
Sbjct: 577 IHQ 579

>TPHA0J00350 Chr10 complement(77974..79653) [1680 bp, 559 aa] {ON}
           Anc_6.22 YOR002W
          Length = 559

 Score =  729 bits (1881), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/526 (65%), Positives = 417/526 (79%), Gaps = 2/526 (0%)

Query: 15  ESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSFSGMNVPPMHGDFEAQR 74
           E F+ASPL+ FLSPF+   NQW + YIIVLFALIIRC +GLG +SGMN  PM GDFEAQR
Sbjct: 31  EPFYASPLYTFLSPFKSTTNQWLSVYIIVLFALIIRCAIGLGPYSGMNEAPMFGDFEAQR 90

Query: 75  HWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDPTWFQLGVSRGQESM 134
           HWME+T +LP+SQWY+YDL YWGLDYPPLTAYHSYI G +G  F+P WF+L  SRG E  
Sbjct: 91  HWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKFFNPAWFELETSRGMEMK 150

Query: 135 DLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAILFQPSLILIDHGH 194
           +LK++MR T ++SE++ YIP +IYF  W+GK R Q+P+GQYIAAAAILFQP L+LIDHGH
Sbjct: 151 ELKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAILFQPCLMLIDHGH 210

Query: 195 FQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPIXXXXXX-XXXXXXX 253
           FQYNSVMLGLTVYAINNLLD+ YAPAAI FV+S+CFKQM+LYYAPI              
Sbjct: 211 FQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIFFAYLLGRSLFKKQ 270

Query: 254 XXNLPRLLAVAAATLISFAAMFFPLYMWGG-IRNVLQSIHRIFPFSRGIFEDKVANFWCF 312
             N+ R L +A AT++SF  +F PLY++GG  RN++QS+HRIFPF+RGIFEDKVANFWC 
Sbjct: 271 FFNVSRFLNIAIATMVSFFTVFAPLYVFGGGKRNIIQSVHRIFPFARGIFEDKVANFWCV 330

Query: 313 SNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHLIPYALTACSMSFFLFSF 372
           +N+ +KYKV YTQ +LQ+YSL  T +GFLPA + I ++PKKHL+PY+L AC+MSFFLFSF
Sbjct: 331 TNVIMKYKVNYTQDELQLYSLILTVVGFLPAMVTILWFPKKHLLPYSLAACAMSFFLFSF 390

Query: 373 QVHEKXXXXXXXXXXXXYTSTDWNVLSMVSWINNMAFFTLWPLLKKDGLVLQYATLLLLS 432
           QVHEK            YTSTDWNVLS+VSWINN+A FTLWPLLKKDG+VLQY    +LS
Sbjct: 391 QVHEKTILVPLLPITLLYTSTDWNVLSLVSWINNVALFTLWPLLKKDGVVLQYGVCFILS 450

Query: 433 NWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIFWKLIIVASYISMGILHL 492
           NWLIGNFSF TPRFLPK LTPGP   +V+ +YRRRSLLP+NI WK+IIV SYI M  +  
Sbjct: 451 NWLIGNFSFFTPRFLPKILTPGPPIQNVNTHYRRRSLLPNNIIWKIIIVLSYIVMVAIQG 510

Query: 493 LDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRNKTL 538
           L+ +V+PP +YPD++VLLNC+LGF  F  FW+WNYYK+FTL +K L
Sbjct: 511 LELFVEPPPQYPDIFVLLNCTLGFCCFTSFWLWNYYKLFTLTSKNL 556

>ACR004W Chr3 (360904..362595) [1692 bp, 563 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR002W (ALG6)
          Length = 563

 Score =  729 bits (1881), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/528 (65%), Positives = 407/528 (77%)

Query: 13  VKESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSFSGMNVPPMHGDFEA 72
           +KE+FFASPL+DFL P RPV NQW AKYIIV+FALIIR  VGLG +SGM  PPM GDFEA
Sbjct: 35  LKEAFFASPLYDFLYPLRPVTNQWAAKYIIVIFALIIRLAVGLGGYSGMGKPPMFGDFEA 94

Query: 73  QRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDPTWFQLGVSRGQE 132
           QRHWME+T ++P+S+WY++ L YWGLDYPPLTAYHSY+LGKLG    P WF L  SRG E
Sbjct: 95  QRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLHASRGYE 154

Query: 133 SMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAILFQPSLILIDH 192
           S DLKSYMR TV+LSEL  YIP V+YF +WIG+ R Q+PIGQYIA AAILFQP+LILIDH
Sbjct: 155 SEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPALILIDH 214

Query: 193 GHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPIXXXXXXXXXXXX 252
           GHFQYN VMLGLTV AINNLLD+YYA AA+ FV S+ FKQMALYYAP+            
Sbjct: 215 GHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLLSRSIYY 274

Query: 253 XXXNLPRLLAVAAATLISFAAMFFPLYMWGGIRNVLQSIHRIFPFSRGIFEDKVANFWCF 312
              N+PR +AVA ATLI+F  ++ PLY+ G I  + QSIHR+FPF RG+FEDKVANFWC 
Sbjct: 275 PRLNIPRFVAVAVATLIAFGVLYAPLYLLGNISAIFQSIHRVFPFERGLFEDKVANFWCV 334

Query: 313 SNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHLIPYALTACSMSFFLFSF 372
           +N+ +KYK  YT SQL+ +SL  T+   LP+ I+ F YPKK ++PYAL ACSMSFFLF F
Sbjct: 335 TNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKKFMLPYALAACSMSFFLFGF 394

Query: 373 QVHEKXXXXXXXXXXXXYTSTDWNVLSMVSWINNMAFFTLWPLLKKDGLVLQYATLLLLS 432
           QVHEK            YTSTDWNVLSMV+WINN+A FTLWPLLKKDGL LQYA + LLS
Sbjct: 395 QVHEKTILVPLLPITLLYTSTDWNVLSMVAWINNIALFTLWPLLKKDGLSLQYAIMFLLS 454

Query: 433 NWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIFWKLIIVASYISMGILHL 492
           NWLIGNFSF+TP FLPK LTPGPS SDV++ YRRRSLLP NI W++IIV SYI +G +H+
Sbjct: 455 NWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLPSNIIWRIIIVVSYICVGAIHI 514

Query: 493 LDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRNKTLYD 540
            + +  P  + PD+WVL NC +G  SF LFW+WN YKMF +RN T+ D
Sbjct: 515 AELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMFAMRNSTISD 562

>TBLA0G00970 Chr7 (246516..248195) [1680 bp, 559 aa] {ON} Anc_6.22
           YOR002W
          Length = 559

 Score =  724 bits (1868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/542 (65%), Positives = 422/542 (77%), Gaps = 15/542 (2%)

Query: 14  KESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSFSGMNVPPMHGDFEAQ 73
           +E+F+ASPLFDFL PFRPV +QW  +Y+I++FA+IIRC + LGS+SG   PPM GDFEAQ
Sbjct: 17  EEAFYASPLFDFLYPFRPVGSQWLTEYVIIIFAIIIRCAISLGSYSGKGTPPMFGDFEAQ 76

Query: 74  RHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDPTWFQLGVSRGQES 133
           RHWME+T +LP+S+WYW+DL YWGLDYPP TAYHSY  GKLG  F+P WF L  SRG ES
Sbjct: 77  RHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRGYES 136

Query: 134 MD--LKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAILFQPSLILID 191
            D  LK+YMRFTV+LSE + YIP V+YF KW+GKHR Q+PIGQ+IAAAAILFQPSL+LID
Sbjct: 137 DDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLMLID 196

Query: 192 HGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPIXXXXXXXXXXX 251
           HGHFQYNSVMLGLTVYAINNLLDE+Y PAAICFVLS+CFKQMALYY+PI           
Sbjct: 197 HGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSKSLV 256

Query: 252 XXXXNLPRLLAVAAATLISFAAMFFPLYMWG-------------GIRNVLQSIHRIFPFS 298
               N+ R + VA +T++SF  MF P+Y++G             G+ N++Q I RIFPF+
Sbjct: 257 HPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIFPFA 316

Query: 299 RGIFEDKVANFWCFSNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHLIPY 358
           RGIFEDKVANFWC +N+ IKY+ L+TQ QLQ YSL AT +GFLP+ I IF YP+K LIPY
Sbjct: 317 RGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFLIPY 376

Query: 359 ALTACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVSWINNMAFFTLWPLLKK 418
           AL ACSMSFFLFSFQVHEK            YTSTDWNVLS+V WINN+A FTLWPLL+K
Sbjct: 377 ALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLRK 436

Query: 419 DGLVLQYATLLLLSNWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIFWKL 478
           DGLVLQY     LSNWLIGNFSF+TP+FLP FLTPGPS S++ ++YRR SLLP NI WK+
Sbjct: 437 DGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNILWKI 496

Query: 479 IIVASYISMGILHLLDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRNKTL 538
           II++SYI MG + +LD + QPP  YPDLW++LNC++GF  F LFW+WN YK+  +RNKTL
Sbjct: 497 IIISSYIVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRNKTL 556

Query: 539 YD 540
            D
Sbjct: 557 ND 558

>KLTH0F17666g Chr6 complement(1425802..1427469) [1668 bp, 555 aa]
           {ON} highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 555

 Score =  115 bits (288), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 110/418 (26%), Positives = 169/418 (40%), Gaps = 82/418 (19%)

Query: 69  DFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDPTWFQLG-- 126
           DF+  R+W+ +T  LPL +WY+     W LDYPP  AY  ++L +    F P   Q    
Sbjct: 44  DFDVHRNWLAITNKLPLHKWYYESTSQWTLDYPPFFAYFEWLLSQ----FVPQRVQDDGC 99

Query: 127 ---VSRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAILF 183
              V+ GQ  +    + R TV++SE+LL++   +Y    I K         ++ A++I+ 
Sbjct: 100 LDIVAVGQFGLPTIVFQRVTVIVSEILLFVVLQVY----INKSHISDRSANFVVASSIVL 155

Query: 184 QPSLILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAP---- 239
            P  ++IDH HFQYN  +  + + +I     + Y      F  ++CFK + LY AP    
Sbjct: 156 SPGFLIIDHIHFQYNGFLFAILIASIVAAKHQRYLLCGFFFSTALCFKHIFLYLAPSFFA 215

Query: 240 ------IXXXXXXXXXXXXXXXNLPR---LLAVAAATLISFAAMFFPLYMWGGIRNVLQS 290
                 I               ++ R   L  +    L  FA  F P      I  + Q 
Sbjct: 216 FLLRVYILDFSNFRFRTYNDLISMVRWKNLFKLGTVVLSVFAVCFAPF-----IYQLPQL 270

Query: 291 IHRIFPFSRGIFEDKVA-NFWCFSNIFIKYKVLY-------------------------- 323
           + R+FPFSRG+     A NFW   +   K   L+                          
Sbjct: 271 MSRLFPFSRGLTHAYWAPNFWALYSALDKVLTLFFLKVPYVHKFLTQVVSPPLIPVTIDE 330

Query: 324 TQSQLQMYSLCATAL------GFLP------AFILIFFYPKKHLIPY-----------AL 360
            +++LQ Y++    L        LP       FIL  FY    +IP            +L
Sbjct: 331 IKTKLQQYNVGTKGLVQDVYFVILPQIQPKLTFILTLFYQILAVIPVLFSPSFERFVGSL 390

Query: 361 TACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVSWINNMAFFTLWPLLKK 418
           T C  + FLF + VHEK             T TD  +L+    + +  + +L+PLL +
Sbjct: 391 TLCGFASFLFGWHVHEKAVLLIIIPFSFLVT-TDRRLLTPFHLVASAGYVSLFPLLHE 447

>Kwal_55.21742 s55 complement(960476..962143) [1668 bp, 555 aa] {ON}
           YOR067C (ALG8) - glycosyl transferase [contig 126] FULL
          Length = 555

 Score =  115 bits (288), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 109/417 (26%), Positives = 167/417 (40%), Gaps = 74/417 (17%)

Query: 66  MHGDFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKL-GDIFDPTWFQ 124
           +  DF+  R+W+ +T  LPL QWY+ +   W LDYPP  AY  + L +L  +I       
Sbjct: 41  LSTDFDVHRNWLAITNKLPLKQWYFENTSQWTLDYPPFFAYFEWALSQLVPNIVRQDGCL 100

Query: 125 LGVSRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAILFQ 184
             V  GQ  M    + R TV+ SE+LL++   +Y    I K         ++ A++I+  
Sbjct: 101 DIVKVGQFGMPTIVFQRLTVIASEILLFVVLQVY----INKSHISERSANFVVASSIVLS 156

Query: 185 PSLILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPIXXXX 244
           P  ++IDH HFQYN  +  + + +I    ++ Y    + F +++CFK + LY AP     
Sbjct: 157 PGFLIIDHIHFQYNGFLFAILIASIVAAKEQRYLLCGLFFSIAICFKHIFLYLAPSFFVF 216

Query: 245 XXXXXXX-------------XXXXNLPRLLAVAAATLISFAAMFFPLYMWGGIRNVLQSI 291
                                       L  + +  L  F   F P      I    Q +
Sbjct: 217 LLRVYVLDFSNFHFKSYNDLISIVQWRNLFKLGSVVLCVFGVCFAPF-----ISQWPQLL 271

Query: 292 HRIFPFSRGIFEDKVA-NFWCFSNIFIKY------KVLYT-------------------- 324
            R+FPFSRG+     A NFW   ++  K       KV Y                     
Sbjct: 272 SRLFPFSRGLTHAYWAPNFWAMYSLLDKVLTLIILKVPYVHKFLTQFIAPPLIPATIGEI 331

Query: 325 QSQLQMYSLCATAL------GFLP------AFILIFFYPKKHLIPY-----------ALT 361
           + +L  Y++    L        LP       FIL  FY    +IP            +LT
Sbjct: 332 KQKLLQYNVGTKGLVQDVYFVILPQIQPRLTFILTLFYQILAIIPVLFSPSFKRFVGSLT 391

Query: 362 ACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVSWINNMAFFTLWPLLKK 418
            C  + FLF + VHEK             TS D  +L+  + + +  + +L+PLL +
Sbjct: 392 LCGFASFLFGWHVHEKAIMLIIIPFSFLVTS-DRRLLTPFNLLASAGYVSLFPLLHE 447

>TPHA0J01380 Chr10 complement(321431..323158) [1728 bp, 575 aa] {ON}
           Anc_5.669 YOR067C
          Length = 575

 Score =  115 bits (288), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 77/258 (29%), Positives = 118/258 (45%), Gaps = 24/258 (9%)

Query: 69  DFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLG-DIFDPTWFQLGV 127
           DF+  R+W+ +T+NLP+S+WY+ +   W LDYPP  AY  ++L +   +I         V
Sbjct: 64  DFDVHRNWLAITSNLPISKWYYENTSEWTLDYPPFFAYFEWVLSRFAPEIVKNDGCLDIV 123

Query: 128 SRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAILFQPSL 187
             GQ  +    + R TV++SE+LL+     Y      K RGQ     ++ A++I+  P  
Sbjct: 124 EVGQFGLPTIVFQRLTVIISEILLFAVLQYYINTSNSKERGQC----FVVASSIVLSPGF 179

Query: 188 ILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPIXXXXXXX 247
           ++IDH HFQYN  +  + + +I     + Y   A+ + +S+CFK + LY AP        
Sbjct: 180 LIIDHIHFQYNGFLFAIFIASIVAAKQKKYLACAVFYSISLCFKHIFLYLAPCYFVFLLR 239

Query: 248 XXX-------------XXXXXNLPRLLAVAAATLISFAAMFFPLYMWGGIRNVLQSIHRI 294
                                   RL  +A      F   F P      I  + Q + R+
Sbjct: 240 AYVLNFENFKFKSYMDLQSVIQWKRLFKLAGIVSGIFTICFAPF-----IFQLPQVLSRL 294

Query: 295 FPFSRGIFEDKVA-NFWC 311
           FPFSRG+     A NFW 
Sbjct: 295 FPFSRGLTHAYWAPNFWA 312

>YOR067C Chr15 complement(451729..453462) [1734 bp, 577 aa] {ON}
           ALG8Glucosyl transferase, involved in N-linked
           glycosylation; adds glucose to the dolichol-linked
           oligosaccharide precursor prior to transfer to protein
           during lipid-linked oligosaccharide biosynthesis;
           similar to Alg6p
          Length = 577

 Score =  110 bits (274), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 97/374 (25%), Positives = 151/374 (40%), Gaps = 75/374 (20%)

Query: 69  DFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKL--GDIFDPTWFQLG 126
           DF+  R+W+ +T  LP+S+WY+     W LDYPP  AY  + L +     + D     + 
Sbjct: 66  DFDVHRNWLAITNKLPISEWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKSVRDDGCLDI- 124

Query: 127 VSRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAILFQPS 186
           V  G+  +    + R TV+ SE+LL++   IY        R Q+    ++ A++I+  P 
Sbjct: 125 VEIGKFGLPTIVFQRLTVIFSEILLFVILQIYINTTKLSERSQS----FVVASSIVLSPG 180

Query: 187 LILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAP------- 239
            ++IDH HFQYN  +  + + +I    ++ Y   A+ +  ++CFK + LY AP       
Sbjct: 181 FLIIDHIHFQYNGFLFAILIGSIVAAKNKRYILCAVLYTTAICFKHIFLYLAPCYFVFLL 240

Query: 240 ------IXXXXXXXXXXXXXXXNLPRLLAVAAATLISFAAMFFPLYMWGGIRNVLQSIHR 293
                 +                   LL +A   +  F   F P         + Q + R
Sbjct: 241 RAYVLNVNNFKFKSYKDFLFLIRWANLLKLATVVVGIFTICFLPF-----AHQMPQVLSR 295

Query: 294 IFPFSRGIFEDKVA-NFWC---------------------FSNIFIKYKVLYTQSQLQMY 331
           +FPFSRG+     A NFW                      F+  FIK  ++    +    
Sbjct: 296 LFPFSRGLTHAYWAPNFWALYSFMDKILTTVMLKLPYVHTFATKFIKPPLIPQNIKEINE 355

Query: 332 SLCATALG-----------FLP------AFILIFFYPKKHLIPY-----------ALTAC 363
            L A   G            LP       FIL  FY    ++P            +LT C
Sbjct: 356 RLAANNNGSKGLVQDVFFVILPQIPPKLTFILTIFYQVLAVLPLLFDPSFKRFVGSLTLC 415

Query: 364 SMSFFLFSFQVHEK 377
            ++ FLF + VHEK
Sbjct: 416 GLASFLFGWHVHEK 429

>TBLA0A09310 Chr1 (2297508..2299148) [1641 bp, 546 aa] {ON}
           Anc_5.669 YOR067C
          Length = 546

 Score =  108 bits (271), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 95/401 (23%), Positives = 164/401 (40%), Gaps = 61/401 (15%)

Query: 69  DFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDPTWFQLGV- 127
           DF+  R+W+ +T  LPL +WY+ +   W LDYPP  AY  + L +    F      L + 
Sbjct: 43  DFDVHRNWLAITNKLPLREWYYENTSQWTLDYPPFFAYFEWFLSQFVPKFVKEDGCLDIL 102

Query: 128 SRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAILFQPSL 187
             G+       + R TV++SE+LL++   ++        + Q+    ++ A++I+  P  
Sbjct: 103 PEGEFGWSTIVFQRLTVIISEILLFVVLQVFINNSGSNEKTQS----FVVASSIILSPGF 158

Query: 188 ILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPIXXXXXXX 247
           ++IDH HFQYN  + G+ + +I    ++ Y    + + +++CFK + LY AP        
Sbjct: 159 LMIDHIHFQYNGFLFGILIASIVAAKNKRYLLCGLFYSIALCFKHIFLYLAPCYFVFLLR 218

Query: 248 XXX-------------XXXXXNLPRLLAVAAATLISFAAMFFPLYMWGGIRNVLQSIHRI 294
                                    L+ +    +      F P +     R++ Q + R+
Sbjct: 219 AYVLNFQDFKFKSYKDLILVVQWGNLMKLGGIVVCVMGVCFGPFW-----RDMNQLLSRL 273

Query: 295 FPFSRGI--------------FEDKVANFWCFSNIFIKYKVLYTQSQLQMYSLCATAL-- 338
           FPFSRG+              F DK+ +       F K+  L    + + ++  +  L  
Sbjct: 274 FPFSRGLTHAYWAPNFWAIYSFVDKMLSILFVRVPFNKFINLDKIEERKRWNNGSRGLVE 333

Query: 339 ----GFLP------AFILIFFYPKKHLIPY-----------ALTACSMSFFLFSFQVHEK 377
                 LP       F+L  FY    ++P            +LT C  + FLF + VHEK
Sbjct: 334 DVFFVILPQIQPNLTFVLTLFYQVLAVVPVLFDPSFKRFIGSLTLCGFASFLFGWHVHEK 393

Query: 378 XXXXXXXXXXXXYTSTDWNVLSMVSWINNMAFFTLWPLLKK 418
                           D  +LS    + +  + +L+PLL K
Sbjct: 394 AILLVIIPFSFL-VVCDRRLLSSFMLVGSAGYVSLFPLLFK 433

>CAGL0L10450g Chr12 complement(1117959..1119611) [1653 bp, 550 aa]
           {ON} similar to uniprot|P40351 Saccharomyces cerevisiae
           YOR067c ALG8 Glucosyltransferase
          Length = 550

 Score =  107 bits (268), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 106/429 (24%), Positives = 173/429 (40%), Gaps = 84/429 (19%)

Query: 69  DFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDPTWFQLG-- 126
           DF+  R+W+ +T  LPL QWY+     W LDYPP  AY  + L +    F P++ +    
Sbjct: 36  DFDVHRNWLAITNKLPLRQWYYEHTSQWTLDYPPFFAYFEWFLSQ----FVPSYVKSDGC 91

Query: 127 ---VSRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAILF 183
              V  GQ  M    + R TV+ SE+LL++   +Y        R Q+    ++ A++I  
Sbjct: 92  LDIVEVGQFGMPTVVFQRLTVIASEILLFVVLQVYINTSKVSERTQS----FVVASSIAI 147

Query: 184 QPSLILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAP---- 239
            P  ++IDH HFQYN  +  + + +I    ++ Y      + +++CFK + LY AP    
Sbjct: 148 SPGFLIIDHIHFQYNGFLFAILIASIVAAKNKKYLWCGFFYSVALCFKHIYLYLAPCYFV 207

Query: 240 ---------IXXXXXXXXXXXXXXXNLPRLLAVAAATLISFAAMFFPLYMWGGIRNVLQS 290
                    +                   L+ + +  + +FA  F P      I ++ Q 
Sbjct: 208 FLLRAYVLNLKDFKFKSYRDLIFIVKWRHLVKLGSVVIATFAVAFGPF-----IFDLPQL 262

Query: 291 IHRIFPFSRGIFEDKVA-NFWC--------FSNIFIKYKVLYT-QSQLQMYSLCATALGF 340
           + R+FPFSRG+     A NFW          + +F+K    Y   SQ     L   +L  
Sbjct: 263 LTRLFPFSRGLTHAYWAPNFWAIYSTIDKILTMVFLKMPYTYKLASQFISPPLIPASLNE 322

Query: 341 LPA-----------------------------FILIFFYPKKHLIPY-----------AL 360
           + A                             F+L   Y    ++P            ++
Sbjct: 323 IKAKMAANNNGSKGLVEDVYFVILPQIVPKLTFLLTLLYQVLAVVPVLFDPSFKRFMGSM 382

Query: 361 TACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVSWINNMAFFTLWPLL--KK 418
           T C ++ FLF + VHEK              S D  +LS    + +  + +L+PLL   +
Sbjct: 383 TLCGLASFLFGWHVHEKAIMLVIIPFSFLVIS-DRRLLSSFMLLTSAGYVSLFPLLYESQ 441

Query: 419 DGLVLQYAT 427
           D L+  + T
Sbjct: 442 DFLIKTFYT 450

>Smik_15.247 Chr15 complement(417710..419443) [1734 bp, 577 aa] {ON}
           YOR067C (REAL)
          Length = 577

 Score =  105 bits (262), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 96/374 (25%), Positives = 148/374 (39%), Gaps = 75/374 (20%)

Query: 69  DFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKL--GDIFDPTWFQLG 126
           DF+  R+W+ +T  LP+S+WY+     W LDYPP  AY  + L +     + D     + 
Sbjct: 66  DFDVHRNWLAITNKLPISEWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRDDGCLDI- 124

Query: 127 VSRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAILFQPS 186
           V  G+  +    + R TV+ SE+LLY    IY        R Q+    ++ A++I+  P 
Sbjct: 125 VEVGKFGLPTIVFQRLTVIFSEILLYAVLQIYINTTKLSERSQS----FVVASSIVLSPG 180

Query: 187 LILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAP------- 239
            ++IDH HFQYN  +  + + +I    ++ Y   A  +  ++CFK + LY AP       
Sbjct: 181 FLMIDHIHFQYNGFLFAILIGSIVAAKNKKYLLCAFLYTTAICFKHIFLYLAPCYFVFLL 240

Query: 240 ------IXXXXXXXXXXXXXXXNLPRLLAVAAATLISFAAMFFPLYMWGGIRNVLQSIHR 293
                 +                   L  + +  +  F   F P         + Q + R
Sbjct: 241 RAYVLNVNNFKFKSYKDFLFLIRWANLFKLGSIVIGIFTICFVPF-----AHQMPQVLSR 295

Query: 294 IFPFSRGIFEDKVA-NFWC---------------------FSNIFIKYKVLYTQSQLQMY 331
           +FPFSRG+     A NFW                      F+  FIK  ++    +    
Sbjct: 296 LFPFSRGLTHAYWAPNFWALYSFMDKILTTVMLKLPYVHTFATKFIKPPLIPQNIKEINE 355

Query: 332 SLCATALG-----------FLP------AFILIFFYPKKHLIPY-----------ALTAC 363
            L A   G            LP       FIL  FY    ++P            +LT C
Sbjct: 356 RLAANNNGSKGLVQDVFFVILPQIPPKLTFILTLFYQNLAVLPLLFDPSFKRFVGSLTLC 415

Query: 364 SMSFFLFSFQVHEK 377
            ++ FLF + VHEK
Sbjct: 416 GLASFLFGWHVHEK 429

>ZYRO0A11506g Chr1 complement(925282..926952) [1671 bp, 556 aa] {ON}
           highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 556

 Score =  104 bits (260), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 72/258 (27%), Positives = 119/258 (46%), Gaps = 26/258 (10%)

Query: 69  DFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKL--GDIFDPTWFQLG 126
           DF+  R+W+ +T NLPL QWY+     W LDYPP  AY  + L +   G +      ++ 
Sbjct: 45  DFDVHRNWLAITHNLPLRQWYYEATSQWTLDYPPFFAYFEWFLSQFVPGTVKQDGCLEI- 103

Query: 127 VSRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAILFQPS 186
           V +GQ       + R TV+LSE+LL++   ++        R Q+    ++ A++I+  P+
Sbjct: 104 VDKGQFGWSTLVFQRSTVILSEILLFVVLQVFINTSSVTERTQS----FVIASSIVLSPA 159

Query: 187 LILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPIXXXXXX 246
            +++DH HFQYN  +  + + +I       Y   A  + +++CFK + LY AP       
Sbjct: 160 FLIVDHIHFQYNGFLFAILIASIVAAKRGKYLWCATFYSVALCFKHIFLYLAPCYFVFLL 219

Query: 247 XX-------------XXXXXXXNLPRLLAVAAATLISFAAMFFPLYMWGGIRNVLQSIHR 293
                                     L  + +  +  FA  F P      ++++ Q + R
Sbjct: 220 RAYCLNFQDFKFKSYKDLIFIVKWRHLFQLGSIVIGVFALCFGPF-----VKDLPQVLTR 274

Query: 294 IFPFSRGIFEDKVA-NFW 310
           +FPFSRG+     A NFW
Sbjct: 275 LFPFSRGLTHAYWAPNFW 292

>Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa]
           {ON} complement(205615..207480) [1866 nt, 622 aa]
          Length = 621

 Score =  103 bits (258), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 99/416 (23%), Positives = 168/416 (40%), Gaps = 76/416 (18%)

Query: 69  DFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKL--GDIFDPTWFQLG 126
           DF+  R+WM +T  LP+S+WY+ +   W LDYPP  AY  + L +     + D     + 
Sbjct: 109 DFDVHRNWMAITNALPISKWYFENTSQWTLDYPPFFAYFEWFLSQFVPKIVRDDGCLDI- 167

Query: 127 VSRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAILFQPS 186
           V  GQ       + R TV++SE+ L+     Y        R Q+    ++ A++I+  P 
Sbjct: 168 VEVGQFGWPTVVFQRLTVIISEICLFAVLQYYINTSNLNERTQS----FVVASSIVLSPG 223

Query: 187 LILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPIXXXXXX 246
            +++DH HFQYN+ +  + + +I     + Y   A+ + +++CFK + LY AP       
Sbjct: 224 FLIVDHIHFQYNAFLFSILIASIVAAKQKKYIACAVFYTIALCFKHIFLYLAPCYFVFLL 283

Query: 247 XXXX-------------XXXXXNLPRLLAVAAATLISFAAMFFPLYMWGGIRNVLQSIHR 293
                                    RLL + +  L  F   F P      I  + Q + R
Sbjct: 284 RAYVLNFKDFKFKSYKDLIFIVQWRRLLKLGSIVLGIFGICFAPF-----IFQMPQVLSR 338

Query: 294 IFPFSRGIFEDKVA-NFWC--------FSNIFIKYKVLY----------------TQSQL 328
           +FPFSRG+     A NFW          + + +K+  ++                 + +L
Sbjct: 339 LFPFSRGLTHAYWAPNFWAIYSFLDKILAVVMLKFPYVHRFISKFISSPLIPSSIAEIKL 398

Query: 329 QMYSLCATALGFLP--------------AFILIFFYPKKHLIPY-----------ALTAC 363
           +M      + G +                F+L  FY    +IP            +LT C
Sbjct: 399 RMEENNNGSKGLVEDVFFVILPQIQPKLTFLLTLFYQILAVIPVLFNPSFKRFIGSLTLC 458

Query: 364 SMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVSWINNMAFFTLWPLLKKD 419
            ++ +LF + VHEK                D  +LS    + +  + +L+PLL ++
Sbjct: 459 GLASYLFGWHVHEKAILLVIIPFSFLVV-CDRRLLSSFMLVASAGYVSLFPLLYEN 513

>Suva_8.118 Chr8 complement(214797..216527) [1731 bp, 576 aa] {ON}
           YOR067C (REAL)
          Length = 576

 Score =  103 bits (257), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 71/259 (27%), Positives = 114/259 (44%), Gaps = 26/259 (10%)

Query: 69  DFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKL--GDIFDPTWFQLG 126
           DF+  R+W+ +T  LP+S+WY+     W LDYPP  AY  + L +     + D     + 
Sbjct: 66  DFDVHRNWLAITNKLPMSEWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRDDGCLDI- 124

Query: 127 VSRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAILFQPS 186
           V  G+  +    + R TV+ SE+LL+    IY        R Q+    ++ A++I+  P 
Sbjct: 125 VEVGKFGLPTIVFQRLTVIFSEILLFAVLQIYINTTKLSERSQS----FVVASSIVLSPG 180

Query: 187 LILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAP------- 239
            ++IDH HFQYN  +  + + +I    ++ Y   A+ +  S+CFK + LY AP       
Sbjct: 181 FLMIDHIHFQYNGFLFAILIGSIVAAKNKKYLWCAVLYTTSICFKHIFLYLAPCYFVFLL 240

Query: 240 ------IXXXXXXXXXXXXXXXNLPRLLAVAAATLISFAAMFFPLYMWGGIRNVLQSIHR 293
                 +                   L  + +  +  F   F P         + Q + R
Sbjct: 241 RAYVLNVNNFKFKSYKDFLFLIRWTNLFKLGSIVIGIFTICFLPF-----AHQMPQVLSR 295

Query: 294 IFPFSRGIFEDKVA-NFWC 311
           +FPFSRG+     A NFW 
Sbjct: 296 LFPFSRGLTHAYWAPNFWA 314

>NDAI0F00510 Chr6 (118893..120605) [1713 bp, 570 aa] {ON} Anc_5.669
           YOR067C
          Length = 570

 Score =  103 bits (256), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 100/419 (23%), Positives = 161/419 (38%), Gaps = 79/419 (18%)

Query: 69  DFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKL--GDIFDPTWFQLG 126
           DF+  R+W+ +T  LPL +WY+     W LDYPP  AY  + + +     + D     + 
Sbjct: 54  DFDVHRNWLAITNKLPLKEWYYEHTSQWTLDYPPFFAYFEWFMSQFVPKVVRDDGCLDI- 112

Query: 127 VSRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKW-IGKHRGQTPIGQYIAAAAILFQP 185
           V  GQ       + R +V++SE+LL++       +W I K +       +I A +I+  P
Sbjct: 113 VPVGQFGWATVVFQRTSVIISEILLFV-----VLQWFINKSKDNERTQSFIVATSIILSP 167

Query: 186 SLILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAP------ 239
             ++IDH HFQYN  +  + + +I     E Y    + + +++CFK + LY AP      
Sbjct: 168 GFLIIDHIHFQYNGFLFAILIASIVAAKQERYLLCGLFYSIALCFKHIFLYLAPCYFVFL 227

Query: 240 -------IXXXXXXXXXXXXXXXNLPRLLAVAAATLISFAAMFFPLYMWGGIRNVLQSIH 292
                  +                   L  +    L  F   F P      I ++ Q   
Sbjct: 228 LRAYVLNVKNFKFKSYKDLILLIQWNNLFKLGGIVLSIFGICFLPF-----IYHLPQVFT 282

Query: 293 RIFPFSRGI--------------FEDKVANFW-------------CFSNIFIKYKVLYTQ 325
           R+FPF RG+              F DK+A                C  +          Q
Sbjct: 283 RLFPFGRGLTHAYWAPNFWAIYSFTDKIATTLLLKLPYVHKLLCKCIKHPLFPTTREEIQ 342

Query: 326 SQLQMYSLCATA-------LGFLP------AFILIFFYPKKHLIPY-----------ALT 361
           S++  Y    +           LP      +FIL  FY    ++P            +LT
Sbjct: 343 SRIMEYGNNGSKGLVEDVYFIILPQIIPKLSFILTGFYQLLAVVPLLFDPSFKRFIGSLT 402

Query: 362 ACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVSWINNMAFFTLWPLLKKDG 420
            C M+ FLF + VHEK                D  +L+    +++  + +L+PLL K+ 
Sbjct: 403 LCGMASFLFGWHVHEKAILLVIIPFSFL-VVCDRRLLTSFMLVSSAGYVSLFPLLYKND 460

>Skud_15.234 Chr15 complement(413571..415304) [1734 bp, 577 aa] {ON}
           YOR067C (REAL)
          Length = 577

 Score =  103 bits (256), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 94/374 (25%), Positives = 148/374 (39%), Gaps = 75/374 (20%)

Query: 69  DFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKL--GDIFDPTWFQLG 126
           DF+  R+W+ +T  LP+S+WY+     W LDYPP  AY  + L +     + D     + 
Sbjct: 66  DFDVHRNWLAITNKLPISKWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRDDGCLDI- 124

Query: 127 VSRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAILFQPS 186
           V  G+  +    + R TV+ S++LL++   +Y        R Q+    ++ A++I+  P 
Sbjct: 125 VEVGKFGLPTIVFQRLTVIFSDILLFVVLQVYINTTDLSERSQS----FVVASSIVLSPG 180

Query: 187 LILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAP------- 239
             +IDH HFQYN  +  + + +I     + Y   AI +  ++CFK + LY AP       
Sbjct: 181 FFMIDHIHFQYNGFLFAILIGSIVAAKKKRYILCAILYTTAICFKHIFLYLAPCYFVFLL 240

Query: 240 ------IXXXXXXXXXXXXXXXNLPRLLAVAAATLISFAAMFFPLYMWGGIRNVLQSIHR 293
                 +                   L  + +  +  F   F P         + Q + R
Sbjct: 241 RAYVLNVNNFKFKSYKDFLFLIRWANLFKLGSIVIGIFTICFLPF-----AHQMPQVLSR 295

Query: 294 IFPFSRGIFEDKVA-NFWC---------------------FSNIFIKYKVLYTQSQLQMY 331
           +FPFSRG+     A NFW                      F+  FIK  ++    +    
Sbjct: 296 LFPFSRGLTHAYWAPNFWALYSFMDKILTTIMLRLPYVHTFATKFIKPPLIPQNLKEINE 355

Query: 332 SLCATALG-----------FLP------AFILIFFYPKKHLIPY-----------ALTAC 363
            L A   G            LP       FIL  FY    ++P            +LT C
Sbjct: 356 RLAANNNGSKGLVQDVFFVILPQIPPKLTFILTIFYQILAVLPLLFDPSFKRFVGSLTLC 415

Query: 364 SMSFFLFSFQVHEK 377
            ++ FLF + VHEK
Sbjct: 416 GLASFLFGWHVHEK 429

>KLLA0F16621g Chr6 complement(1531745..1533430) [1686 bp, 561 aa]
           {ON} highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 561

 Score =  102 bits (254), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 69/248 (27%), Positives = 111/248 (44%), Gaps = 25/248 (10%)

Query: 69  DFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKL--GDIFDPTWFQLG 126
           DF+  R+W+ +T  LPL++WY      W LDYPP  AY  + L +     + +     + 
Sbjct: 52  DFDVHRNWLAITNKLPLNKWYVESTSQWTLDYPPFFAYFEWFLSQFVPKSVAEDGCLDI- 110

Query: 127 VSRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAILFQPS 186
           V  G   +    + R TV+LSEL+LY    ++    I           ++ A++I+  P 
Sbjct: 111 VKVGSFGLPTIIFQRITVILSELVLYAALQVF----INTSDISEKSANFVVASSIVLSPG 166

Query: 187 LILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPIXXXXXX 246
           L+++DH HFQYN  + G+ + +I    ++ Y   A  F +++CFK + LY AP       
Sbjct: 167 LLIVDHIHFQYNGFLFGILISSIVAAKNKRYILCAAFFSIALCFKHIFLYLAPAYFVFLL 226

Query: 247 XXXXX-------------XXXXNLPRLLAVAAATLISFAAMFFPLYMWGGIRNVLQSIHR 293
                                     LL +A+  +  F+  F P      I    Q + R
Sbjct: 227 RAYVLDFSSFKFRSYKDLISIVQWSNLLKLASVVMGIFSLAFLPF-----ITTWQQLLAR 281

Query: 294 IFPFSRGI 301
           +FPFSRG+
Sbjct: 282 LFPFSRGL 289

>NCAS0G00450 Chr7 (77781..79493) [1713 bp, 570 aa] {ON} Anc_5.669
           YOR067C
          Length = 570

 Score = 99.8 bits (247), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 105/424 (24%), Positives = 167/424 (39%), Gaps = 92/424 (21%)

Query: 69  DFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDPTWFQLGVS 128
           DF+  R+W+ +T  LPL QWY+     W LDYPP  AY  +I+ +         F   V 
Sbjct: 56  DFDVHRNWLAVTNKLPLKQWYYEHTSQWTLDYPPFFAYFEWIISQ---------FVPQVV 106

Query: 129 RGQESMDLKS----------YMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAA 178
           R    +D+            + R +V+ SE+LL++    +      K R Q+    +I A
Sbjct: 107 RDDGCLDIVEIGKFGEPTVIFQRLSVITSEILLFVVLQWFINTSNVKERTQS----FIVA 162

Query: 179 AAILFQPSLILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYA 238
            +I+  P  +++DH HFQYN  +  + + +I     + Y   A+ +  ++CFK + LY A
Sbjct: 163 TSIILSPGFLIVDHIHFQYNGFLFSILIASIVAAKQKRYILCAVFYTTALCFKHIFLYLA 222

Query: 239 PIXXXXXXXXXXXXXX-------XNLPRLLA------VAAATLISFAAMFFPLYMWGGIR 285
           P                       +L RL+       +A   L      F P      I 
Sbjct: 223 PCYFVFLLRAYVLNVKGFQFKSYKDLVRLVQWTNLFRLAGVVLSIVGVCFGPF-----IF 277

Query: 286 NVLQSIHRIFPFSRGIFEDKVA-NFWC--------FSNIFIKYKVLYT------------ 324
           ++ Q + R+FPFSRG+     A NFW          + + +K   ++T            
Sbjct: 278 DMPQLLTRLFPFSRGLTHAYWAPNFWAIYSFTDKVLTTLMLKLPYVHTLATRFISAPFFP 337

Query: 325 ------QSQLQMYSLCATALG------FLP------AFILIFFYPKKHLIPY-------- 358
                 Q +L   +     L        LP       FIL  FY    +IP         
Sbjct: 338 ATIKEIQKRLSEDNNGTKGLVQDVYFIVLPQIVPKLTFILTLFYQLLAVIPLLFDPSFKR 397

Query: 359 ---ALTACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVSWINNMAFFTLWPL 415
              +LT C M+ +LF + VHEK                D  +LS     ++  + +L+PL
Sbjct: 398 FIGSLTLCGMASYLFGWHVHEKAIMLVIIPFSFLVVC-DRRLLSSFMLASSAGYVSLFPL 456

Query: 416 LKKD 419
           L ++
Sbjct: 457 LYEN 460

>TDEL0B02540 Chr2 (459825..461534) [1710 bp, 569 aa] {ON} Anc_5.669
           YOR067C
          Length = 569

 Score = 98.2 bits (243), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 94/373 (25%), Positives = 144/373 (38%), Gaps = 73/373 (19%)

Query: 69  DFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGK-LGDIFDPTWFQLGV 127
           DF+  R+W+ +T  LPL +WY+     W LDYPP  AY  ++L + +  I         V
Sbjct: 55  DFDVHRNWLAITNELPLKEWYYEKTSQWTLDYPPFFAYFEWLLSQFVPKIVKEDGALDIV 114

Query: 128 SRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAILFQPSL 187
             GQ       + R TV+ SE+LL++   ++    +           ++ A++I+  P  
Sbjct: 115 EIGQFGWPTVVFQRLTVIFSEVLLFVVLQVF----VNTSSATEKTRSFVVASSIVLSPGF 170

Query: 188 ILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPIXXXXXXX 247
           ++IDH HFQYN  +    + +I     + Y   A  + +++CFK + LY AP        
Sbjct: 171 LMIDHIHFQYNGFLFAPLIASIVAAKHKKYMWCATFYAIALCFKHIFLYLAPCYFVFLLR 230

Query: 248 XXX-------------XXXXXNLPRLLAVAAATLISFAAMFFPLYMWGGIRNVLQSIHRI 294
                                    L  +A+  L  F   F P      + ++ Q + R+
Sbjct: 231 AYVLNFKNFEFKSYKDLIFIVQWKHLFKMASVVLGIFFICFGPF-----LYDLPQVMTRL 285

Query: 295 FPFSRGI--------------FEDKVANF--------WCFSNIFI----------KYKVL 322
           FPFSRG+              F DK+  F          F+  FI            K  
Sbjct: 286 FPFSRGLTHAYWAPNFWAIYSFLDKILTFVMLKLPYVHAFATKFISPPLIPESLDDLKER 345

Query: 323 YTQSQLQMYSLCATA-LGFLP------AFILIFFYPKKHLIPY-----------ALTACS 364
             Q+      L        LP       FIL  FY    +IP            +LT C 
Sbjct: 346 LVQNNSGTKGLVQDVFFAILPQISPKLTFILTMFYQALAVIPLLFDPSFKRFIGSLTLCG 405

Query: 365 MSFFLFSFQVHEK 377
           +S +LF + VHEK
Sbjct: 406 LSSYLFGWHVHEK 418

>SAKL0G00836g Chr7 (77387..79072) [1686 bp, 561 aa] {ON} highly
           similar to uniprot|P40351 Saccharomyces cerevisiae
           YOR067C ALG8 adds glucose to the dolichol- linked
           oligosaccharide precursor prior to transfer to protein
           glycosyl transferase
          Length = 561

 Score = 97.8 bits (242), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 76/266 (28%), Positives = 112/266 (42%), Gaps = 26/266 (9%)

Query: 69  DFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKL--GDIFDPTWFQLG 126
           DF+  R+W+ +T  LPL +WY      W LDYPP  AY  + L +     + D     + 
Sbjct: 48  DFDVHRNWLAITNKLPLREWYIEATSQWTLDYPPFFAYFEWFLSQFVPKIVRDDGCLDI- 106

Query: 127 VSRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAILFQPS 186
           V  G   M    + R TV++SE+LL++   I+    I K         +I A++I+  P 
Sbjct: 107 VEVGNFGMPTIIFQRITVIVSEVLLFVVLQIF----INKSATNEKSANFIVASSIVLSPG 162

Query: 187 LILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAP------- 239
            +++DH HFQYN  +  + + AI       Y      F  ++CFK + LY AP       
Sbjct: 163 FLIVDHIHFQYNGFLFAILIAAIVAAKHHRYLLCGAFFATALCFKHIFLYLAPSFFVFLL 222

Query: 240 ------IXXXXXXXXXXXXXXXNLPRLLAVAAATLISFAAMFFPLYMWGGIRNVLQSIHR 293
                                    R L +    L  FA  F P      I  + Q + R
Sbjct: 223 RAYILDFTNFKFKSYKDLVSIVKWQRALKLGLVVLGIFAVCFAPF-----ISEMPQLLER 277

Query: 294 IFPFSRGIFEDKVA-NFWCFSNIFIK 318
           +FPFSRG+     A NFW   ++  K
Sbjct: 278 LFPFSRGLTHAYWAPNFWALYSLLDK 303

>ADR210C Chr4 complement(1070234..1071952) [1719 bp, 572 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR067C
           (ALG8)
          Length = 572

 Score = 97.1 bits (240), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 74/265 (27%), Positives = 114/265 (43%), Gaps = 40/265 (15%)

Query: 69  DFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKL--GDIFDPTWFQLG 126
           DFE  R+W+ +T  LPL +WY      W +DYPPL A+  + L ++  G +      +L 
Sbjct: 59  DFEVHRNWLAVTHRLPLRKWYVDATSQWTMDYPPLFAWLEWALSQVVPGAVRRDGCLKL- 117

Query: 127 VSRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAILFQPS 186
           V+ G+       + R TV+ SE+LLY+   +Y    +     Q     ++   ++   P+
Sbjct: 118 VAEGRYGWPTVVFQRLTVIASEVLLYVVLQVY----VSSSAAQERTVNFVVTTSVALSPA 173

Query: 187 LILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPIXXXXXX 246
            +L+DH HFQYN  +  + V +I    +  Y      F +++C K + LY AP       
Sbjct: 174 FLLVDHIHFQYNGFLFAVLVASIVAARERRYVLCGALFTVALCLKHIFLYLAPAYFVFLL 233

Query: 247 XXXXXXXXX----------------NLPRL----LAVAAATLISFAAMFFPLYMWGGIRN 286
                                    NL RL    LA+ A T   FA +            
Sbjct: 234 RAYVLDLGEFRFRSYRDLVFAVRWGNLCRLGGVVLAIMAVTFAPFAGV------------ 281

Query: 287 VLQSIHRIFPFSRGIFEDKVA-NFW 310
           + Q + R+FPFSRG+     A NFW
Sbjct: 282 MPQLMARLFPFSRGLTHAYWAPNFW 306

>KAFR0D02440 Chr4 (489816..491543) [1728 bp, 575 aa] {ON} Anc_5.669
           YOR067C
          Length = 575

 Score = 95.9 bits (237), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 101/419 (24%), Positives = 164/419 (39%), Gaps = 80/419 (19%)

Query: 69  DFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDPTWFQLG-V 127
           DF+  R+W+ +T  + L  WY+     W LDYPP  AY  + +  L   F      L  V
Sbjct: 64  DFDVHRNWLAITNGMHLKDWYYEHTSQWTLDYPPFFAYFEWFISHLVPSFVRRDGCLDIV 123

Query: 128 SRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAILFQPSL 187
             GQ       + R TV+ SE LL++   IY      + R Q+    +I A++I+  P  
Sbjct: 124 EVGQFGWPTVLFQRLTVIFSESLLFLVLQIYINTSEVEERTQS----FIVASSIVLSPGF 179

Query: 188 ILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPIXXXXXXX 247
           +++DH HFQYN  +  + V +I    ++ Y   A+ + +++CFK + LY AP        
Sbjct: 180 LIVDHIHFQYNGFLFAILVASIVAARNKRYLLCALFYSIALCFKHIFLYLAPCYFVFLLR 239

Query: 248 XXXXXXX----------------XNLPRLLAVAAATLISFAAMFFPLYMWGGIRNVLQSI 291
                                   NL +L  +       F+  F P      I ++ Q +
Sbjct: 240 VYVLNFENFKFRSYKDLIFLIRWKNLCQLGMIVVGV---FSLCFGPF-----IFDMPQLL 291

Query: 292 HRIFPFSRGIFEDKVA-NFWCFSNIFIKYKVLYTQSQLQMYSLCAT--ALGFLPA----- 343
            R+FPFSRG+     A NFW   +   K   ++      +++  A   A   LP+     
Sbjct: 292 SRLFPFSRGLTHAYWAPNFWALYSFLDKVLTVFALRLHYVHNFAAKFIAPSLLPSSIEEI 351

Query: 344 -------------------------------FILIFFYPKKHLIPY-----------ALT 361
                                          F+L  FY    +IP            +LT
Sbjct: 352 RQRIAEHNNGTKGLVQDVFFVILPQISPKLTFLLTLFYQILAVIPLLFDPSFKRFMGSLT 411

Query: 362 ACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVSWINNMAFFTLWPLLKKDG 420
            C M+ +LF + VHEK                D  +L   + +++  + +L+PLL ++ 
Sbjct: 412 LCGMASYLFGWHVHEKAIMLVIIPFSFL-VVFDRRLLISFTLVSSAGYVSLFPLLYENA 469

>Ecym_4051 Chr4 (109310..111124) [1815 bp, 604 aa] {ON} similar to
           Ashbya gossypii ADR210C
          Length = 604

 Score = 94.0 bits (232), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 128/535 (23%), Positives = 199/535 (37%), Gaps = 105/535 (19%)

Query: 69  DFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKL--GDIFDPTWFQLG 126
           D E  R+W+ LT  LPL  WY      W LDYPP  AY  ++L +     + D     + 
Sbjct: 93  DLEVHRNWLALTNKLPLLDWYREATSQWTLDYPPFFAYFEWVLSQFVPAVVRDDGCLDI- 151

Query: 127 VSRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAILFQPS 186
           V  G+       ++R TV+ +E+LL++   ++    I           +I A++I   P 
Sbjct: 152 VKEGKFGWPTVVFLRLTVIGTEILLFVVLQVF----INTSDESERTVNFIIASSIALSPG 207

Query: 187 LILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPIXXXXXX 246
            +++DH HFQYN  +  + + +I     E Y      F   +CFK + LY AP       
Sbjct: 208 FLIVDHMHFQYNGFLFAILIASIVAAKKERYLLCGAFFTTVLCFKHIFLYLAPAYFTFLL 267

Query: 247 XXXXXXXXX----------------NLPRLLAVAAATLISFAAMFFPLYMWGGIRNVLQS 290
                                    NL +L  +  + L   A  F P      I  + Q 
Sbjct: 268 RAYVLNFSNFSFRTYRDLIFVVRWFNLLKLGVIIVSIL---AVCFVPF-----IPVLPQL 319

Query: 291 IHRIFPFSRGIFEDKVA-NFWCFSNIFIKYKVLYTQSQLQMYSLCATALGFLP------- 342
           I R+FPFSRG+     A NFW     F+   + +   ++     CAT +   P       
Sbjct: 320 ISRLFPFSRGLTHAYWAPNFWAVYA-FMDRILTFIMLKMPYVHKCATKIVLPPLIPNSIE 378

Query: 343 --------------------------------AFILIFFYPKKHLIPY-----------A 359
                                            F L  FY    +IP             
Sbjct: 379 EIKNRIGASNYGTRGLVQDILFIILPQVQPRLTFALTLFYQILAIIPVLFNPSFKRFIGC 438

Query: 360 LTACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVSWINNMAFFTLWPLLKKD 419
           LT C  S FLF + VHEK              S D  +L+    +    + +L+PLL + 
Sbjct: 439 LTLCGFSSFLFGWHVHEKAIMLVIVPFSFL-VSMDRRLLTPFMLLTASGYVSLFPLLYQS 497

Query: 420 GLVLQYATLLLLSNWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDN--IFWK 477
              L    +L    W I  FS +              T  VS + +RR    D   + + 
Sbjct: 498 SEFL--IKVLYTWIWCIIYFSALK------------KTVKVSTSIQRRVFFFDRLAVCYC 543

Query: 478 LIIVASYISMGILHLLDFYVQPPAKYPDLWVL---LNCSLGFFSFF--LFWVWNY 527
           L++V   +++  L ++ F      KY  L ++   + CS+G  S +  L W++N+
Sbjct: 544 LLLVPMVLAVESLGVMKFKYVILQKYEFLGLMCYSIFCSIGVISSWIGLSWLFNF 598

>KNAG0L01920 Chr12 complement(344454..346160) [1707 bp, 568 aa] {ON}
           Anc_5.669 YOR067C
          Length = 568

 Score = 92.0 bits (227), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 69/266 (25%), Positives = 112/266 (42%), Gaps = 42/266 (15%)

Query: 69  DFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDPTWFQLGVS 128
           DF+  R+W+ +T  LPL +WY+     W LDYPP  AY  ++L +         F     
Sbjct: 53  DFDVHRNWLAITNALPLREWYYEKTSQWTLDYPPFFAYFEWVLSQ---------FVPAAV 103

Query: 129 RGQESMDLKS----------YMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAA 178
           R    +D+            + R TV+ SE+LL++   +Y        + Q+    ++ A
Sbjct: 104 RADGCLDIVPQGVFGALTVLFQRCTVIASEVLLFVVLQVYINTSPPAEKTQS----FVVA 159

Query: 179 AAILFQPSLILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYA 238
           ++I+  P L+++DH HFQYN  +  + + +I       +   A  +  ++CFK + LY A
Sbjct: 160 SSIVLSPMLLIVDHIHFQYNGFLFAILIASIVAARKRKFLLCAFFYSTALCFKHIFLYLA 219

Query: 239 PIXXXXXXXXXXXX-------------XXXNLPRLLAVAAATLISFAAMFFPLYMWGGIR 285
           P                             +  RL  +    L      F P       R
Sbjct: 220 PCYFMFLLRTYVLQFEGFRFKSYKDLFRIIHWGRLFKLGGVVLGVAVVCFAPF-----AR 274

Query: 286 NVLQSIHRIFPFSRGIFEDKVA-NFW 310
           ++ Q + R+FPFSRG+     A NFW
Sbjct: 275 DMPQLLSRLFPFSRGLTHAYWAPNFW 300

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.330    0.143    0.477 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,423,638
Number of extensions: 2260161
Number of successful extensions: 6003
Number of sequences better than 10.0: 41
Number of HSP's gapped: 6005
Number of HSP's successfully gapped: 54
Length of query: 541
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 427
Effective length of database: 40,409,475
Effective search space: 17254845825
Effective search space used: 17254845825
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 68 (30.8 bits)