Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E01342g6.23ON34134118330.0
ZYRO0C07722g6.23ON37335711871e-163
KAFR0A050806.23ON31129611791e-163
TDEL0G044606.23ON36931411821e-162
KLTH0C11154g6.23ON30530011391e-157
KNAG0M011906.23ON38029811311e-154
KLLA0D01243g6.23ON31130411141e-153
Kwal_56.224396.23ON32030411111e-152
NCAS0D021706.23ON31030011071e-152
KNAG0D02240singletonON35933811051e-151
NDAI0D008306.23ON37430110921e-148
CAGL0I08151gsingletonON38229610871e-148
Kpol_1061.27singletonON30630010781e-147
KAFR0G026806.23ON38332810861e-147
TPHA0M002806.23ON30329410761e-147
CAGL0F01815gsingletonON31430310751e-147
Kpol_385.5singletonON30630010741e-147
NDAI0C026206.23ON31130110661e-145
KNAG0K01400singletonON30929810591e-144
NCAS0H008406.23ON36033510581e-144
KNAG0K024403.39ON59657741.1
NCAS0B046008.144ON54759741.2
KLTH0H13948g1.442ON49747731.4
ZYRO0A01342g2.235ON134364722.1
TDEL0C045202.235ON131364703.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E01342g
         (341 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E01342g Chr5 (101847..102872) [1026 bp, 341 aa] {ON} conser...   710   0.0  
ZYRO0C07722g Chr3 (585947..587068) [1122 bp, 373 aa] {ON} conser...   461   e-163
KAFR0A05080 Chr1 complement(1009747..1010682) [936 bp, 311 aa] {...   458   e-163
TDEL0G04460 Chr7 (809440..810549) [1110 bp, 369 aa] {ON}              459   e-162
KLTH0C11154g Chr3 (916374..917291) [918 bp, 305 aa] {ON} conserv...   443   e-157
KNAG0M01190 Chr13 complement(216456..217598) [1143 bp, 380 aa] {...   440   e-154
KLLA0D01243g Chr4 complement(108848..109783) [936 bp, 311 aa] {O...   433   e-153
Kwal_56.22439 s56 complement(129210..130172) [963 bp, 320 aa] {O...   432   e-152
NCAS0D02170 Chr4 complement(403949..404881) [933 bp, 310 aa] {ON...   431   e-152
KNAG0D02240 Chr4 complement(385803..386882) [1080 bp, 359 aa] {O...   430   e-151
NDAI0D00830 Chr4 complement(188085..189209) [1125 bp, 374 aa] {O...   425   e-148
CAGL0I08151g Chr9 (793917..795065) [1149 bp, 382 aa] {ON} highly...   423   e-148
Kpol_1061.27 s1061 (79476..80396) [921 bp, 306 aa] {ON} (79476.....   419   e-147
KAFR0G02680 Chr7 (553335..554486) [1152 bp, 383 aa] {ON} Anc_6.23     422   e-147
TPHA0M00280 Chr13 complement(55778..56689) [912 bp, 303 aa] {ON}...   419   e-147
CAGL0F01815g Chr6 complement(179470..180414) [945 bp, 314 aa] {O...   418   e-147
Kpol_385.5 s385 (12788..13708) [921 bp, 306 aa] {ON} (12788..137...   418   e-147
NDAI0C02620 Chr3 (608649..609584) [936 bp, 311 aa] {ON} Anc_6.23      415   e-145
KNAG0K01400 Chr11 complement(280379..281308) [930 bp, 309 aa] {O...   412   e-144
NCAS0H00840 Chr8 complement(153671..154753) [1083 bp, 360 aa] {O...   412   e-144
KNAG0K02440 Chr11 (487307..489097) [1791 bp, 596 aa] {ON} Anc_3....    33   1.1  
NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {O...    33   1.2  
KLTH0H13948g Chr8 complement(1215314..1216807) [1494 bp, 497 aa]...    33   1.4  
ZYRO0A01342g Chr1 (104605..108636) [4032 bp, 1343 aa] {ON} simil...    32   2.1  
TDEL0C04520 Chr3 (814803..818744) [3942 bp, 1313 aa] {ON} Anc_2....    32   3.5  

>SAKL0E01342g Chr5 (101847..102872) [1026 bp, 341 aa] {ON} conserved
           hypothetical protein
          Length = 341

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/341 (100%), Positives = 341/341 (100%)

Query: 1   MRPTTQKTVYILALFAVLVSWASSKYFMSNKGQENRMSKVRTIYKHFVAVEQSEGVGARV 60
           MRPTTQKTVYILALFAVLVSWASSKYFMSNKGQENRMSKVRTIYKHFVAVEQSEGVGARV
Sbjct: 1   MRPTTQKTVYILALFAVLVSWASSKYFMSNKGQENRMSKVRTIYKHFVAVEQSEGVGARV 60

Query: 61  RRSIGTTQLRNFTPFLMLDHFNVTPPAGFPDHPHHGQETITYVLGGMMAHEDFTGSKGVL 120
           RRSIGTTQLRNFTPFLMLDHFNVTPPAGFPDHPHHGQETITYVLGGMMAHEDFTGSKGVL
Sbjct: 61  RRSIGTTQLRNFTPFLMLDHFNVTPPAGFPDHPHHGQETITYVLGGMMAHEDFTGSKGVL 120

Query: 121 RPGDLQFMTAGKGIVHSEIPVKMESGEPTVGLQLWVDLPERLKNCEPRYRDLRGAETPIA 180
           RPGDLQFMTAGKGIVHSEIPVKMESGEPTVGLQLWVDLPERLKNCEPRYRDLRGAETPIA
Sbjct: 121 RPGDLQFMTAGKGIVHSEIPVKMESGEPTVGLQLWVDLPERLKNCEPRYRDLRGAETPIA 180

Query: 181 EPHQNLKVRVISGESYGVQSRSELAYTPVHFYHFISSKKGTPFEQKFPEDFNVFMYVLKG 240
           EPHQNLKVRVISGESYGVQSRSELAYTPVHFYHFISSKKGTPFEQKFPEDFNVFMYVLKG
Sbjct: 181 EPHQNLKVRVISGESYGVQSRSELAYTPVHFYHFISSKKGTPFEQKFPEDFNVFMYVLKG 240

Query: 241 SLTLNSKNFPQYSAIFFKNDGEGVEGIAASDDTEFALVGGSILEQPVVQHGPFVETSKER 300
           SLTLNSKNFPQYSAIFFKNDGEGVEGIAASDDTEFALVGGSILEQPVVQHGPFVETSKER
Sbjct: 241 SLTLNSKNFPQYSAIFFKNDGEGVEGIAASDDTEFALVGGSILEQPVVQHGPFVETSKER 300

Query: 301 MIQVFQDYQFGMNGFERAHNWKSSISDGISQQNAEKQLKSE 341
           MIQVFQDYQFGMNGFERAHNWKSSISDGISQQNAEKQLKSE
Sbjct: 301 MIQVFQDYQFGMNGFERAHNWKSSISDGISQQNAEKQLKSE 341

>ZYRO0C07722g Chr3 (585947..587068) [1122 bp, 373 aa] {ON} conserved
           hypothetical protein
          Length = 373

 Score =  461 bits (1187), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 228/357 (63%), Positives = 265/357 (74%), Gaps = 27/357 (7%)

Query: 9   VYILALFAVLVSWASSKYFMSNK----------GQENR-------------MSK---VRT 42
           V I  L   L+++ S  Y  SNK          GQE               MSK   VR+
Sbjct: 17  VLIFTLVG-LIAFQSCSYLTSNKDNKQLFSFLSGQEQNPKEPINYQFNDGIMSKSISVRS 75

Query: 43  IYKHFVAVEQSEGVGARVRRSIGTTQLRNFTPFLMLDHFNVTPPAGFPDHPHHGQETITY 102
           + K+F+A+EQ EGVGARVRRSIGT ++R F PFLMLD F V PPAGFPDHPHHGQETITY
Sbjct: 76  VLKNFIAIEQEEGVGARVRRSIGTMKMRRFPPFLMLDDFFVKPPAGFPDHPHHGQETITY 135

Query: 103 VLGGMMAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEIPVKMESGEPTVGLQLWVDLPERL 162
            L GM+AHEDFTGSKGVL PGDLQFMTAGKGIVHSEIPV +E G  + GLQLWVDLP  L
Sbjct: 136 NLKGMIAHEDFTGSKGVLFPGDLQFMTAGKGIVHSEIPVSLEDGSASNGLQLWVDLPAEL 195

Query: 163 KNCEPRYRDLRGAETPIAEPHQNLKVRVISGESYGVQSRSELAYTPVHFYHFISSKKGTP 222
           KNCEPRYRDLR  +TP  + + NL VRVISG+SYGV S  ELAYTPVHFYHFI+SKKGT 
Sbjct: 196 KNCEPRYRDLRKKQTPEVKVNDNLTVRVISGKSYGVDSVQELAYTPVHFYHFITSKKGTE 255

Query: 223 FEQKFPEDFNVFMYVLKGSLTLNSKNFPQYSAIFFKNDGEGVEGIAASDDTEFALVGGSI 282
           F Q+FP+DFNVF Y+LKGSL +N + FP++SA+FF  DGEGV G + SDD EF L+GG I
Sbjct: 256 FAQEFPKDFNVFFYILKGSLAVNDQVFPEHSAVFFDTDGEGVAGTSVSDDAEFVLIGGKI 315

Query: 283 LEQPVVQHGPFVETSKERMIQVFQDYQFGMNGFERAHNWKSSISDGISQQNAEKQLK 339
           L+Q V+QHGPFVETS+ERMI VF++YQ+GMNGFE AH+W S I+ GIS+  A K  K
Sbjct: 316 LDQEVLQHGPFVETSRERMIDVFRNYQYGMNGFENAHSWDSKIAGGISEAEARKLYK 372

>KAFR0A05080 Chr1 complement(1009747..1010682) [936 bp, 311 aa] {ON}
           Anc_6.23
          Length = 311

 Score =  458 bits (1179), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 206/296 (69%), Positives = 256/296 (86%)

Query: 41  RTIYKHFVAVEQSEGVGARVRRSIGTTQLRNFTPFLMLDHFNVTPPAGFPDHPHHGQETI 100
           RTI KHFVAVEQ EGVGARVRRS+G+ + RNFTPFL+LDHF V+ PAGFPDHPHHGQETI
Sbjct: 11  RTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFLLLDHFTVSHPAGFPDHPHHGQETI 70

Query: 101 TYVLGGMMAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEIPVKMESGEPTVGLQLWVDLPE 160
           TYV  GM+AHEDFTGSKG+LRPGDLQFMTAGKGI+HSEIPV ME+G+  VGLQLWVDLP+
Sbjct: 71  TYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLPQ 130

Query: 161 RLKNCEPRYRDLRGAETPIAEPHQNLKVRVISGESYGVQSRSELAYTPVHFYHFISSKKG 220
            +K+CEPRYR+LRG E PI EP+++LKV+VISG SYGV+S  ELAYTPV FYHFIS+KKG
Sbjct: 131 EMKDCEPRYRNLRGGEIPIVEPNEHLKVKVISGRSYGVESVKELAYTPVDFYHFISNKKG 190

Query: 221 TPFEQKFPEDFNVFMYVLKGSLTLNSKNFPQYSAIFFKNDGEGVEGIAASDDTEFALVGG 280
           T F Q+ PE+FN F+YV+KGS+ +  + FPQYS IFF  DG G++G+ + DDTEFA++GG
Sbjct: 191 TDFVQQTPENFNFFLYVMKGSVKIGDETFPQYSTIFFNADGNGIKGVVSDDDTEFAIIGG 250

Query: 281 SILEQPVVQHGPFVETSKERMIQVFQDYQFGMNGFERAHNWKSSISDGISQQNAEK 336
            IL+QPV+QHGPF+E+++E++I+VFQ++Q+G+NGFERA  WKSSI +GI +++  K
Sbjct: 251 LILDQPVIQHGPFIESTREKLIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVPK 306

>TDEL0G04460 Chr7 (809440..810549) [1110 bp, 369 aa] {ON} 
          Length = 369

 Score =  459 bits (1182), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 205/314 (65%), Positives = 257/314 (81%)

Query: 27  FMSNKGQENRMSKVRTIYKHFVAVEQSEGVGARVRRSIGTTQLRNFTPFLMLDHFNVTPP 86
           F+S     ++  +VR+I K+FVA +Q EGVGA VRRSIGT Q+R F+PFLMLDHF V+PP
Sbjct: 51  FISQSETMSKTLQVRSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLMLDHFTVSPP 110

Query: 87  AGFPDHPHHGQETITYVLGGMMAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEIPVKMESG 146
           AGFPDHPHHGQETITY+LGGM+AHEDF+ SKG+L PGDLQFMTAGK I+HSEIPVKM+SG
Sbjct: 111 AGFPDHPHHGQETITYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIHSEIPVKMDSG 170

Query: 147 EPTVGLQLWVDLPERLKNCEPRYRDLRGAETPIAEPHQNLKVRVISGESYGVQSRSELAY 206
           +P VGLQLWVDLPE+LKNCEPRYRDL+  + P+ +P ++LKV VISG SYGVQS  +LAY
Sbjct: 171 QPAVGLQLWVDLPEKLKNCEPRYRDLKAKDIPVIKPSEHLKVTVISGTSYGVQSARDLAY 230

Query: 207 TPVHFYHFISSKKGTPFEQKFPEDFNVFMYVLKGSLTLNSKNFPQYSAIFFKNDGEGVEG 266
           TPVH+YHF +SKKGT F Q+FP  FN FMY+LKGS+ +  K FPQ+S +FF  DG+ VEG
Sbjct: 231 TPVHYYHFATSKKGTEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFSTVFFDTDGDAVEG 290

Query: 267 IAASDDTEFALVGGSILEQPVVQHGPFVETSKERMIQVFQDYQFGMNGFERAHNWKSSIS 326
            +ASD+ EF L+GG IL Q VVQHGPFVET++ER+I+VF +YQ  +NGF+R  NW+S+I+
Sbjct: 291 FSASDNAEFVLIGGEILHQDVVQHGPFVETNRERLIEVFHNYQNSINGFDRGRNWRSTIA 350

Query: 327 DGISQQNAEKQLKS 340
            GI++  A+K  ++
Sbjct: 351 GGITESEAKKDFRN 364

>KLTH0C11154g Chr3 (916374..917291) [918 bp, 305 aa] {ON} conserved
           hypothetical protein
          Length = 305

 Score =  443 bits (1139), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 210/300 (70%), Positives = 250/300 (83%)

Query: 37  MSKVRTIYKHFVAVEQSEGVGARVRRSIGTTQLRNFTPFLMLDHFNVTPPAGFPDHPHHG 96
           M+K R+I K+F A+EQSEGVGA+VRRSIG+ +LRNFTPFLMLDHFNV+PPAGFPDHPHHG
Sbjct: 1   MNKPRSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHG 60

Query: 97  QETITYVLGGMMAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEIPVKMESGEPTVGLQLWV 156
           QETITYVLGGM+AHEDFTGS+GVLRPGDLQFMTAGKGI+HSEIPV++ESG P+VGLQLWV
Sbjct: 61  QETITYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWV 120

Query: 157 DLPERLKNCEPRYRDLRGAETPIAEPHQNLKVRVISGESYGVQSRSELAYTPVHFYHFIS 216
           DLP  LK+CEPRYRDL   E P  +P   L+VRVISGESYGV S SELAYTPVHFYH+I+
Sbjct: 121 DLPMHLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYIT 180

Query: 217 SKKGTPFEQKFPEDFNVFMYVLKGSLTLNSKNFPQYSAIFFKNDGEGVEGIAASDDTEFA 276
            K GT FEQ FP +FNVFMYVLKGS+ +N K F QYS++FF  DG  VEG  +S+++EF 
Sbjct: 181 RKPGTTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDGSRVEGSGSSEESEFI 240

Query: 277 LVGGSILEQPVVQHGPFVETSKERMIQVFQDYQFGMNGFERAHNWKSSISDGISQQNAEK 336
           L+GG +L+QP++Q+GPFVETSK+ M +V  +YQ G NGFERA  W SSI+ G+   +  K
Sbjct: 241 LIGGEVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAK 300

>KNAG0M01190 Chr13 complement(216456..217598) [1143 bp, 380 aa] {ON}
           Anc_6.23
          Length = 380

 Score =  440 bits (1131), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 196/298 (65%), Positives = 253/298 (84%)

Query: 37  MSKVRTIYKHFVAVEQSEGVGARVRRSIGTTQLRNFTPFLMLDHFNVTPPAGFPDHPHHG 96
           M + RTI KHF+A EQ EGVGARVRRS+G+ + RNF+PFL+LDHF V+ PAGFPDHPHHG
Sbjct: 72  MPEFRTIQKHFIAGEQEEGVGARVRRSVGSMRQRNFSPFLLLDHFTVSHPAGFPDHPHHG 131

Query: 97  QETITYVLGGMMAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEIPVKMESGEPTVGLQLWV 156
           QETITYV  GM+AHEDF GSKGVLRPGDLQFMTAGKGI+HSEIPV ME+G+  VGLQLWV
Sbjct: 132 QETITYVREGMIAHEDFLGSKGVLRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWV 191

Query: 157 DLPERLKNCEPRYRDLRGAETPIAEPHQNLKVRVISGESYGVQSRSELAYTPVHFYHFIS 216
           DLP+ +K+C PRYR+LRG E PIAEP+++LK++VISG+S+G+ S  ELAYTPV FYH+IS
Sbjct: 192 DLPKDMKDCAPRYRNLRGTEIPIAEPNEHLKIKVISGKSHGIDSVKELAYTPVDFYHYIS 251

Query: 217 SKKGTPFEQKFPEDFNVFMYVLKGSLTLNSKNFPQYSAIFFKNDGEGVEGIAASDDTEFA 276
            KKGT F Q+ P +FNVF+YV+KG++ ++ + FPQYS +F+  +G+ + G+   DDTEFA
Sbjct: 252 DKKGTGFVQEVPTNFNVFLYVMKGAVKIDGQVFPQYSTVFYNANGDAIRGMVDDDDTEFA 311

Query: 277 LVGGSILEQPVVQHGPFVETSKERMIQVFQDYQFGMNGFERAHNWKSSISDGISQQNA 334
           ++GG IL+QPV+QHGPFVET++E++I+VFQ++Q+G+NGFERA  WKSSI +GI +++ 
Sbjct: 312 IIGGLILDQPVIQHGPFVETTREKIIEVFQNFQYGINGFERAVGWKSSIRNGILEKDV 369

>KLLA0D01243g Chr4 complement(108848..109783) [936 bp, 311 aa] {ON}
           conserved hypothetical protein
          Length = 311

 Score =  433 bits (1114), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 197/304 (64%), Positives = 246/304 (80%)

Query: 35  NRMSKVRTIYKHFVAVEQSEGVGARVRRSIGTTQLRNFTPFLMLDHFNVTPPAGFPDHPH 94
           N +SKVR++ KHFVA+EQSEG GA V+RSIGT Q+RNF PFLMLD+F+V+PPAGFP+HPH
Sbjct: 4   NVVSKVRSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFLMLDNFDVSPPAGFPEHPH 63

Query: 95  HGQETITYVLGGMMAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEIPVKMESGEPTVGLQL 154
           HGQETITYVL GMMAHEDFTGSKGVLR GDLQFMTAGK IVHSEIPVKM++GE T GLQL
Sbjct: 64  HGQETITYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIVHSEIPVKMDNGESTQGLQL 123

Query: 155 WVDLPERLKNCEPRYRDLRGAETPIAEPHQNLKVRVISGESYGVQSRSELAYTPVHFYHF 214
           WVDLP  +KN EPRYRDLR  E P+A P  NL V+VISGESYGV+S +ELAYTPV FYHF
Sbjct: 124 WVDLPNDIKNVEPRYRDLRREEIPLATPSDNLIVKVISGESYGVKSLTELAYTPVEFYHF 183

Query: 215 ISSKKGTPFEQKFPEDFNVFMYVLKGSLTLNSKNFPQYSAIFFKNDGEGVEGIAASDDTE 274
           I++KK T F Q F +DF+ F+Y++KGS++++ + +P+ SAIFFKNDG+G+ G   SD+ E
Sbjct: 184 IANKKNTEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSDNAE 243

Query: 275 FALVGGSILEQPVVQHGPFVETSKERMIQVFQDYQFGMNGFERAHNWKSSISDGISQQNA 334
           FA++ G    Q VVQ+GPFVE+S+E ++ V Q+YQ G+NGFE A  W   I +G+++   
Sbjct: 244 FAIIAGKYFNQKVVQYGPFVESSRENIVDVIQNYQNGVNGFENARTWSPVIKNGVTEAEV 303

Query: 335 EKQL 338
           ++ L
Sbjct: 304 QQYL 307

>Kwal_56.22439 s56 complement(129210..130172) [963 bp, 320 aa] {ON}
           [contig 185] FULL
          Length = 320

 Score =  432 bits (1111), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 198/304 (65%), Positives = 241/304 (79%)

Query: 37  MSKVRTIYKHFVAVEQSEGVGARVRRSIGTTQLRNFTPFLMLDHFNVTPPAGFPDHPHHG 96
           M K R+I K+F A+EQSEGVGA+VRRSIGT +LRNFTPFLMLDHF + PPAGFPDHPHHG
Sbjct: 15  MKKARSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFLMLDHFTIAPPAGFPDHPHHG 74

Query: 97  QETITYVLGGMMAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEIPVKMESGEPTVGLQLWV 156
           QET+T++L G +AHEDFTGSKGVLR GDLQFMTAGKG VHSEIPV++ESG+PT G+QLWV
Sbjct: 75  QETVTHILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTVHSEIPVQLESGDPTEGIQLWV 134

Query: 157 DLPERLKNCEPRYRDLRGAETPIAEPHQNLKVRVISGESYGVQSRSELAYTPVHFYHFIS 216
           DLP RLK+C+PRYRDL+    P A     L + VISG+SYGV S  ELAYT VH+YH++ 
Sbjct: 135 DLPARLKDCQPRYRDLKRDRIPTARSKNGLNISVISGQSYGVDSIQELAYTSVHYYHYVF 194

Query: 217 SKKGTPFEQKFPEDFNVFMYVLKGSLTLNSKNFPQYSAIFFKNDGEGVEGIAASDDTEFA 276
           S+    FEQ FP DFNVF+YVLKG L +  + F ++S+IFFK DG  V G + S+D EF 
Sbjct: 195 SEANISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHSSIFFKTDGSHVSGFSGSNDLEFI 254

Query: 277 LVGGSILEQPVVQHGPFVETSKERMIQVFQDYQFGMNGFERAHNWKSSISDGISQQNAEK 336
           L GG IL+QP+VQ+GPFVETSKERM++VFQ+YQ G NGFE+A  W SSI++GI + +   
Sbjct: 255 LAGGQILDQPIVQYGPFVETSKERMMEVFQNYQSGTNGFEKAAGWTSSIANGIVESDISD 314

Query: 337 QLKS 340
            +KS
Sbjct: 315 FVKS 318

>NCAS0D02170 Chr4 complement(403949..404881) [933 bp, 310 aa] {ON}
           Anc_6.23
          Length = 310

 Score =  431 bits (1107), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 189/300 (63%), Positives = 247/300 (82%)

Query: 41  RTIYKHFVAVEQSEGVGARVRRSIGTTQLRNFTPFLMLDHFNVTPPAGFPDHPHHGQETI 100
           R++ K FVA+EQ EGVGA VRRSIG+ + RNF+PFL++D+F V+ PAGFPDHPHHGQETI
Sbjct: 8   RSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDNFTVSHPAGFPDHPHHGQETI 67

Query: 101 TYVLGGMMAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEIPVKMESGEPTVGLQLWVDLPE 160
           TYVL GM+AHEDFTGS+GVLRPGDLQFMTAGK I+HSEIPV+M +G+  +G+QLWVDLP+
Sbjct: 68  TYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNGDAGIGIQLWVDLPK 127

Query: 161 RLKNCEPRYRDLRGAETPIAEPHQNLKVRVISGESYGVQSRSELAYTPVHFYHFISSKKG 220
           +LKNCEPRYR+LR  E PI +P+ +L VRV+SG+SYGV+S  +LAYTP+ +Y   + K G
Sbjct: 128 KLKNCEPRYRNLRATEIPIVKPNDDLTVRVVSGKSYGVESVKDLAYTPIDYYFMNTKKTG 187

Query: 221 TPFEQKFPEDFNVFMYVLKGSLTLNSKNFPQYSAIFFKNDGEGVEGIAASDDTEFALVGG 280
           T F Q+FP DFNVF+Y++KGS+ +N    PQYS IFFK DG+ ++G +AS+DTEF LVGG
Sbjct: 188 TEFVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKGCSASEDTEFVLVGG 247

Query: 281 SILEQPVVQHGPFVETSKERMIQVFQDYQFGMNGFERAHNWKSSISDGISQQNAEKQLKS 340
            IL+QP++QHGPFVE+ +E +++VF++YQ+ +NGFERA  W+S I+DGI + + E   KS
Sbjct: 248 QILDQPIIQHGPFVESDRESLLEVFKNYQYCINGFERARGWRSRIADGIHEDDVEAFEKS 307

>KNAG0D02240 Chr4 complement(385803..386882) [1080 bp, 359 aa] {ON} 
          Length = 359

 Score =  430 bits (1105), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 198/338 (58%), Positives = 258/338 (76%), Gaps = 2/338 (0%)

Query: 4   TTQKTVYILALFAVLVSW--ASSKYFMSNKGQENRMSKVRTIYKHFVAVEQSEGVGARVR 61
           +T K   ++ LF+V++ +   +     +N      + K+R+I  HF+  E +EGVGARV+
Sbjct: 22  STYKKAALIFLFSVVLYYFYPTRTNTTNNDYTMPSLFKLRSIANHFIPREVAEGVGARVK 81

Query: 62  RSIGTTQLRNFTPFLMLDHFNVTPPAGFPDHPHHGQETITYVLGGMMAHEDFTGSKGVLR 121
           RS+G+ Q R FTPFLMLD F V  P+GFPDHPHHGQETITYV+ G++AHEDFTGSKGVLR
Sbjct: 82  RSVGSMQQRRFTPFLMLDDFTVKSPSGFPDHPHHGQETITYVIDGLIAHEDFTGSKGVLR 141

Query: 122 PGDLQFMTAGKGIVHSEIPVKMESGEPTVGLQLWVDLPERLKNCEPRYRDLRGAETPIAE 181
           PGDLQFMTAGKGIVHSE+PV+ME G P  GLQLWVDLP+ LKNCEPRYR+LR  + P+ +
Sbjct: 142 PGDLQFMTAGKGIVHSEMPVEMEDGRPARGLQLWVDLPKDLKNCEPRYRNLRSEDIPVVK 201

Query: 182 PHQNLKVRVISGESYGVQSRSELAYTPVHFYHFISSKKGTPFEQKFPEDFNVFMYVLKGS 241
           PH+NL+VRVISG+SYG +S  +LAYTP+ FY+ ++SK GT F Q+ P DFN F+YV+KGS
Sbjct: 202 PHENLEVRVISGKSYGTESVKDLAYTPIDFYYMLASKAGTEFAQEIPSDFNAFLYVMKGS 261

Query: 242 LTLNSKNFPQYSAIFFKNDGEGVEGIAASDDTEFALVGGSILEQPVVQHGPFVETSKERM 301
           + +N K F Q +AIFF  DGEGV G A SDDTEFA++GG IL+QP+VQHGPFVET +E++
Sbjct: 262 VVINEKVFKQNTAIFFDTDGEGVAGQAGSDDTEFAIIGGKILDQPLVQHGPFVETDQEKL 321

Query: 302 IQVFQDYQFGMNGFERAHNWKSSISDGISQQNAEKQLK 339
            + F +Y+    GFERA  W+S I+ GI++  A++ L+
Sbjct: 322 YEAFMNYEGYTKGFERAKGWRSDIASGINESEAKQLLE 359

>NDAI0D00830 Chr4 complement(188085..189209) [1125 bp, 374 aa] {ON}
           Anc_6.23
          Length = 374

 Score =  425 bits (1092), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 194/301 (64%), Positives = 244/301 (81%), Gaps = 3/301 (0%)

Query: 41  RTIYKHFVAVEQSEGVGARVRRSIGTTQLRNFTPFLMLDHFNVTPPA-GFPDHPHHGQET 99
           RTI K+F+  EQSEGVGARVRR+IGT ++  F PFLMLDHF VTPP  GFPDHPHHGQET
Sbjct: 73  RTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFLMLDHFKVTPPEQGFPDHPHHGQET 132

Query: 100 ITYVLGGMMAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEIPVKMESGEPTVGLQLWVDLP 159
           ITY+L GM+AHEDFTGSKGVLRPGDLQFMTAGKGIVHSE+PV M+ G P +GLQLWVDLP
Sbjct: 133 ITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVLMKDGRPGIGLQLWVDLP 192

Query: 160 ERLKNCEPRYRDLRGAETPIA--EPHQNLKVRVISGESYGVQSRSELAYTPVHFYHFISS 217
             LKNCEPRYR+LR  E PI   +  +++ V+VISG +YGV S  +LAYTP+HFYH+IS 
Sbjct: 193 RELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISGNAYGVDSVRDLAYTPIHFYHYISD 252

Query: 218 KKGTPFEQKFPEDFNVFMYVLKGSLTLNSKNFPQYSAIFFKNDGEGVEGIAASDDTEFAL 277
           K G  F+Q  P+DFNVF+YV+KG++ ++ + F Q +A+FF  DG  ++G +A++DTEFA+
Sbjct: 253 KAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNTAVFFNVDGHSIKGQSATNDTEFAI 312

Query: 278 VGGSILEQPVVQHGPFVETSKERMIQVFQDYQFGMNGFERAHNWKSSISDGISQQNAEKQ 337
           +GG IL+QP+VQHGPFVET++E + +VF++YQ G+NGFERA NW+SSI+DGI +  A   
Sbjct: 313 IGGKILDQPLVQHGPFVETTREDLYKVFENYQQGINGFERAVNWRSSIADGIDEDTANAL 372

Query: 338 L 338
           L
Sbjct: 373 L 373

>CAGL0I08151g Chr9 (793917..795065) [1149 bp, 382 aa] {ON} highly
           similar to KLLA0D01243g Kluyveromyces lactis and
           DEHA0E07447g Debaryomyces hansenii and YALI0E33297g
           Yarrowia lipolytica and CA2891|CaIFS4 Candida albicans
          Length = 382

 Score =  423 bits (1087), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 192/296 (64%), Positives = 237/296 (80%)

Query: 41  RTIYKHFVAVEQSEGVGARVRRSIGTTQLRNFTPFLMLDHFNVTPPAGFPDHPHHGQETI 100
           R+I  HF+A EQ EGVGARVRRS+GT Q+R FTPFLMLD F V PP GFPDHPHHGQETI
Sbjct: 83  RSILTHFIAGEQEEGVGARVRRSVGTYQMRRFTPFLMLDDFTVAPPNGFPDHPHHGQETI 142

Query: 101 TYVLGGMMAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEIPVKMESGEPTVGLQLWVDLPE 160
           TYV  GM+AHED TGSKGVL  GDLQFMTAGKGIVHSEIPV  + G+P  GLQLWVDLP 
Sbjct: 143 TYVTDGMIAHEDITGSKGVLLKGDLQFMTAGKGIVHSEIPVTTKDGKPCRGLQLWVDLPS 202

Query: 161 RLKNCEPRYRDLRGAETPIAEPHQNLKVRVISGESYGVQSRSELAYTPVHFYHFISSKKG 220
            +KN +PRYR+LRG ETP+A P++NL+VRVISG+SYGV+S  +LAYTPVH YHF+++K G
Sbjct: 203 DMKNIDPRYRNLRGNETPVAYPNENLEVRVISGKSYGVESLRDLAYTPVHLYHFLANKTG 262

Query: 221 TPFEQKFPEDFNVFMYVLKGSLTLNSKNFPQYSAIFFKNDGEGVEGIAASDDTEFALVGG 280
           T F Q  PEDFNVF+YV+KGS+ +N      +S+ FF  DG  + G A S+D +FA++ G
Sbjct: 263 TEFVQDIPEDFNVFIYVMKGSIQVNDVELTTFSSAFFDVDGNAIRGKALSEDAQFAIIAG 322

Query: 281 SILEQPVVQHGPFVETSKERMIQVFQDYQFGMNGFERAHNWKSSISDGISQQNAEK 336
            IL+Q V+QHGPFVET++E++++VF++YQ   NGFE AH+W+SSI DGIS++ A K
Sbjct: 323 RILDQEVIQHGPFVETNREKLMEVFRNYQEEKNGFENAHSWRSSIHDGISEEEALK 378

>Kpol_1061.27 s1061 (79476..80396) [921 bp, 306 aa] {ON}
           (79476..80396) [921 nt, 307 aa]
          Length = 306

 Score =  419 bits (1078), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 195/300 (65%), Positives = 233/300 (77%)

Query: 35  NRMSKVRTIYKHFVAVEQSEGVGARVRRSIGTTQLRNFTPFLMLDHFNVTPPAGFPDHPH 94
           ++   +R+I+KHF++ EQSEGVGARVRRSIGT  LR F+PFLMLDHFNV P AGFPDHPH
Sbjct: 2   SKQQNLRSIFKHFISREQSEGVGARVRRSIGTMLLRKFSPFLMLDHFNVAPGAGFPDHPH 61

Query: 95  HGQETITYVLGGMMAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEIPVKMESGEPTVGLQL 154
           HGQETITYV  GM+AHEDFTG KGVL  GDLQFMTAGK I H+E+PV+  SGE  VGLQL
Sbjct: 62  HGQETITYVNEGMIAHEDFTGCKGVLGKGDLQFMTAGKAICHAEMPVQSNSGEHVVGLQL 121

Query: 155 WVDLPERLKNCEPRYRDLRGAETPIAEPHQNLKVRVISGESYGVQSRSELAYTPVHFYHF 214
           WVDLP  +KN EPRYRDLR  + P A P  +L++ VISG SYGV S  +LAYTP+ FY +
Sbjct: 122 WVDLPTDMKNTEPRYRDLRNKDIPRANPTDDLEIEVISGNSYGVDSVKDLAYTPIDFYMY 181

Query: 215 ISSKKGTPFEQKFPEDFNVFMYVLKGSLTLNSKNFPQYSAIFFKNDGEGVEGIAASDDTE 274
              K GT F QKF  DFNVF+YVLKG++ +  + FPQYS+IFF  DG+ V G  A+DDTE
Sbjct: 182 RGKKAGTEFTQKFSRDFNVFIYVLKGAVNIGDQVFPQYSSIFFNTDGDAVGGTVAADDTE 241

Query: 275 FALVGGSILEQPVVQHGPFVETSKERMIQVFQDYQFGMNGFERAHNWKSSISDGISQQNA 334
           FA++GG IL+Q  VQHGPFVE +KE++I+VF DYQ   NGFERA NW+SSI DGI + +A
Sbjct: 242 FAIIGGKILDQETVQHGPFVEETKEKLIKVFYDYQSYSNGFERARNWRSSIRDGIKEDDA 301

>KAFR0G02680 Chr7 (553335..554486) [1152 bp, 383 aa] {ON} Anc_6.23
          Length = 383

 Score =  422 bits (1086), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 200/328 (60%), Positives = 253/328 (77%), Gaps = 7/328 (2%)

Query: 19  VSWASSKYFMSN---KGQENRMSKV---RTIYKHFVAVEQSEGVGARVRRSIGTTQLRNF 72
           + W    +  +N   + QE+ MS++   R+I  HF+  E  EG GARV+RSIG+ + R F
Sbjct: 57  IKWGLEDFRQNNFNEEKQEDEMSRIIHQRSIINHFIPNETFEGDGARVKRSIGSHEQRRF 116

Query: 73  TPFLMLDHFNVTPPAGFPDHPHHGQETITYVLGGMMAHEDFTGSKGVLRPGDLQFMTAGK 132
            PFLMLD F+VTPPAGFPDHPHHGQETITYVL GM+AHEDFTG  G+L PGDLQFMTAG+
Sbjct: 117 APFLMLDDFDVTPPAGFPDHPHHGQETITYVLSGMIAHEDFTGLNGILSPGDLQFMTAGR 176

Query: 133 GIVHSEIPVKMESGEPTVGLQLWVDLPERLKNCEPRYRDLRGAETPIAEPHQNLKVRVIS 192
           GIVHSEIPV ME+G    GLQLWVDLP+ LK  EPRYR+LR A+ PIA P++NLKV VIS
Sbjct: 177 GIVHSEIPVTMENGGSCRGLQLWVDLPQDLKTIEPRYRNLRAADIPIAMPYENLKVYVIS 236

Query: 193 GESYGVQSRSELAYTPVHFYHFISSKKGTPFEQKFPEDFNVFMYVLKGSLTLNSKNFPQY 252
           G+SY V+S ++LAYTPVH YHF++ K GTPF Q+FP+DFNVF+YV+KG++ +N K F + 
Sbjct: 237 GKSYDVESLNDLAYTPVHLYHFVTIKAGTPFIQEFPKDFNVFLYVIKGAVLINEKIFKEN 296

Query: 253 SAIFFKNDGEGVEGIAASDDTEFALVGGSILEQPVVQHGPFVETSKERMIQVFQDYQFGM 312
           +AIFF  DGE +EG  A+DD+EF LVGG IL QPVVQ GPFVET K++++QVF D++   
Sbjct: 297 TAIFFDVDGESIEGQFATDDSEFVLVGGEILNQPVVQQGPFVETDKQKLMQVFDDFESYR 356

Query: 313 NGFERAHNWKSSISDGISQQNAEKQLKS 340
           NGFERA NW+S+I  GI +  A ++L++
Sbjct: 357 NGFERAENWESNIRKGIKEAEA-RELRT 383

>TPHA0M00280 Chr13 complement(55778..56689) [912 bp, 303 aa] {ON}
           Anc_6.23
          Length = 303

 Score =  419 bits (1076), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 190/294 (64%), Positives = 236/294 (80%)

Query: 41  RTIYKHFVAVEQSEGVGARVRRSIGTTQLRNFTPFLMLDHFNVTPPAGFPDHPHHGQETI 100
           R+I KHF+A EQ+EGVGARVRRSIGT ++R F+PFLMLDHFNV PPAGFPDHPHHGQETI
Sbjct: 6   RSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLDHFNVIPPAGFPDHPHHGQETI 65

Query: 101 TYVLGGMMAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEIPVKMESGEPTVGLQLWVDLPE 160
           TYV  GM+AHEDFTGSKG+LRPGDLQFMTAGK + HSE+PV ME+GE   GLQLWVDLP 
Sbjct: 66  TYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHSEMPVLMENGEILDGLQLWVDLPT 125

Query: 161 RLKNCEPRYRDLRGAETPIAEPHQNLKVRVISGESYGVQSRSELAYTPVHFYHFISSKKG 220
            LKN EPRYRDL     PIA+P +NL++ VISG+SYG++S  +LAYTPV FY + + KKG
Sbjct: 126 NLKNTEPRYRDLHKENIPIAKPDENLEIEVISGKSYGIESVKDLAYTPVDFYVYKARKKG 185

Query: 221 TPFEQKFPEDFNVFMYVLKGSLTLNSKNFPQYSAIFFKNDGEGVEGIAASDDTEFALVGG 280
           + F Q F  D+NVF+Y++KGS+ + ++ FPQ+S+IFF  DG+ V+GI  SDDTEFA++GG
Sbjct: 186 SAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDGDNVQGIVGSDDTEFAIIGG 245

Query: 281 SILEQPVVQHGPFVETSKERMIQVFQDYQFGMNGFERAHNWKSSISDGISQQNA 334
            IL Q  VQHGPFVE + E++++VF +Y+    GFERA NW+SSI +GI +  A
Sbjct: 246 QILRQETVQHGPFVEETVEKLVKVFHNYESYTGGFERALNWRSSIRNGIDESQA 299

>CAGL0F01815g Chr6 complement(179470..180414) [945 bp, 314 aa] {ON}
           similar to KLLA0D01243g Kluyveromyces lactis and
           DEHA0E07447g Debaryomyces hansenii
          Length = 314

 Score =  418 bits (1075), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 191/303 (63%), Positives = 246/303 (81%), Gaps = 4/303 (1%)

Query: 37  MSKVRTIYKHFVAVEQSEGVGARVRRSIGTTQLRNFTPFLMLDHFNVTPPAGFPDHPHHG 96
           M+  R+I KHF+  EQ EGVGARVRRS+GT + R F+PFLMLD F V  PAGFPDHPHHG
Sbjct: 1   MTTYRSIQKHFMTFEQEEGVGARVRRSVGTMKQRMFSPFLMLDDFYVKHPAGFPDHPHHG 60

Query: 97  QETITYVLGGMMAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEIPVKMESGEPTVGLQLWV 156
           QETITYVL GM+AHEDFTG+KGVL  GDLQFMTAGKGIVHSEIPV+MESGE   GLQ WV
Sbjct: 61  QETITYVLNGMVAHEDFTGAKGVLGKGDLQFMTAGKGIVHSEIPVQMESGEACHGLQFWV 120

Query: 157 DLPERLKNCEPRYRDLRGAETPIAEPHQNLKVRVISGESYGVQSRSELAYTPVHFYHFIS 216
           DLP+ LK CEPRYR+LRG + P+  P++NL V+VISG+SYGV S  +LAYTP+H YH+++
Sbjct: 121 DLPKDLKWCEPRYRNLRGDKIPVVRPNENLTVKVISGKSYGVDSVRDLAYTPIHMYHYLT 180

Query: 217 SKKGTPFEQKFPEDFNVFMYVLKGSLTLNSKNFPQYSAIFFKNDGEGVEGIAASDDTEFA 276
           +K GT +EQ+FP++FNVFMYV+KG +++  + FP+++A+FF  DG+ V+G  A+DD +FA
Sbjct: 181 NKAGTQWEQEFPKNFNVFMYVMKGKVSVGDQVFPEHTAVFFNTDGDAVKGEFATDDAQFA 240

Query: 277 LVGGSILEQPVVQHGPFVETSKERMIQVFQDYQFGMNGFERAHNWKSSISDGISQQNAEK 336
           ++GG IL+Q  +QHGPFVET +E +++VF +YQ+G+NGFERA  W+SSI  GI+    EK
Sbjct: 241 IMGGQILDQQTIQHGPFVETDRESLMKVFMNYQYGINGFERAKGWQSSIIHGIT----EK 296

Query: 337 QLK 339
           Q++
Sbjct: 297 QVR 299

>Kpol_385.5 s385 (12788..13708) [921 bp, 306 aa] {ON} (12788..13708)
           [921 nt, 307 aa]
          Length = 306

 Score =  418 bits (1074), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 195/300 (65%), Positives = 233/300 (77%)

Query: 35  NRMSKVRTIYKHFVAVEQSEGVGARVRRSIGTTQLRNFTPFLMLDHFNVTPPAGFPDHPH 94
           ++   +R+I+KHF+A EQ+EGVGARVRRSIGT  LR F+PFLMLDHFNV P AGFPDHPH
Sbjct: 2   SKQQNLRSIFKHFIAREQAEGVGARVRRSIGTMLLRKFSPFLMLDHFNVAPGAGFPDHPH 61

Query: 95  HGQETITYVLGGMMAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEIPVKMESGEPTVGLQL 154
           HGQETITYV  GM+AHEDFTG KGVL  GDLQFMTAGK I H+E+PV+  SGE  VGLQL
Sbjct: 62  HGQETITYVNEGMIAHEDFTGCKGVLYKGDLQFMTAGKAICHAEMPVQSNSGEHVVGLQL 121

Query: 155 WVDLPERLKNCEPRYRDLRGAETPIAEPHQNLKVRVISGESYGVQSRSELAYTPVHFYHF 214
           WVDLP  +KN EPRYRDL+  E P A P  +L+V VISG SYGV S  +LAYTP+ FY +
Sbjct: 122 WVDLPTDMKNTEPRYRDLKNKEIPRANPTDDLEVEVISGNSYGVDSVKDLAYTPIDFYMY 181

Query: 215 ISSKKGTPFEQKFPEDFNVFMYVLKGSLTLNSKNFPQYSAIFFKNDGEGVEGIAASDDTE 274
              K GT F Q F  DFNVF+YVL+G++T+  + FPQYS+IFF  DG+ V G  A+D+TE
Sbjct: 182 RGKKAGTEFTQNFSRDFNVFIYVLQGAITIGDQVFPQYSSIFFNTDGDAVGGTIAADNTE 241

Query: 275 FALVGGSILEQPVVQHGPFVETSKERMIQVFQDYQFGMNGFERAHNWKSSISDGISQQNA 334
           FA++GG IL+Q  VQHGPFVE +KE++I+VF DYQ   NGFERA NWKSSI DGI + +A
Sbjct: 242 FAIIGGKILDQQTVQHGPFVEETKEKLIKVFYDYQSYSNGFERARNWKSSIRDGIKENDA 301

>NDAI0C02620 Chr3 (608649..609584) [936 bp, 311 aa] {ON} Anc_6.23
          Length = 311

 Score =  415 bits (1066), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 184/301 (61%), Positives = 249/301 (82%), Gaps = 1/301 (0%)

Query: 35  NRMSKVRTIYKHFVAVEQSEGVGARVRRSIGTTQLRNFTPFLMLDHFNVTPPAGFPDHPH 94
           +++ ++R++ K+F+A+EQ EGVGA VRRSIG+ + RNF+PFL++DHF V+ PAGFPDHPH
Sbjct: 2   SKVPQIRSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDHFTVSHPAGFPDHPH 61

Query: 95  HGQETITYVLGGMMAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEIPVKMESGEPTVGLQL 154
           HGQETITYVL GM+AHEDFTGSKGVLRPGDLQFMTAGK I+HSEIPVKME+G P +G+QL
Sbjct: 62  HGQETITYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIMHSEIPVKMENGTPGIGIQL 121

Query: 155 WVDLPERLKNCEPRYRDLRGAETPIAEPHQNLKVRVISGESYGVQSRSELAYTPVHFYHF 214
           WV LP  LKN EPRYR+LRG + PI +P++NL VRVISG+SYG +S  +LAYTP+ +Y F
Sbjct: 122 WVALPIDLKNSEPRYRNLRGDKIPIIKPNENLTVRVISGKSYGTESVKDLAYTPIDYYIF 181

Query: 215 ISSKKGTPFEQKFPEDFNVFMYVLKGSLTLNSKNFPQYSAIFFKNDGEGVEGIAASD-DT 273
             +KKG  F Q+ P +FN F+Y+ KG++ +N   +P+YS +FF  DG+ ++G +A+D +T
Sbjct: 182 NMNKKGVEFFQETPRNFNFFLYITKGAVEINGVVYPKYSTVFFDTDGDSIKGKSAADEET 241

Query: 274 EFALVGGSILEQPVVQHGPFVETSKERMIQVFQDYQFGMNGFERAHNWKSSISDGISQQN 333
           EFA++GG IL+QP++QHGPFVET +E ++QVF++YQ+ +NGFERA  W+SSI+DGI +++
Sbjct: 242 EFAIIGGLILDQPILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIADGILEKD 301

Query: 334 A 334
            
Sbjct: 302 V 302

>KNAG0K01400 Chr11 complement(280379..281308) [930 bp, 309 aa] {ON} 
          Length = 309

 Score =  412 bits (1059), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 184/298 (61%), Positives = 248/298 (83%), Gaps = 1/298 (0%)

Query: 37  MSKV-RTIYKHFVAVEQSEGVGARVRRSIGTTQLRNFTPFLMLDHFNVTPPAGFPDHPHH 95
           M++V R++ K F A+EQ+EGVGA VRRSIG  + RNF+PFL+LDHF V+ P+GFPDHPHH
Sbjct: 1   MAQVFRSVQKAFRALEQAEGVGALVRRSIGVRRQRNFSPFLLLDHFTVSHPSGFPDHPHH 60

Query: 96  GQETITYVLGGMMAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEIPVKMESGEPTVGLQLW 155
           GQETITY+  GM+AHEDFTGSKG+LRPGDLQFMTAGKGIVHSEIPV  +  +  VGLQLW
Sbjct: 61  GQETITYIQQGMIAHEDFTGSKGILRPGDLQFMTAGKGIVHSEIPVLTKDAKAAVGLQLW 120

Query: 156 VDLPERLKNCEPRYRDLRGAETPIAEPHQNLKVRVISGESYGVQSRSELAYTPVHFYHFI 215
           VDLP+ +K+C PRYR+LR +E PIA+P+++LKV+VISG+SYGV+S  ELAYTPV FYH+I
Sbjct: 121 VDLPKNMKDCPPRYRNLRASEIPIAQPNEHLKVKVISGKSYGVESVKELAYTPVDFYHYI 180

Query: 216 SSKKGTPFEQKFPEDFNVFMYVLKGSLTLNSKNFPQYSAIFFKNDGEGVEGIAASDDTEF 275
           S K+G  F Q+ PE++N F+YV++GS+ ++ + +PQYS IF+  +G  ++G+    +TEF
Sbjct: 181 SDKEGINFVQEIPENYNAFLYVMEGSVVVDGQEYPQYSTIFYNANGNAIKGVTGEKNTEF 240

Query: 276 ALVGGSILEQPVVQHGPFVETSKERMIQVFQDYQFGMNGFERAHNWKSSISDGISQQN 333
           A++ G IL+Q +VQHGPFVETS E+M +VF++YQ+G+NGFE+A NW+SSI +GI++++
Sbjct: 241 AIIAGLILDQDIVQHGPFVETSPEKMKEVFRNYQWGINGFEKAINWESSIINGITEKD 298

>NCAS0H00840 Chr8 complement(153671..154753) [1083 bp, 360 aa] {ON}
           Anc_6.23
          Length = 360

 Score =  412 bits (1058), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 196/335 (58%), Positives = 249/335 (74%), Gaps = 5/335 (1%)

Query: 7   KTVYILALFAVL--VSWASSKYFMSNKGQENRMS---KVRTIYKHFVAVEQSEGVGARVR 61
           K + I AL  VL  V    S   M    +++  +   K R+I KHF+A EQSEG GA VR
Sbjct: 23  KYILIAALVLVLTVVFQFKSPTVMDQVNEDSATAESQKERSILKHFIAEEQSEGDGATVR 82

Query: 62  RSIGTTQLRNFTPFLMLDHFNVTPPAGFPDHPHHGQETITYVLGGMMAHEDFTGSKGVLR 121
           RS+G+ Q+  F+PFLMLD F VTPP GFPDHPHHGQETITYV GG++AHEDFTGSKGVL 
Sbjct: 83  RSVGSYQMTRFSPFLMLDDFKVTPPEGFPDHPHHGQETITYVTGGILAHEDFTGSKGVLY 142

Query: 122 PGDLQFMTAGKGIVHSEIPVKMESGEPTVGLQLWVDLPERLKNCEPRYRDLRGAETPIAE 181
           PGDLQFMTAGKGIVH E+PV M     + GLQ WVDLP  LKNCEPRYR+LR    P+ +
Sbjct: 143 PGDLQFMTAGKGIVHCEMPVTMNDSAVSTGLQFWVDLPADLKNCEPRYRNLRADTIPVVQ 202

Query: 182 PHQNLKVRVISGESYGVQSRSELAYTPVHFYHFISSKKGTPFEQKFPEDFNVFMYVLKGS 241
            + NL V+VISG+SY V+S  +LAYTP+ FY+FIS+K GT F Q+ P DFN F+YV KG+
Sbjct: 203 VNDNLNVKVISGKSYDVESVKDLAYTPIDFYYFISNKAGTEFAQEIPPDFNAFIYVTKGA 262

Query: 242 LTLNSKNFPQYSAIFFKNDGEGVEGIAASDDTEFALVGGSILEQPVVQHGPFVETSKERM 301
           +T+  + F  +S++FF+ DG  + G  ASD+TEFA++GG IL+Q VVQHGPFVET++E++
Sbjct: 263 ITIGEEVFKVHSSVFFQTDGNFIRGFTASDNTEFAVIGGKILDQQVVQHGPFVETTREKL 322

Query: 302 IQVFQDYQFGMNGFERAHNWKSSISDGISQQNAEK 336
           I+VF +Y+ G+NGFE+A  WKSSIS+GI +Q A +
Sbjct: 323 IEVFDNYRAGINGFEKALGWKSSISNGIDEQTARE 357

>KNAG0K02440 Chr11 (487307..489097) [1791 bp, 596 aa] {ON} Anc_3.39
           YNL308C
          Length = 596

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 26/57 (45%)

Query: 170 RDLRGAETPIAEPHQNLKVRVISGESYGVQSRSELAYTPVHFYHFISSKKGTPFEQK 226
           +DL        +P    + R +S ESYG+ +R   A        FIS KK  P+ +K
Sbjct: 478 KDLEERGRSKTQPEIKFRYREVSPESYGLNAREIFAADDTDLNDFISLKKFAPYREK 534

>NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {ON}
           Anc_8.144
          Length = 547

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 8/59 (13%)

Query: 269 ASDDTEFALVGGSILEQPVVQHGPFVETSKERMIQVFQDYQFGMNGFERAHNWKSSISD 327
           ++D+ EF L+GG  L+Q  VQ  P     K+R+    +DY F +N F  + N  +SI D
Sbjct: 248 SNDNIEFPLIGGESLQQSEVQPQP---QQKKRV----RDY-FKLNIFSSSANINTSIDD 298

>KLTH0H13948g Chr8 complement(1215314..1216807) [1494 bp, 497 aa]
           {ON} similar to uniprot|P39998 Saccharomyces cerevisiae
           YEL015W EDC3 Non-essential conserved protein of unknown
           function plays a role in mRNA decapping by specifically
           affecting the function of the decapping enzyme Dcp1p
           localizes to cytoplasmic mRNA processing bodies
          Length = 497

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 23/47 (48%)

Query: 174 GAETPIAEPHQNLKVRVISGESYGVQSRSELAYTPVHFYHFISSKKG 220
           G   P A P Q L++  +  +S+G  S+  + +  VH   F+  K G
Sbjct: 235 GVSVPCATPVQLLEIERVCSDSFGFTSKMAMEHWAVHMSLFVKQKLG 281

>ZYRO0A01342g Chr1 (104605..108636) [4032 bp, 1343 aa] {ON} similar
           to uniprot|P32597 Saccharomyces cerevisiae YIL126W STH1
           helicase related protein snf2 homolog
          Length = 1343

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 3/64 (4%)

Query: 200 SRSELAYTPVHFYHFISS--KKGTPFEQKFPEDFNVFMYVLKGSLTLNSKNFPQYSAIFF 257
           S+S+L+YT  H+YH  +     GTP +   PE + +  +VL      ++K F  +    F
Sbjct: 601 SQSKLSYTITHYYHTKNRLILTGTPLQNNLPELWALLNFVLPKIFN-SAKTFEDWFNTPF 659

Query: 258 KNDG 261
            N G
Sbjct: 660 ANTG 663

>TDEL0C04520 Chr3 (814803..818744) [3942 bp, 1313 aa] {ON} Anc_2.235
           YIL126W
          Length = 1313

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 3/64 (4%)

Query: 200 SRSELAYTPVHFYHFISS--KKGTPFEQKFPEDFNVFMYVLKGSLTLNSKNFPQYSAIFF 257
           ++S+L+YT  H+YH  +     GTP +   PE + +  +VL      ++K F  +    F
Sbjct: 590 AQSKLSYTITHYYHTRNRLILTGTPLQNNLPELWALLNFVLPKIFN-SAKTFEDWFNTPF 648

Query: 258 KNDG 261
            N G
Sbjct: 649 ANTG 652

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,590,168
Number of extensions: 1570230
Number of successful extensions: 3121
Number of sequences better than 10.0: 31
Number of HSP's gapped: 3184
Number of HSP's successfully gapped: 31
Length of query: 341
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 231
Effective length of database: 40,868,139
Effective search space: 9440540109
Effective search space used: 9440540109
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)