Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E01210g6.21ON32332315280.0
Kwal_56.224336.21ON32232110011e-136
Smik_15.1766.21ON3453299651e-130
YOR007C (SGT2)6.21ON3463299541e-128
Ecym_30256.21ON3183239461e-127
Skud_15.1686.21ON3483319441e-127
KLTH0C11220g6.21ON3273269411e-127
TPHA0J003406.21ON3383369231e-124
TDEL0G044806.21ON3433289121e-122
Suva_15.1826.21ON3463299111e-122
ZYRO0C07788g6.21ON3343189051e-121
Kpol_1037.266.21ON3423329041e-121
KAFR0L004106.21ON3313308911e-119
CAGL0E02739g6.21ON3433198761e-117
KLLA0D01155g6.21ON3353308701e-116
NCAS0H008306.21ON3383368481e-112
NDAI0D008106.21ON3493428381e-111
KNAG0M011706.21ON3393278341e-110
TBLA0G010506.21ON3503298341e-110
ACR005W6.21ON3273357931e-104
Kpol_1032.86.21ON3433285041e-60
NCAS0D026706.21ON3512503621e-39
TPHA0M002706.21ON3773733343e-35
NDAI0I022406.21ON3502163158e-33
TBLA0A072706.21ON3733372749e-27
NDAI0F009105.617ON5831021922e-15
Kwal_55.199355.617ON5931941878e-15
CAGL0H08195g5.617ON5831011861e-14
NCAS0G008105.617ON5842261842e-14
TPHA0D028805.617ON5851201842e-14
KLTH0E02178g5.617ON5931001833e-14
AEL224W5.617ON5801231815e-14
SAKL0G07084g5.617ON5851231781e-13
KAFR0C058905.617ON5752371772e-13
ZYRO0A05676g5.617ON5721011753e-13
YOR027W (STI1)5.617ON5891011743e-13
Kpol_1018.695.617ON5902281744e-13
Smik_15.2055.617ON5891011744e-13
Skud_15.1925.617ON5891281719e-13
KLLA0A07062g5.617ON5811001692e-12
TBLA0E033005.617ON5821001682e-12
Suva_8.805.617ON5861011655e-12
TDEL0A048405.617ON5761001621e-11
KNAG0B032005.617ON5792291584e-11
Ecym_55825.617ON5841011585e-11
NCAS0A00490singletonON6201051274e-07
AAR083C3.481ON5381691239e-07
Ecym_44133.481ON5101371212e-06
KAFR0B066103.481ON5111211103e-05
TBLA0C039503.481ON512981061e-04
AGL268C8.506ON3792061032e-04
NDAI0B057903.481ON523831032e-04
TBLA0F032203.395ON536651033e-04
KNAG0A039508.506ON3861031023e-04
KLLA0F24046g2.152ON604861033e-04
KAFR0E029808.506ON3801371024e-04
TDEL0D055003.481ON5121161014e-04
NCAS0B024008.506ON3801271005e-04
Skud_7.4323.481ON513851015e-04
NCAS0F034903.481ON5121021015e-04
YGR123C (PPT1)3.481ON513851006e-04
KLLA0B09966g8.506ON370133980.001
Smik_6.2153.481ON51388980.001
SAKL0F03102g3.481ON513135980.001
CAGL0H07425g8.506ON380131970.001
SAKL0H10934g8.506ON380107970.001
NDAI0C052908.506ON37996960.002
Kwal_27.118908.506ON334116940.003
Smik_2.2958.506ON38592940.003
Kwal_33.147672.152ON594110950.003
KNAG0A079003.481ON51279940.004
CAGL0D05060g3.481ON51083930.005
Kpol_505.413.481ON51398920.007
NDAI0B043402.152ON664111910.008
Suva_4.4058.506ON38592910.008
ZYRO0B04224g3.481ON513116910.009
Suva_7.4083.481ON51385900.011
YHR117W (TOM71)2.152ON639104880.019
Skud_8.1782.152ON638101870.024
KLLA0B10912g3.481ON512129870.025
YBR155W (CNS1)8.506ON38592870.025
TPHA0D032203.481ON513145860.029
NCAS0G024802.152ON596101850.046
KLTH0F14542g3.481ON513115840.057
ZYRO0F08624g8.506ON379114830.068
KLTH0B05170g2.152ON59386830.077
NDAI0F028102.152ON60980830.084
TDEL0B013108.506ON38092810.11
KLTH0C06204g7.412ON627131810.14
Kwal_23.54087.546ON141047810.15
ADR230W5.689ON685100810.15
ABR131W2.152ON59486810.15
Ecym_82042.152ON59786810.15
NCAS0B070102.152ON62598810.16
Suva_15.3142.152ON644104810.16
YNL121C (TOM70)2.152ON617117800.18
AGL294W7.412ON656104790.24
TPHA0L014208.506ON374132780.26
Skud_2.2828.506ON38589780.26
KNAG0A041208.470ON602102790.27
Smik_4.4918.470ON61249770.41
Smik_4.7743.84ON58434770.45
Ecym_71427.412ON675104770.47
Skud_4.5068.470ON61149770.49
CAGL0L04048g2.152ON58798760.51
Suva_2.4108.470ON61149760.51
Skud_14.2112.152ON617117760.51
TPHA0E007407.412ON746104760.56
Smik_8.1952.152ON635101760.61
NCAS0B025608.470ON578114760.62
Ecym_25598.506ON370221750.63
Smik_14.2072.152ON617117760.64
TBLA0C055302.152ON610104750.82
YDR244W (PEX5)8.470ON61248750.85
TBLA0H033808.506ON375163740.86
Kpol_513.28.506ON374121740.87
Kwal_55.211753.481ON511100740.90
CAGL0K11209g8.470ON59092740.96
SAKL0E10956g2.152ON60086741.1
AFR453W8.470ON56987731.5
NDAI0C051308.470ON590110721.6
NCAS0I008703.395ON58566721.7
KLTH0E11748g8.506ON378223711.8
Ecym_20906.328ON17262692.5
Suva_14.2192.152ON617117703.0
Kpol_1028.516.328ON11786663.1
KNAG0B012903.395ON53763703.2
NCAS0E024907.412ON809104703.6
ZYRO0E03300g1.456ON397143693.8
Kpol_1018.1067.412ON753123694.1
TDEL0B051402.152ON599104684.9
Suva_3.421.431ON28456675.0
Ecym_13968.470ON57391685.2
Ecym_40315.689ON68896685.4
KLLA0C15455g8.470ON56692685.7
TPHA0I015102.152ON60398686.1
KLTH0H14872g5.352ON623148686.1
KLTH0A00638g7.546ON141146686.2
Kpol_520.67.458ON29263676.3
KNAG0B022407.412ON73987676.4
NDAI0J001307.546ON140347686.8
KNAG0F040107.546ON141847686.8
SAKL0H11946g8.470ON57391668.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E01210g
         (323 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...   593   0.0  
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...   390   e-136
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...   376   e-130
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...   372   e-128
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...   369   e-127
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...   368   e-127
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...   367   e-127
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...   360   e-124
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...   355   e-122
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...   355   e-122
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...   353   e-121
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...   352   e-121
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...   347   e-119
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...   342   e-117
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...   339   e-116
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...   331   e-112
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...   327   e-111
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...   325   e-110
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...   325   e-110
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...   310   e-104
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...   198   1e-60
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...   144   1e-39
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...   133   3e-35
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...   125   8e-33
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...   110   9e-27
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     79   2e-15
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    77   8e-15
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    76   1e-14
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    75   2e-14
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    75   2e-14
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    75   3e-14
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    74   5e-14
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    73   1e-13
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    73   2e-13
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    72   3e-13
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    72   3e-13
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    72   4e-13
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    72   4e-13
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    70   9e-13
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    70   2e-12
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    69   2e-12
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    68   5e-12
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    67   1e-11
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    65   4e-11
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    65   5e-11
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       54   4e-07
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    52   9e-07
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    51   2e-06
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    47   3e-05
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    45   1e-04
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    44   2e-04
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    44   2e-04
TBLA0F03220 Chr6 complement(782214..783824) [1611 bp, 536 aa] {O...    44   3e-04
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    44   3e-04
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...    44   3e-04
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    44   4e-04
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    44   4e-04
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    43   5e-04
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    44   5e-04
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    44   5e-04
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    43   6e-04
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    42   0.001
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    42   0.001
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    42   0.001
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    42   0.001
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    42   0.001
NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON} Anc_8...    42   0.002
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    41   0.003
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    41   0.003
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...    41   0.003
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    41   0.004
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    40   0.005
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    40   0.007
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...    40   0.008
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    40   0.008
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    40   0.009
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    39   0.011
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...    39   0.019
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...    38   0.024
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    38   0.025
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    38   0.025
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    38   0.029
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...    37   0.046
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    37   0.057
ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} simila...    37   0.068
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...    37   0.077
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...    37   0.084
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    36   0.11 
KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {...    36   0.14 
Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR1...    36   0.15 
ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic ...    36   0.15 
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...    36   0.15 
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...    36   0.15 
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...    36   0.16 
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...    36   0.16 
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...    35   0.18 
AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic ho...    35   0.24 
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    35   0.26 
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    35   0.26 
KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {O...    35   0.27 
Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W ...    34   0.41 
Smik_4.774 Chr4 complement(1365084..1366838) [1755 bp, 584 aa] {...    34   0.45 
Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}...    34   0.47 
Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W ...    34   0.49 
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...    34   0.51 
Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W ...    34   0.51 
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...    34   0.51 
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    34   0.56 
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...    34   0.61 
NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {O...    34   0.62 
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    33   0.63 
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...    34   0.64 
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...    33   0.82 
YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}  PEX5Peroxi...    33   0.85 
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    33   0.86 
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    33   0.87 
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    33   0.90 
CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON} sim...    33   0.96 
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...    33   1.1  
AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic ...    33   1.5  
NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON} Anc_8...    32   1.6  
NCAS0I00870 Chr9 (160192..161949) [1758 bp, 585 aa] {ON} Anc_3.3...    32   1.7  
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    32   1.8  
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    31   2.5  
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...    32   3.0  
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    30   3.1  
KNAG0B01290 Chr2 (244938..246551) [1614 bp, 537 aa] {ON} Anc_3.3...    32   3.2  
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    32   3.6  
ZYRO0E03300g Chr5 complement(259634..260827) [1194 bp, 397 aa] {...    31   3.8  
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    31   4.1  
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...    31   4.9  
Suva_3.42 Chr3 (57365..58219) [855 bp, 284 aa] {ON} YCR016W (REAL)     30   5.0  
Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar t...    31   5.2  
Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON} s...    31   5.4  
KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} simi...    31   5.7  
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...    31   6.1  
KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]...    31   6.1  
KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {O...    31   6.2  
Kpol_520.6 s520 (15903..16781) [879 bp, 292 aa] {ON} (15903..167...    30   6.3  
KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {O...    30   6.4  
NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {O...    31   6.8  
KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7....    31   6.8  
SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]...    30   8.1  

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score =  593 bits (1528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/323 (92%), Positives = 298/323 (92%)

Query: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60
           MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD
Sbjct: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60

Query: 61  NRKLDELLKSAATALPTQSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKKY 120
           NRKLDELLKSAATALPTQSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKKY
Sbjct: 61  NRKLDELLKSAATALPTQSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKKY 120

Query: 121 TEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGK 180
           TEAIEVLP               LKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGK
Sbjct: 121 TEAIEVLPSNAVYYANRAAAYSSLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGK 180

Query: 181 PEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESSTDAGAG 240
           PEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESSTDAGAG
Sbjct: 181 PEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESSTDAGAG 240

Query: 241 ASGFPDMASXXXXXXXXXXNNPQVMSAAQKLMQNPGAMDEMMKNPAVRQMAENFSSGGGT 300
           ASGFPDMAS          NNPQVMSAAQKLMQNPGAMDEMMKNPAVRQMAENFSSGGGT
Sbjct: 241 ASGFPDMASLLGGGLGGLLNNPQVMSAAQKLMQNPGAMDEMMKNPAVRQMAENFSSGGGT 300

Query: 301 PNLGDLMSNPAIKDMAKNLFGPN 323
           PNLGDLMSNPAIKDMAKNLFGPN
Sbjct: 301 PNLGDLMSNPAIKDMAKNLFGPN 323

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score =  390 bits (1001), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 196/321 (61%), Positives = 241/321 (75%), Gaps = 3/321 (0%)

Query: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60
           M+ SNK++A LIVDFLS TVE   VSEDY DSLNVAIDCI+EAFEF+R++V+  ++ +F 
Sbjct: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60

Query: 61  NRKLDELLKSAATALPTQSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKKY 120
            R L +++++A+    +  E VKVNIP EDA TKAKAE LKL+GNKAMA+KDFE A+ KY
Sbjct: 61  GRSLKQVVEAASVGSSSPQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLKY 120

Query: 121 TEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGK 180
           +EAI+VLP               LKKYEE+V+DAE AIKVNPSYSKGYSRLGFA+YALGK
Sbjct: 121 SEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGK 180

Query: 181 PEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESSTDAGAG 240
           PEEAL+AYK VLDIEG+ ATD MKRDY+TA +KV QSLN+EKS P  T +   S      
Sbjct: 181 PEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAPAATRDGAGSATG--- 237

Query: 241 ASGFPDMASXXXXXXXXXXNNPQVMSAAQKLMQNPGAMDEMMKNPAVRQMAENFSSGGGT 300
           + G PD++S          NNPQ+M AAQ++MQNP AM E+M NPAV+QMAE F SGGGT
Sbjct: 238 SGGLPDISSMLGGGLGGLLNNPQLMQAAQQMMQNPNAMQEVMNNPAVKQMAEKFQSGGGT 297

Query: 301 PNLGDLMSNPAIKDMAKNLFG 321
           P++ DLM+NPA+ DMAKN+FG
Sbjct: 298 PSMADLMNNPALMDMAKNMFG 318

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score =  376 bits (965), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 198/329 (60%), Positives = 249/329 (75%), Gaps = 8/329 (2%)

Query: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIV-KNSF 59
           M  S +EIAALIV++ SS VEK  +SED ADSLNVA+DCISEAF FERDA S I+ K+ F
Sbjct: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60

Query: 60  DNRKLDELLKSAATALPTQ----SEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFET 115
             + L ++L SA+ A  +     ++ V+VNIP EDA TKAKAEDLK+QGNKAMA+KD+E 
Sbjct: 61  KGKSLADVLNSASKASESNEKDDAQNVEVNIPEEDAETKAKAEDLKMQGNKAMANKDYEL 120

Query: 116 AIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFAK 175
           AI KYTEAI+VLP               L++Y+E+V+DAES+I ++PSY +GYSRLGFAK
Sbjct: 121 AINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAK 180

Query: 176 YALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESST 235
           YA GKPEEALEAYK VLDIEGD AT+ MKRDYE+AK+KVEQSLNLEK+VP Q+ + +++ 
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKAVPEQSRDADANA 240

Query: 236 DAGAGASGFPDMASXXXXXXXXXXNNPQVMSAAQKLMQNPGAM---DEMMKNPAVRQMAE 292
             GAG+SG PD+ S          NNPQ+M AAQK+M NPGAM    +MM++P++RQMAE
Sbjct: 241 SQGAGSSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE 300

Query: 293 NFSSGGGTPNLGDLMSNPAIKDMAKNLFG 321
            F+SGGG PNL DLM+NPA+++MA NLFG
Sbjct: 301 GFTSGGGAPNLSDLMNNPALRNMAGNLFG 329

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score =  372 bits (954), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 197/329 (59%), Positives = 247/329 (75%), Gaps = 8/329 (2%)

Query: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIV-KNSF 59
           M+ S +EIAALIV++ SS VEK  +SED ADSLNVA+DCISEAF FER+AVS I+ K+ F
Sbjct: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60

Query: 60  DNRKLDELLKSAATALPTQ----SEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFET 115
             + L ++L SA+    +     +E V++NIP +DA TKAKAEDLK+QGNKAMA+KD+E 
Sbjct: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL 120

Query: 116 AIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFAK 175
           AI KYTEAI+VLP               LK+Y+++V+DAESAI ++PSY +GYSRLGFAK
Sbjct: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK 180

Query: 176 YALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESST 235
           YA GKPEEALEAYK VLDIEGD AT+ MKRDYE+AK+KVEQSLNLEK+VP Q+ + +   
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADVDA 240

Query: 236 DAGAGASGFPDMASXXXXXXXXXXNNPQVMSAAQKLMQNPGAM---DEMMKNPAVRQMAE 292
             GA A G PD+ S          NNPQ+M AAQK+M NPGAM    +MM++P++RQMAE
Sbjct: 241 SQGASAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE 300

Query: 293 NFSSGGGTPNLGDLMSNPAIKDMAKNLFG 321
            F+SGGGTPNL DLM+NPA+++MA NLFG
Sbjct: 301 GFASGGGTPNLSDLMNNPALRNMAGNLFG 329

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score =  369 bits (946), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 190/323 (58%), Positives = 236/323 (73%), Gaps = 9/323 (2%)

Query: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60
           M  SNKEIAALIV FLS++ +   V E+Y DSLNVAIDCI+EAFE ER+  +EIV  +++
Sbjct: 1   MPGSNKEIAALIVQFLSTSTKD--VQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYN 58

Query: 61  NRKLDELLKSAATALPT--QSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIK 118
            R L +L+KS A+  PT   SEP   N  A       +AE+LKL+GNKA A+KDFE A+K
Sbjct: 59  GRGLVDLVKSGASE-PTLSSSEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVK 117

Query: 119 KYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYAL 178
           KYTEAIE++P                KK+EE+V+DAESA+++NPSYS+GYSRLG AKYAL
Sbjct: 118 KYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYAL 177

Query: 179 GKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESSTDAG 238
           GKPEEA+EAYK VLDIEGD AT+ MKRDYE+AK+KVE+SLNLE ++P   ++Q   T  G
Sbjct: 178 GKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLE-ALPKGEEQQ---TSEG 233

Query: 239 AGASGFPDMASXXXXXXXXXXNNPQVMSAAQKLMQNPGAMDEMMKNPAVRQMAENFSSGG 298
           + A GFPD++S          NNPQVM AAQK+MQNP AM EMM NPA++QMA+NF+SGG
Sbjct: 234 SSAGGFPDLSSMLGGGLGGLLNNPQVMQAAQKMMQNPSAMQEMMNNPAIKQMAQNFASGG 293

Query: 299 GTPNLGDLMSNPAIKDMAKNLFG 321
           GTPNLGD+M +P IKDMA   FG
Sbjct: 294 GTPNLGDMMKDPNIKDMAGKFFG 316

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score =  368 bits (944), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 197/331 (59%), Positives = 245/331 (74%), Gaps = 10/331 (3%)

Query: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNS-F 59
           M+ S  EIA+LIV++ SS VEK  +SED ADSLNVA+DCISEAF FER+AV  I++NS F
Sbjct: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60

Query: 60  DNRKLDELLKSAATALPT----QSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFET 115
             + L +LL S +    +     ++ V+VNIP EDA  KAKAEDLK+QGNKAMA+KD+E 
Sbjct: 61  KGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPEEDAEIKAKAEDLKMQGNKAMANKDYEL 120

Query: 116 AIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFAK 175
           AI KYTEAI+VLP               LK Y+E+V+DAESAI ++P+Y +GYSRLGFAK
Sbjct: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAK 180

Query: 176 YALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESST 235
           YA GKPEEALEAYK VLDIEGD AT+ MKRDYE+AK+KVEQSLNLEK+VP Q+ + +++ 
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADANA 240

Query: 236 DA--GAGASGFPDMASXXXXXXXXXXNNPQVMSAAQKLMQNPGAM---DEMMKNPAVRQM 290
           DA  GAG SG PD+ S          NNPQ+M AAQK+M NPGAM    +MM++P ++QM
Sbjct: 241 DASQGAGTSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPNIKQM 300

Query: 291 AENFSSGGGTPNLGDLMSNPAIKDMAKNLFG 321
           AE F+SGGG PNL DLM+NPA++ MA NLFG
Sbjct: 301 AEGFTSGGGAPNLSDLMNNPALRSMAGNLFG 331

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score =  367 bits (941), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 191/326 (58%), Positives = 240/326 (73%), Gaps = 8/326 (2%)

Query: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60
           M  + KE+A+LI+D+L  T E   + EDY DSLNVAIDC++EAFE E+++ S +++ SF 
Sbjct: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFG 60

Query: 61  NRKLDELLKSAATA-LPTQSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKK 119
            + L++++ +++     TQ EPVKVNIP EDA  KAKAE LKL+GNKAMA+KDFE AI K
Sbjct: 61  GQSLEQIVGASSKGPTATQQEPVKVNIPVEDAEIKAKAEALKLEGNKAMATKDFEHAISK 120

Query: 120 YTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALG 179
           Y+EAI  LP               LKKY E+V+DAE+AIKVNPSYSKGYSRLGFA+YALG
Sbjct: 121 YSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALG 180

Query: 180 KPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESSTDAGA 239
           +PEEAL+AYK VLDIEG  ATD MKRDY+TA +KVEQSLN+E+S P  ++ +  S DA A
Sbjct: 181 RPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASNAE--SPDA-A 237

Query: 240 GASGFPDMASX----XXXXXXXXXNNPQVMSAAQKLMQNPGAMDEMMKNPAVRQMAENFS 295
           G SGFPD+AS               NPQVM AAQ++MQNP AM EMM NPA++QMA+ F 
Sbjct: 238 GGSGFPDIASMLGGGLGGGLGGLLKNPQVMQAAQQMMQNPNAMQEMMSNPAIKQMADKFQ 297

Query: 296 SGGGTPNLGDLMSNPAIKDMAKNLFG 321
           SGGGTP++ DLM+NPA+ DMAKN+FG
Sbjct: 298 SGGGTPSMADLMNNPALMDMAKNMFG 323

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  360 bits (923), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 198/336 (58%), Positives = 241/336 (71%), Gaps = 22/336 (6%)

Query: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60
           MA SNKEIAALIVD+L++ V+K  VS D ADSLNVA+DCI+EAFEFERD+V + VK++F+
Sbjct: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60

Query: 61  NRKLDELLKSAATALPTQSEPVKVNIP--AEDANTKAKAEDLKLQGNKAMASKDFETAIK 118
              L   L  +AT        ++VNI   A D   KA AE LKL+GNKAMA+KD+E+AIK
Sbjct: 61  GNGLTSFLSGSAT------NDIQVNIADDAADEEQKATAEGLKLEGNKAMATKDYESAIK 114

Query: 119 KYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYAL 178
           KY+EAIEVLP               LKKY+++V DAESAIKVNP+YSKGYSRLGFAK+A 
Sbjct: 115 KYSEAIEVLPTNAVYYANRAAAYSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQ 174

Query: 179 GKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESSTD-- 236
           GK E+AL+AYK VLDIEGDKATD+MKRDYETAK+KVEQSLNLEK  P +  E ES+ D  
Sbjct: 175 GKVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKEA-ETESNADAG 233

Query: 237 ----AGAGASGFPDMAS----XXXXXXXXXXNNPQVMSAAQKLMQNPGAMDE---MMKNP 285
                  G  GFPD++S               NPQ+M AAQ++MQNP AM +   MM+NP
Sbjct: 234 TGAAGMGGMGGFPDLSSMLGGGLGGGLGDLLKNPQIMQAAQQMMQNPNAMQQMESMMQNP 293

Query: 286 AVRQMAENFSSGGGTPNLGDLMSNPAIKDMAKNLFG 321
           AVRQMAENF+SG GTP+L  +M+NP +KDMAKN+FG
Sbjct: 294 AVRQMAENFASGEGTPDLSAMMNNPDLKDMAKNMFG 329

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score =  355 bits (912), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 192/328 (58%), Positives = 238/328 (72%), Gaps = 11/328 (3%)

Query: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60
           M+ SNKE+A+LIVD+LS  VEK AVSE+  DSLNVAIDCI E+FE ++     +    F 
Sbjct: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAV----FG 56

Query: 61  NRKLDELLK----SAATALPTQSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETA 116
            + L ELL+    S++    TQ+E +KVNIPAEDA TKAKAE LKL+GNKAMA KDF+ A
Sbjct: 57  GKGLVELLQNESGSSSETATTQAESIKVNIPAEDAETKAKAETLKLEGNKAMACKDFDLA 116

Query: 117 IKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKY 176
           IKKY++AIEVLP               +K YEE+++DAESAIK +P+YSKGYSRLG+AK+
Sbjct: 117 IKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKF 176

Query: 177 ALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESSTD 236
           ALG+ E+ALEAYK VLDIEGDKA+DVMKRDYETAK+KVEQSL+LEK   TQ    ++   
Sbjct: 177 ALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEKKPETQARGADAGAG 236

Query: 237 AGAGASGFPDMASXXXXXXXXXXNNPQVMSAAQKLMQNPGAMDE---MMKNPAVRQMAEN 293
              G+ GF D AS          NNPQ+M AAQ++MQNP AM +   MM+NP VRQMAEN
Sbjct: 237 GAGGSGGFGDFASMLGGGLGGLLNNPQLMQAAQQMMQNPQAMSQMESMMQNPGVRQMAEN 296

Query: 294 FSSGGGTPNLGDLMSNPAIKDMAKNLFG 321
           F+ G G PN+GDLM+NPA++DMA +LFG
Sbjct: 297 FAQGNGMPNMGDLMNNPALRDMAGSLFG 324

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score =  355 bits (911), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 197/329 (59%), Positives = 243/329 (73%), Gaps = 8/329 (2%)

Query: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60
           M+ S +EIA+LIV++ SS VEK  VSED ADSLNVA+DCISEAF FERDAVS I+  S  
Sbjct: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60

Query: 61  NRKLDELLKSAATALPTQ-----SEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFET 115
             +    L S+++ LP       ++ V+VNIP EDA TKAKAE+LK+QGNKAMA+K++E 
Sbjct: 61  KGQSLNNLLSSSSKLPESGKKDDAQNVEVNIPEEDAETKAKAEELKIQGNKAMANKEYEL 120

Query: 116 AIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFAK 175
           AIKKYTEAI+VLP               LK+Y+E+++DAESAI V+PSY +GYSRLGFAK
Sbjct: 121 AIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAK 180

Query: 176 YALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESST 235
           YA GKPEEALEAYK VLDIEGD ATD MKRDYE+AK++VEQSLNLEK+ P Q  +  ++ 
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKTAPEQPRDAGANA 240

Query: 236 DAGAGASGFPDMASXXXXXXXXXXNNPQVMSAAQKLMQNPGAM---DEMMKNPAVRQMAE 292
             GAGA G PD+ S          NNPQ+M AAQK+M NPGAM     MM++P++RQMAE
Sbjct: 241 GQGAGAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQNMMQDPSIRQMAE 300

Query: 293 NFSSGGGTPNLGDLMSNPAIKDMAKNLFG 321
            F+SGGGTPNL DLM NPA+++MA +LFG
Sbjct: 301 GFTSGGGTPNLSDLMKNPALRNMAGSLFG 329

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score =  353 bits (905), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 185/318 (58%), Positives = 230/318 (72%), Gaps = 7/318 (2%)

Query: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60
           MA SNK+I++LIVD+L+  V+K +VSED  DSLNVAI+CI+EAF  E+ + S     +F 
Sbjct: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSSA----AFG 56

Query: 61  NRKLDELLKSAATALPTQSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKKY 120
            + L ELL + A A  +Q E VKVNIPAEDA  K+KAE LKL+GNKAMA KD+E AIKKY
Sbjct: 57  GKNLAELLSAGAGAPSSQGENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKY 116

Query: 121 TEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGK 180
           +EAI V+P               LK Y+E+++DAESA+KV+ SYSKGYSRLG+AK+A GK
Sbjct: 117 SEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGK 176

Query: 181 PEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESSTDAGAG 240
            EEALEAYK VLDIEGD ATDVMKRDYETAKRKVEQ+L L K+  T+T ++ +   AGA 
Sbjct: 177 SEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDETETSDRGTGEPAGAN 236

Query: 241 ASGFPDMASXXXXXXXXXXNNPQVMSAAQKLMQNPGAMDE---MMKNPAVRQMAENFSSG 297
             G  D++S          NNPQVM AAQ++MQNP AM +   MM+NP VRQMAE F+ G
Sbjct: 237 PGGGFDLSSMLGGGLGGLLNNPQVMQAAQQMMQNPQAMSQMETMMQNPNVRQMAEKFAGG 296

Query: 298 GGTPNLGDLMSNPAIKDM 315
            GTPNL D+M+NPA++DM
Sbjct: 297 NGTPNLNDIMNNPALRDM 314

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score =  352 bits (904), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 191/332 (57%), Positives = 237/332 (71%), Gaps = 11/332 (3%)

Query: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60
           M+ SNK+IAALI+DFLS+ V+KN VSED ADSLNVA+DCI+EAFEFERD+V+ +VK+SF 
Sbjct: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60

Query: 61  NRKLDELLKSAATALPTQS---EPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAI 117
              L   L  + +A    +   E VKVN+  +D      AE LKL+GNKAMA KD+E AI
Sbjct: 61  GNSLSSYLNGSTSASAATTTADETVKVNVTEDDTEASEAAEALKLEGNKAMAGKDYELAI 120

Query: 118 KKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYA 177
           KKYTEAI  LP               LKKY+E+V+DA SAIK+NP+YSKGYSRLGFAK+A
Sbjct: 121 KKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFA 180

Query: 178 LGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSV----PTQTDEQES 233
            GK E+ALEAYK VLDIEGDKAT++MKRDYETAK+KVEQSLNLEKS      T   +  S
Sbjct: 181 QGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAESDSAS 240

Query: 234 STDAGAGASGFPDMAS-XXXXXXXXXXNNPQVMSAAQKLMQNPGAM---DEMMKNPAVRQ 289
           + D  AG  G PD +S           NNPQ+M AAQ++MQ+P AM   + MM+NP+V+Q
Sbjct: 241 AADPFAGMGGMPDFSSMLGGGGLGNLLNNPQLMQAAQQMMQDPEAMKQVESMMQNPSVKQ 300

Query: 290 MAENFSSGGGTPNLGDLMSNPAIKDMAKNLFG 321
           MA+ FSSG GTP+   LM++P+I+DMAKN+FG
Sbjct: 301 MADQFSSGNGTPDFSALMNDPSIRDMAKNMFG 332

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score =  347 bits (891), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 187/330 (56%), Positives = 232/330 (70%), Gaps = 10/330 (3%)

Query: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60
           M  SNKEI+ LIVD+L    EKN VSED  DSLNVAIDCI+++FEFERD+ S ++K+ F 
Sbjct: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFY 60

Query: 61  NRKLDELLKSAATALPTQSEPVKVNIPAE----DANTKAKAEDLKLQGNKAMASKDFETA 116
           N  L ELL+ A     +  E V VN+P +    D  TK KAE LKL+GNKAMA KDF+ A
Sbjct: 61  NLSLPELLEVAMEN--SAKENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKDFDLA 118

Query: 117 IKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKY 176
           I KY+EAI + P               LK +E++ +DAESAI+V+P+YSKGYSRLGFAKY
Sbjct: 119 IAKYSEAISISPNNAIYYANRAAAYSSLKDFEKATEDAESAIRVDPNYSKGYSRLGFAKY 178

Query: 177 ALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESSTD 236
           AL KPEEALEAYK VLD+EGDKAT++MKRDYETAK++VEQSLNLEK   T  +E  + + 
Sbjct: 179 ALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEESVTESA 238

Query: 237 AGAGASGFPDMASXXXXXXXXXXNNPQVMSAAQKLMQNPGAMDE---MMKNPAVRQMAEN 293
           A A A GFPDM+S          NNPQ+M AAQ++M +P AM +   MM+NP++RQMAEN
Sbjct: 239 ANAAAGGFPDMSSMLGGGLNGLLNNPQLMQAAQQMMSDPNAMSKIQSMMQNPSIRQMAEN 298

Query: 294 FSSGGGTPNLGDLMSNPAIKDMAKNLFGPN 323
           F + G TP+   LM++P IKDMAKN FG N
Sbjct: 299 FQN-GNTPDFSQLMNDPNIKDMAKNFFGGN 327

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score =  342 bits (876), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 182/319 (57%), Positives = 231/319 (72%), Gaps = 4/319 (1%)

Query: 5   NKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFDNRKL 64
           +KE+AA+I+ +L   V + AV EDY DS+NVAIDCI+E+FE ER  V  ++K S  ++ L
Sbjct: 2   SKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKGL 61

Query: 65  DELLKSAATALPTQSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKKYTEAI 124
           +E L+        +SE VKVNIPAEDA TKAKAE LKL+GNKAMA KDFE AI KY+EAI
Sbjct: 62  EECLECMKGG-AVKSEDVKVNIPAEDAETKAKAEALKLEGNKAMAGKDFELAIAKYSEAI 120

Query: 125 EVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEA 184
           EVLP               LK+Y+E+V DAE AI+++P+YSKGYSRLGFAKYA  KPEEA
Sbjct: 121 EVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEA 180

Query: 185 LEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESSTDAGAGASGF 244
           LEAYK V+D+EGDKATD+MKRDYETAK+KVEQSLNLEK+   +  +  +   AGAG +G 
Sbjct: 181 LEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDARGADSGAGAGAGAGGAGG 240

Query: 245 PDMASXXXXXXXXXXNNPQVMSAAQKLMQNPGA---MDEMMKNPAVRQMAENFSSGGGTP 301
            D +S          NNPQ+M AAQ++M NP A   M  MM++P++RQMAE F+SG GTP
Sbjct: 241 FDFSSMLSGGLSGLMNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMAEQFTSGNGTP 300

Query: 302 NLGDLMSNPAIKDMAKNLF 320
           N+ DLMSNPA+++MA ++F
Sbjct: 301 NMDDLMSNPALRNMASSMF 319

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score =  339 bits (870), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 191/330 (57%), Positives = 235/330 (71%), Gaps = 11/330 (3%)

Query: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60
           M+ SNKEIAALIVDFLSS+   ++V+EDY DSLNVAIDCI+EAF+FERD    ++   F+
Sbjct: 1   MSLSNKEIAALIVDFLSSS--SSSVNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFN 58

Query: 61  NRKLDELLKSAATALPTQSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKKY 120
            +KL ELL SA ++     EPVKV+IP EDA  KAKAE+LKLQGNKAMA+K F+ AI+KY
Sbjct: 59  GKKLPELLASAPSSGGVSGEPVKVHIPVEDAAAKAKAEELKLQGNKAMAAKKFDEAIEKY 118

Query: 121 TEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGK 180
           T AIEV P               LK+YE++V+DAE AI+V+P+YSKG+SRLGFAKYAL K
Sbjct: 119 TAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNK 178

Query: 181 PEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESSTDAGAG 240
           PEEAL+AYK VLDIEG+KATDVMKRDYETAK+KVE S+NLEKS  + + E  S   A  G
Sbjct: 179 PEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLEKSSTSASSEDVSDKSATEG 238

Query: 241 A---------SGFPDMASXXXXXXXXXXNNPQVMSAAQKLMQNPGAMDEMMKNPAVRQMA 291
                                       NNPQVM AA+K+MQNPG M +MM NPA++QMA
Sbjct: 239 PGAGAGGLPDLSSLLGGGGLGGGLGALLNNPQVMQAAEKMMQNPGLMQDMMSNPAMKQMA 298

Query: 292 ENFSSGGGTPNLGDLMSNPAIKDMAKNLFG 321
             FSSGGG P+L  +M++P+I+DMAKN+FG
Sbjct: 299 NQFSSGGGMPDLSQMMNDPSIRDMAKNMFG 328

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  331 bits (848), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 177/336 (52%), Positives = 230/336 (68%), Gaps = 15/336 (4%)

Query: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60
           M+ SNKE+ +LIVDFLS+ ++   +SED ADSLNVAIDCI+E+FEFERD V++ +++ F 
Sbjct: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS 60

Query: 61  NRKLDELLKSAATALPT--QSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIK 118
            + L E+L SA+       + E VKVNIP EDA  KA AE  KL+GNKAMA+KD+  AI+
Sbjct: 61  GKTLKEILSSASATSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIE 120

Query: 119 KYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYAL 178
           KY+EAI+ LP               +K+Y+ +++DAE AI+++P+YSKGYSRL FAKYAL
Sbjct: 121 KYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYAL 180

Query: 179 GKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESSTDAG 238
            KPEEALE YK VLD+EGDKAT  MKRD+E AK +VE S+NLEKS  T  +   S+    
Sbjct: 181 NKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSAGQQP 240

Query: 239 A---GASGFPDMAS-----XXXXXXXXXXNNPQVMSAAQKLMQNPGA---MDEMMKNPAV 287
           A     SG PDM+S               NNPQVM AAQ++M +P +   M EMM+NP +
Sbjct: 241 ANPFAGSGMPDMSSLFGNGGGMGGLSSFLNNPQVMQAAQQMMSDPNSMQKMQEMMQNPNL 300

Query: 288 RQMAENFSSGGGTPNLGDLMSNPAIKDMAKNLFGPN 323
           R+MA+N +SG    NL DLM+NP++KDMA NLFGPN
Sbjct: 301 REMAQNLASGDA--NLDDLMNNPSVKDMANNLFGPN 334

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score =  327 bits (838), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 179/342 (52%), Positives = 233/342 (68%), Gaps = 21/342 (6%)

Query: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60
           M+ +NK+I ALIVDFLS+ +EKN VSED ADSLNVA+DCISEA EF+R+ V E +KN F+
Sbjct: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60

Query: 61  NRKLDELLKSAATALPT----QSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETA 116
            + L ++L + +TA       + E V+VNIP EDA  KA AE  KL+GNKAMA KDF  A
Sbjct: 61  GKTLVDILNTTSTATANTTIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLA 120

Query: 117 IKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKY 176
           ++KYTEAI++LP               LK++EE+++DAESAIK++PSYSKGYSRL FAKY
Sbjct: 121 VEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKY 180

Query: 177 ALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKS-VPTQTDEQESST 235
            LGK EEALE+YK VLDIEGD AT  MKRDYETAK++VE+S+N+EKS  P Q   Q+ + 
Sbjct: 181 GLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQTN 240

Query: 236 DAGAG------ASGFPDMAS-----XXXXXXXXXXNNPQVMSAAQKLMQNPGAMDE---M 281
           ++  G      A G PDM+S               +NP  MS AQKLM +P AM +   M
Sbjct: 241 ESAQGNAPNPFAGGMPDMSSLFGGAGMGGGLGSLLSNPDFMSTAQKLMSDPNAMQQVQSM 300

Query: 282 MKNPAVRQMAENFSSGGGTPNLGDLMSNPAIKDMAKNLFGPN 323
           M +P++R +A NF +  G  ++ D+M+NPAI++MA NLF  N
Sbjct: 301 MSDPSMRDLANNFKN--GNTDMNDIMNNPAIRNMASNLFKGN 340

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score =  325 bits (834), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 169/327 (51%), Positives = 232/327 (70%), Gaps = 11/327 (3%)

Query: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60
           MA SNKE+++LI+D+L+  V K  VS D  DSLNVAIDC++E F  E+D +S  +++ F+
Sbjct: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFN 60

Query: 61  NRKLDELL----KSAATALPTQSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETA 116
            + L ELL    ++A      ++E VK+NIP EDA TKAKAE LKL+GNKA+ASKD++ A
Sbjct: 61  GKSLTELLDAASQNAGNTDECKTETVKINIPQEDAETKAKAEALKLEGNKAVASKDYDLA 120

Query: 117 IKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKY 176
           ++KYTEAI++LP                + Y+E+V+DAE AIK++P+YSKGYSRL +AKY
Sbjct: 121 VEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKY 180

Query: 177 ALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESSTD 236
                EE+LEAYK VL+IEGD AT+V KR YETAK++VE+SLNLEKSVPT++   +++  
Sbjct: 181 VQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTESAGGQTNPA 240

Query: 237 AGAGASGFPDMASXXXXXXXXXXNNPQVMSAAQKLMQNPGAMDE---MMKNPAVRQMAEN 293
           AG    GFPD +S          NNPQ+M AAQ +M NPGAM++   MM+NPA++QMAE 
Sbjct: 241 AGG---GFPDFSSLMSGGLEGLMNNPQMMQAAQSMMSNPGAMEKIQSMMQNPAIQQMAEQ 297

Query: 294 FSSGGGTPNLGDLMSNPAIKDMAKNLF 320
           F  GG TP+  ++M+NPA+++MA +LF
Sbjct: 298 F-KGGNTPDFSEMMNNPAVRNMASSLF 323

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score =  325 bits (834), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 177/329 (53%), Positives = 228/329 (69%), Gaps = 15/329 (4%)

Query: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60
           M+ SNK+IA L+VDFLS+ +EK AVS D ADSLNVAIDCI+EAFEFE+D V   + + F 
Sbjct: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFG 60

Query: 61  NRKLDELLKSAATALPTQSEP--VKVNIP----AEDANTKAKAEDLKLQGNKAMASKDFE 114
            + L ELL +A  A    S P  +KV+I      ED    AKAE LKL+GNKAMA+KD+ 
Sbjct: 61  GKSLTELLDAATNAKGRSSSPEDIKVSISDKDEEEDKELAAKAEALKLEGNKAMAAKDYN 120

Query: 115 TAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFA 174
            A++KY  AI+++P                +KY+E+++DAESAIKV P++SKGYSRLGFA
Sbjct: 121 LAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFA 180

Query: 175 KYALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESS 234
           K+A GK +EALEAYK  L+++GDKATD+MKRDYETAK+KVEQSLN+EKS         S+
Sbjct: 181 KFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKSATPSASASASA 240

Query: 235 TDAGAGASGFPDMASXXXXXXXXXXNNPQVMSAAQKLMQNPGAMDE---MMKNPAVRQMA 291
           +     A G PDMAS          NNPQ+M AAQ++M NP AM++   MM+NP++RQMA
Sbjct: 241 S-----AGGMPDMASMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMMQNPSIRQMA 295

Query: 292 ENFSSGGGTPNLGDLMSNPAIKDMAKNLF 320
           EN SS G +  +GD M+NPAI++MA NLF
Sbjct: 296 ENLSS-GSSEGMGDFMNNPAIREMASNLF 323

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score =  310 bits (793), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 171/335 (51%), Positives = 221/335 (65%), Gaps = 22/335 (6%)

Query: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60
           M+ SNK+IAALIVDFL+++ +   V EDY DSL VAIDCI+EAFE        +V     
Sbjct: 1   MSPSNKDIAALIVDFLTTSAK--TVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCG 58

Query: 61  NRKLDELLKSAATALPTQSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKKY 120
            R L +LL +         EP    + AE+   K +AE LKL+GN+AMA+KD+ETAI+KY
Sbjct: 59  GRSLSQLLTTGMAHTSDAGEP---KVAAEE--LKKEAEALKLEGNRAMAAKDYETAIQKY 113

Query: 121 TEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGK 180
           T AIEVLP               L++YE++V+DAE A KV+ SYSKG+SRLG+AKYALG+
Sbjct: 114 TAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGR 173

Query: 181 PEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESSTDAGAG 240
            EEALEAYK VLDIEGD AT+ M+RDYE+AKRKVE+S+N++++   +  E   S    AG
Sbjct: 174 HEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNA--EVTESGDSAAGSAG 231

Query: 241 ASGFPDMAS-------------XXXXXXXXXXNNPQVMSAAQKLMQNPGAMDEMMKNPAV 287
            SG PD+AS                       NNPQVM AAQK+MQNP A+ EMM NPA+
Sbjct: 232 GSGLPDLASMFGGGGLGGGLGGGLGGGLGGLLNNPQVMQAAQKMMQNPSAIQEMMSNPAI 291

Query: 288 RQMAENFSSGGGTPNLGDLMSNPAIKDMAKNLFGP 322
           ++MAENF+SG G+  LGDLM++PA+++MA   FGP
Sbjct: 292 KKMAENFASGNGSSGLGDLMADPAVRNMASKFFGP 326

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score =  198 bits (504), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 122/328 (37%), Positives = 192/328 (58%), Gaps = 15/328 (4%)

Query: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60
           M+ +NK+  ALIV++L   ++   VSED A+SLNVAIDCIS+ FE +  +  +I+ + F+
Sbjct: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60

Query: 61  NRKLDELLKSAATALPTQSEPVKVNIPAEDA--NTKAKAEDLKLQGNKAMASKDFETAIK 118
              L + +      L   S+ V++ +  E+   + K +AE LKL+GNK M+ K++++AI 
Sbjct: 61  KSDL-KTITLKGLGLQNVSDVVELEVKNEEISEDKKKEAEALKLEGNKQMSLKNYKSAID 119

Query: 119 KYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYAL 178
           KY++AIE+ P               ++ +  +V DA +AIK++P+YSK YSRLG AK A 
Sbjct: 120 KYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAE 179

Query: 179 GKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQE-SSTDA 237
           G  E+A+ A+K VL++EGDK+T+VMK DYE AK+ V+  + L K+VP  +     ++TD 
Sbjct: 180 GNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPSGPPPLNTTDV 239

Query: 238 GAGASGFPDMASXXXXXXXXXXNNP--QVMSAAQKLMQNPGAMDE---MMKNPAVRQMAE 292
                   D+A+          NN      +      QNP  M +   +M+NP VRQ AE
Sbjct: 240 ------LTDIATVLGSSFGSLMNNTQMMQRAQQMMQTQNPEMMQQVEGLMQNPVVRQFAE 293

Query: 293 NFSSGGGTPNLGDLMSNPAIKDMAKNLF 320
           N ++G G   L D+++NP++K++A  L 
Sbjct: 294 NVANGNGPGGLSDVLNNPSVKEVANGLM 321

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score =  144 bits (362), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 93/250 (37%), Positives = 139/250 (55%), Gaps = 24/250 (9%)

Query: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60
           M+ SNKEIA+ IV +LSS +    V+EDYA+S++VAI+CI ++F+ + +  ++       
Sbjct: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVSAD------- 53

Query: 61  NRKLDELLKSAATALPTQSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKKY 120
                +L       L  + EP       E  N +A    LKL+GNKA+  ++++ AI KY
Sbjct: 54  ----SDLATVLLANLNLEPEPKLSEKERELVNEQAIK--LKLEGNKAVERENYKDAIDKY 107

Query: 121 TEAIEVL-----PXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFAK 175
           T AI++L     P                 +YEE+  DA + IK++P++SKGYSRL  AK
Sbjct: 108 TRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAK 167

Query: 176 YALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESST 235
               K E+A+ AYK VLD+EG+KATD MKRD+E  K+K E +LN    +     +  S+T
Sbjct: 168 IGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFE-TLNFSTHI-----DSGSAT 221

Query: 236 DAGAGASGFP 245
                A+ +P
Sbjct: 222 PISEAANKYP 231

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score =  133 bits (334), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 107/373 (28%), Positives = 177/373 (47%), Gaps = 60/373 (16%)

Query: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60
           M  +++EIA++IVD+ +  +    +++D  DSLNVAIDCI++ F+ ++D +S I+K ++ 
Sbjct: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR 60

Query: 61  NRKLDELL---KSAATALPTQSEPVKV---------------------NIPA-------E 89
           +  L   L   K +A  L  ++  + V                     N+P        E
Sbjct: 61  SNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEE 120

Query: 90  DANTKA------KAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXX 143
              TK       KAE LK +GN+ M +K +  AI  Y++AI++ P               
Sbjct: 121 TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIK 180

Query: 144 LKKYEESVQDAESAI----KVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDI----- 194
              ++ ++ DA  +I    K++P+  K Y RLG AKY +G  E +L A+K +++I     
Sbjct: 181 ANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENN 240

Query: 195 EGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESSTDAGAGAS-GFPDMASXXXX 253
           +GD+ T  M  DYE AK KV++   ++ +  T  +   +S + G        D+ +    
Sbjct: 241 KGDEITKQMDADYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLNDILNMAGN 300

Query: 254 XXXXXXNNPQVMSAAQKLM-QNPGA---MDEMMKNPAVRQMAENFSSGGGTPNLGDLMSN 309
                 +NP      ++L+  NP A    D +M +P VRQM EN +S        D MSN
Sbjct: 301 NLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKENVNS--------DSMSN 352

Query: 310 -PAIKDMAKNLFG 321
            P +KD+  +L  
Sbjct: 353 IPILKDLFYSLLN 365

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score =  125 bits (315), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 80/216 (37%), Positives = 114/216 (52%), Gaps = 16/216 (7%)

Query: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60
           M+ + ++ A+LI+ +LS     N + ED  +SL VAI CI E+F  + D    I+  S  
Sbjct: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGD----ILPTSLK 56

Query: 61  NRKLDELLKSAATALPTQSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKKY 120
            R L  +L+     L    +     I  E+A      E LK +GN+AM    +E AIKKY
Sbjct: 57  ERTLKTILQENLNTLEATQK-----IHNEEA------EALKKEGNEAMIEGQYEEAIKKY 105

Query: 121 TEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGK 180
           TEAI+                  L +YE++V DA  AI ++PS+SK YSRLG+AK    K
Sbjct: 106 TEAIQ-FSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDK 164

Query: 181 PEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQ 216
            E+ + AYK  +D+EG  A+  +  DYE A+ K EQ
Sbjct: 165 LEDGMTAYKRAIDLEGTNASKTLYDDYEDARFKYEQ 200

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score =  110 bits (274), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 84/337 (24%), Positives = 155/337 (45%), Gaps = 42/337 (12%)

Query: 4   SNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAF-------------EFERDA 50
           ++K++A LIV+FL + + K  +S+D  DSLNVAIDCI + +             +F +  
Sbjct: 7   NDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYISSSLILKFSKSD 66

Query: 51  VSEIV----KNSFDN--------------RKLDELLKSAATALPT-QSEPVKVNIPAEDA 91
           ++ I+    KN++ N                L+E +K   + +    +E + +N+     
Sbjct: 67  LTSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTSK 126

Query: 92  NT-----KAKAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKK 146
           N      K  A+  K +GN+ M S+D++ AI+ YT AI   P               +  
Sbjct: 127 NNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVND 186

Query: 147 YEESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGDKATDVMKRD 206
           YE ++ DA   I ++ ++SK Y RL   K    +  +AL+ YK  +++  D   + + R+
Sbjct: 187 YESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITRE 246

Query: 207 YETAKRKVEQSLNLEKSVPTQTDEQESSTDAGAGASGFPDMASXXXXXXXXXXNNPQVMS 266
           +E  K KV+  ++L + +         + ++       PD+ S          +NP +  
Sbjct: 247 FEDLKLKVQTDISL-REISNDHSNNNYNENSYNSTKNSPDIGSILGDGFAALLSNPMLQQ 305

Query: 267 AAQKLMQ-NPGA---MDEMMKNPAVRQMAENFSSGGG 299
              K++Q NP A   +  ++ NPA++ + +NF +G  
Sbjct: 306 MIFKIIQNNPDAAKNIGYVLANPAMKNLLQNFKNGSA 342

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 62/102 (60%), Gaps = 1/102 (0%)

Query: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIEVLPX-XXXXXXXXXXXXXXLKKYEESVQDAE 155
           A++ K QGN A  SKDF  AI+ +T+AIEV P                 K+++E++ DA 
Sbjct: 5   ADEYKQQGNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDAT 64

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGD 197
             +K+NP++SKGY+RLG A++ LG  EEA + YK  L ++ +
Sbjct: 65  ECVKINPTWSKGYNRLGAAEFGLGNLEEAEKNYKEALKLDNN 106

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/208 (21%), Positives = 90/208 (43%), Gaps = 24/208 (11%)

Query: 96  KAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAE 155
           KAE+ +L+G +     D+  A+K Y+E I+  P               L  + E+++D +
Sbjct: 388 KAEEARLEGKEYFTKGDWPNAVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCD 447

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIE-----GDKATDVMKRDYETA 210
           +AIK +P++ + Y R   A+ A+ +   AL+  +     +     G  + ++M+   +  
Sbjct: 448 NAIKKDPNFVRAYIRKATAQIAIKEYANALDTLEEAKSKDSSVNNGANSNEIMRLQMKAT 507

Query: 211 KRKVEQSLNLEKSVPTQTDEQESSTDAGAGASGFPDMASXXXXXXXXXXNNPQVMSAAQK 270
           + + +         PT  +  E +      A   P++A+           +P + S  Q+
Sbjct: 508 QERFQ--------APTGNETPEETYKR---AMQDPEVAAIMQ--------DPVMQSILQQ 548

Query: 271 LMQNPGAMDEMMKNPAVRQMAENFSSGG 298
              NP A+ E MKNP + +  +   + G
Sbjct: 549 AQTNPAALQEHMKNPEISKKIQILIAAG 576

 Score = 30.0 bits (66), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 31/141 (21%), Positives = 63/141 (44%), Gaps = 8/141 (5%)

Query: 91  ANTKAKAEDLKLQGNKAMASKDFETAIKKYTEA------IEVLPXXXXXXXXXXXXXXXL 144
           +N+K +A++ K++GNK   +  F+ AI++Y +A      I  L                +
Sbjct: 249 SNSKLEADEAKVEGNKLYKAHKFDEAIEQYNKAWALNKDITYLNNRSAAEFEKGDFETAI 308

Query: 145 KKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVL--DIEGDKATDV 202
               E+V             +K ++R+G A +  G  +++++ Y+  L      D  T +
Sbjct: 309 ATLNEAVDQGRELRADYKIIAKSFARIGNAYHKKGDLKKSIDYYQKSLTEHRTADILTKL 368

Query: 203 MKRDYETAKRKVEQSLNLEKS 223
              + E  K++ EQ ++ EK+
Sbjct: 369 RNCEKELKKQEAEQYIDPEKA 389

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 76.6 bits (187), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 95/194 (48%), Gaps = 21/194 (10%)

Query: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIEVLPX-XXXXXXXXXXXXXXLKKYEESVQDAE 155
           AE+ K QGN A  +KDFE A + +++AIE                   LKK++E+++DAE
Sbjct: 3   AEEFKKQGNAAFVAKDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDAE 62

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVE 215
             +K+NP++SKGY+R+G A+Y LG  ++A + YK  L+I      D   +  +    +V+
Sbjct: 63  ECVKINPTWSKGYNRVGAAQYGLGNLDDAEKEYKKALEI------DSSNKAAQEGLEQVQ 116

Query: 216 QSLNLEKSVPTQTDEQESSTDAGAGA-SGFPDMASXXXX--XXXXXXNNPQVMSAAQKLM 272
           ++ N  +  P          D G G     P+M               +PQ++S   +  
Sbjct: 117 KTQNARQQQP----------DLGFGQLFNDPNMIEKLKSNPKTAELMKDPQLVSKVLQFQ 166

Query: 273 QNPGAM-DEMMKNP 285
            NP  M  E+MK+P
Sbjct: 167 SNPQMMGQEVMKDP 180

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 90/205 (43%), Gaps = 18/205 (8%)

Query: 96  KAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAE 155
           KAE+ +LQG +     D+ +A+  YTE I+  P               L  + ++++D +
Sbjct: 400 KAEEARLQGKEFFTKGDWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDCD 459

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVL--DIEGDKATDVMKRDYETAKRK 213
            AI  +P++ + Y R   A+ A+ +   A+E        D+E +K  +   R+ E    K
Sbjct: 460 VAISKDPNFVRAYIRKASAQIAVREFAPAMETLDAARAKDLEINKGANA--REIEQLYVK 517

Query: 214 VEQSLNLEKSVPTQTDEQESSTDAGAGASGFPDMASXXXXXXXXXXNNPQVMSAAQKLMQ 273
             Q    +   P +T EQ     A A A   P++A+           +P + S   +  Q
Sbjct: 518 ASQQ-RFKPEDPNETPEQ-----AYARALKDPEVAA--------IMQDPVMQSILSQAQQ 563

Query: 274 NPGAMDEMMKNPAVRQMAENFSSGG 298
           NP A+ E MKNPAV    +   + G
Sbjct: 564 NPAALQEHMKNPAVFSKIQTLIAAG 588

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 64/130 (49%), Gaps = 8/130 (6%)

Query: 70  SAATALPTQSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPX 129
           +A + L   ++ ++V+ P  + ++KAKA+  K +GNK   ++ F+ AI+ Y +A + L  
Sbjct: 240 TAESDLSADADKMEVDEPEPEQDSKAKADAEKAEGNKYYKARKFDEAIEHYNKAWD-LHR 298

Query: 130 XXXXXXXXXXXXXXLKKYEESVQDAESAI----KVNPSY---SKGYSRLGFAKYALGKPE 182
                            YE++++    A+    ++   Y   SK ++R+G A   +   +
Sbjct: 299 DVTYLNNRSAAEYEKGDYEQAIKTLTEAVDQGREMRADYKLISKSFARIGNAYLKMDDLK 358

Query: 183 EALEAYKTVL 192
           +A+E Y+  L
Sbjct: 359 KAIEFYQRSL 368

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 61/101 (60%), Gaps = 1/101 (0%)

Query: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXX-XXXXXXXXXXLKKYEESVQDAE 155
           A++ K QGN A  +KD+E AI  +++AIEV                  LKK+ E++ DAE
Sbjct: 4   ADEYKQQGNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALNDAE 63

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEG 196
             +K+NP++SKGY+RLG A   LG  +EA  +YK  L+++G
Sbjct: 64  ECVKINPTWSKGYNRLGAAHLGLGDLDEAEGSYKKALELDG 104

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 90/208 (43%), Gaps = 24/208 (11%)

Query: 96  KAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAE 155
           KAE+ +L+G       D+  A+K YTE I+  P               L  + E+++D  
Sbjct: 389 KAEEARLEGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDCN 448

Query: 156 SAIKVNPSYSKGYSRLGFAKYAL---GKPEEALEAYKTVLDIEGDKATDVMKRD--YETA 210
            AI+ +P++ + Y R   A+ A+       E L+A +T  D E + + +V + D  Y  A
Sbjct: 449 KAIEKDPNFIRAYIRKATAQIAVKEFAAAIETLDAARTK-DAEVNNSANVREIDQLYVKA 507

Query: 211 KRKVEQSLNLEKSVPTQTDEQESSTDAGAGASGFPDMASXXXXXXXXXXNNPQVMSAAQK 270
            ++  Q  +     P Q  E+         A   P++ +           +P + S  Q+
Sbjct: 508 SQQRFQPAS-SNETPEQVYER---------AMKDPEVIA--------IMQDPVMQSILQQ 549

Query: 271 LMQNPGAMDEMMKNPAVRQMAENFSSGG 298
             QNP A+ E MKNP V +  +   + G
Sbjct: 550 AQQNPAALQEHMKNPDVFKKIQTLIAAG 577

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/226 (27%), Positives = 107/226 (47%), Gaps = 38/226 (16%)

Query: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIEV-LPXXXXXXXXXXXXXXXLKKYEESVQDAE 155
           A++LK +GN A ASKDF  AI+ +TEAI                    LK+++E++ DA+
Sbjct: 4   ADELKQKGNAAFASKDFTGAIEYFTEAIAASTTPNHVLYSNRSACYTSLKQFQEALNDAQ 63

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVE 215
             +K+NP +SKGY+R+G A   LG  ++A   YK  L+++ +          + A   +E
Sbjct: 64  QCVKINPDWSKGYNRMGAAHLGLGDLDDAESNYKKALELDSNN---------KAASEGLE 114

Query: 216 QSLNLEKSVPTQTDEQESSTDAGAGASGFPDMASXXXXXXXXXXNNPQVMSAAQKLMQNP 275
           Q   +++S  ++ D             G  +M S           +P ++   +KL QNP
Sbjct: 115 QVHRVQESRKSRPD------------FGMTEMFS-----------DPNLI---EKLRQNP 148

Query: 276 GAMDEMMKNPAVRQMAENFSSGGGTPNLGDLMSNPAIKDMAKNLFG 321
              D MM +P++    +++ S     +  DLM +P +  +   L G
Sbjct: 149 KTKD-MMNDPSLVAKLQSYKSNPQGLS-SDLMGDPRLMTIMATLLG 192

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 89/208 (42%), Gaps = 24/208 (11%)

Query: 96  KAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAE 155
           KAE+ +L+G +     D+  A+K YTE I+  P               L  + E+++D E
Sbjct: 389 KAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDCE 448

Query: 156 SAIKVNPSYSKGYSRLGFAKYALG---KPEEALEAYKTVLD--IEGDKATDVMKRDYETA 210
            AI+ +P++ + Y R   A+ A+    K  E LE  K   D    G  + ++MK   +  
Sbjct: 449 KAIEKDPNFVRAYLRKATAQIAIKDFVKALETLEEAKKKDDEVNNGASSNEIMKLQMKAT 508

Query: 211 KRKVEQSLNLEKSVPTQTDEQESSTDAGAGASGFPDMASXXXXXXXXXXNNPQVMSAAQK 270
           + + +         PT     E+  +    A   P++A+           +P + S  Q+
Sbjct: 509 QERFQ--------APTGN---ETPEETYKRAMQDPEVAA--------IMQDPVMQSILQQ 549

Query: 271 LMQNPGAMDEMMKNPAVRQMAENFSSGG 298
              +P A+ E MKNP + +  +   S G
Sbjct: 550 AQNDPAALQEHMKNPEISKKIQVLVSAG 577

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/120 (35%), Positives = 69/120 (57%), Gaps = 3/120 (2%)

Query: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIEVLPX-XXXXXXXXXXXXXXLKKYEESVQDAE 155
           A++ K QGN A ++K++E A+  +++AIEV P                LKK+ +++ DA 
Sbjct: 5   ADEYKQQGNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDAN 64

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVE 215
              K+NP++SKGY+R+G A Y LG  +EA ++YK  L++  D +  V +   E  KR  E
Sbjct: 65  ECTKINPTWSKGYNRVGAAHYGLGDLDEAEKSYKKALEL--DASNKVAQEGLEQVKRTQE 122

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 65/245 (26%), Positives = 100/245 (40%), Gaps = 24/245 (9%)

Query: 59  FDNRKLDELLKSAA-TALPTQSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAI 117
           F N+ L E    A  T L +  + +KV   AE      KAE+ ++QG        +  A+
Sbjct: 354 FFNKSLTEFRTPATLTKLRSLEKKIKVQ-EAEAYINPEKAEEARIQGKDFFNKGQWPDAV 412

Query: 118 KKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYA 177
           K YTE I   P               L  + E++ D E A++ +P++ K Y R   A+ A
Sbjct: 413 KAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDCEKALEKDPNFVKAYIRKATAQIA 472

Query: 178 LGKPEEALEAYKTVLDIEGDKATDVMK----RDYETAKRKVEQSLNLEKSVPTQTDEQES 233
           + +   ALE     LDI   K T++      R+      K  Q    E +   +T EQ  
Sbjct: 473 IKEYSSALE----TLDIARSKDTELNNGSNIREINQLYAKATQQ-RFEPASSNETPEQTY 527

Query: 234 STDAGAGASGFPDMASXXXXXXXXXXNNPQVMSAAQKLMQNPGAMDEMMKNPAVRQMAEN 293
                  A   P++A+           +P + S  Q+   NP A+ E MKNP + +  + 
Sbjct: 528 QR-----AMKDPEVAA--------IMQDPVMQSILQQAQTNPAALQEHMKNPEIFKKIQT 574

Query: 294 FSSGG 298
             S G
Sbjct: 575 LISAG 579

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 60/100 (60%), Gaps = 1/100 (1%)

Query: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIEVLPX-XXXXXXXXXXXXXXLKKYEESVQDAE 155
           AE+ K QGN A  +KD+E A + +T+AIE                   LKK+ E++ DA 
Sbjct: 3   AEEFKKQGNAAFVAKDYEKASELFTKAIEASEAPNHVLYSNRSACFTSLKKFNEALNDAN 62

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIE 195
             +K+NP++SKGY+R+G A + LGK +EA + YK  L+I+
Sbjct: 63  ECVKINPAWSKGYNRVGAAYFGLGKLDEAEQGYKKALEID 102

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 87/205 (42%), Gaps = 18/205 (8%)

Query: 96  KAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAE 155
           KAE+ +LQG +     D+  A+K YTE  +  P               L  + E+++D +
Sbjct: 400 KAEEARLQGKEYFTKGDWPNAVKAYTEMTKRAPEDARGYSNRAAALAKLMSFPEAIKDCD 459

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVL--DIEGDKATDVMKRDYETAKRK 213
            AI  +P++ + Y R   A+ A+ +   A+E        D E +   +V  R+ +    K
Sbjct: 460 MAISKDPNFIRAYIRKATAQIAVREFASAIETLDAARAKDTELNNGANV--REIDQLYIK 517

Query: 214 VEQSLNLEKSVPTQTDEQESSTDAGAGASGFPDMASXXXXXXXXXXNNPQVMSAAQKLMQ 273
             Q    +   P +T EQ     A A A   P++AS           +P + S   +  Q
Sbjct: 518 ASQQ-RFQPQDPNETPEQ-----AYARALKDPEVAS--------IMQDPVMQSILSQAQQ 563

Query: 274 NPGAMDEMMKNPAVRQMAENFSSGG 298
           NP A+ E MKNP V    +   + G
Sbjct: 564 NPAALQEHMKNPEVFNKIQTLIAAG 588

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 53/118 (44%), Gaps = 6/118 (5%)

Query: 81  PVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKKYTEAIEV------LPXXXXXX 134
           P++V+ P  + ++K  A+  K +GNK   ++ F+ AI+ Y +A ++      L       
Sbjct: 251 PMEVDEPQPEQDSKKNADAEKAEGNKFYKARKFDEAIEHYNKAWDLHKDVTYLNNRSAAE 310

Query: 135 XXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVL 192
                    +K   E+V+            SK ++R+G A   L   ++A+E Y+  L
Sbjct: 311 YEKGDYEQAIKTLTEAVEQGREMRADYKLISKSFARIGNAYLKLEDFKKAIEFYQKSL 368

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 74.3 bits (181), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 43/123 (34%), Positives = 72/123 (58%), Gaps = 3/123 (2%)

Query: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIEVLPX-XXXXXXXXXXXXXXLKKYEESVQDAE 155
           AE+ K +GN A A+KDFE AI+ + +AIEV                  ++K+ E++ DA+
Sbjct: 4   AEEYKKEGNSAFAAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALADAQ 63

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGDK--ATDVMKRDYETAKRK 213
             +++ P +SKG++RLG A Y LG  +EA E+YK  L+++     A D + +   T +++
Sbjct: 64  ECVRIKPDWSKGHNRLGAAHYGLGDLDEAEESYKKALELDSSNKAAQDGLAQVQATQQQR 123

Query: 214 VEQ 216
           +EQ
Sbjct: 124 MEQ 126

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 90/203 (44%), Gaps = 14/203 (6%)

Query: 96  KAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAE 155
           KAE+ +LQG +   + D+  A+K YTE I+  P               L  + ++++D +
Sbjct: 387 KAEEARLQGKEYFTNADWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPDAIKDCD 446

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVE 215
            AI+ +P++ + Y R   A+ A+ +   A+E   T  + + +       R+ +    K  
Sbjct: 447 MAIQKDPNFVRAYIRKATAQIAVQEYAAAIETLDTAREKDAEVNNGSNTREIDQLYIKAT 506

Query: 216 QSLNLEKSVPTQTDEQESSTDAGAGASGFPDMASXXXXXXXXXXNNPQVMSAAQKLMQNP 275
           Q    ++  P   +  ES  +  A A   P++A+           +P + S   +  QNP
Sbjct: 507 Q----QRFQPANAN--ESPEETYARAVKDPEVAA--------ILQDPVMQSILSQAQQNP 552

Query: 276 GAMDEMMKNPAVRQMAENFSSGG 298
            A+ E MKNP V +  +   + G
Sbjct: 553 AALQEHMKNPQVFKKIQTLIAAG 575

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 70/156 (44%), Gaps = 12/156 (7%)

Query: 92  NTKAKAEDLKLQGNKAMASKDFETAIKKYTEA------IEVLPXXXXXXXXXXXXXXXLK 145
           N ++KAE+ K +GN+    + F+ AI  Y +A      I  L                +K
Sbjct: 249 NDRSKAEEAKAKGNELYKKRQFDEAIANYEKAWDLHKDITYLNNRAAAEYEKGDYESAIK 308

Query: 146 KYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGDKATDVMKR 205
             E++V++           +K ++RLG A Y L   ++A+E Y+  L     +  +V+ +
Sbjct: 309 TLEKAVEEGRELRADYKVIAKSFARLGNAHYKLADLKKAIEYYEKSLT--EHRTPEVLNK 366

Query: 206 ----DYETAKRKVEQSLNLEKSVPTQTDEQESSTDA 237
               + E  KR+ E  ++ EK+   +   +E  T+A
Sbjct: 367 LRSLEKEQKKREAEAYIDPEKAEEARLQGKEYFTNA 402

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 74/123 (60%), Gaps = 3/123 (2%)

Query: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIEVLPX-XXXXXXXXXXXXXXLKKYEESVQDAE 155
           A++ K QGN A A+KDFE AI+ +T+AIEV                   K++ ++++DA+
Sbjct: 3   ADEYKQQGNAAFAAKDFEKAIELFTKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDAK 62

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEG--DKATDVMKRDYETAKRK 213
             + +NP++SKGY+R+G A + LG  +EA + YK  L+++     A D +++ ++T + +
Sbjct: 63  QCVNINPAWSKGYNRVGAAHFGLGDLDEAEQGYKKALELDSANKAAQDGLEQVHKTQQSR 122

Query: 214 VEQ 216
            +Q
Sbjct: 123 QQQ 125

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 89/204 (43%), Gaps = 16/204 (7%)

Query: 96  KAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAE 155
           KAE+ +LQG +     D+  A+K YTE I+  P               L  + E+++D  
Sbjct: 392 KAEEARLQGKEYFTKGDWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCN 451

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVE 215
            AI  +P++ + Y R   A+ A+ +       + +V++   +  T   + +     R+++
Sbjct: 452 VAISKDPNFIRAYIRKATAQIAVRE-------FVSVIETLDEARTKDSQINNGANAREID 504

Query: 216 Q-SLNLEKSVPTQTDEQESSTDAGAGASGFPDMASXXXXXXXXXXNNPQVMSAAQKLMQN 274
           Q  +   +      D  ES   A A A   P++A+           +P + S  Q+  QN
Sbjct: 505 QLYIKASQQRFQPEDVNESPEQAYARAMKDPEVAN--------IMQDPVMQSILQQAQQN 556

Query: 275 PGAMDEMMKNPAVRQMAENFSSGG 298
           P A+ E MKNP V +  +   + G
Sbjct: 557 PAALQEHMKNPEVFKKIQTLIAAG 580

 Score = 33.5 bits (75), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 51/107 (47%), Gaps = 6/107 (5%)

Query: 92  NTKAKAEDLKLQGNKAMASKDFETAIKKYTEAIEV------LPXXXXXXXXXXXXXXXLK 145
           ++KAKA+  K +GNK   ++ F+ AI+ Y++A E+      L                +K
Sbjct: 254 SSKAKADAEKAEGNKFYKARKFDEAIEHYSKAWELHKDITYLNNRAAAEYEKGEYETAIK 313

Query: 146 KYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVL 192
              E+V+            SK ++R+G + + L + ++A+E Y+  L
Sbjct: 314 TLTEAVEQGRELRADYKVISKSFARIGNSYHKLNELKKAIEFYQKSL 360

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 106/237 (44%), Gaps = 50/237 (21%)

Query: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIEV--LPXXXXXXXXXXXXXXXLKKYEESVQDA 154
           A++ K +GN A  +KD++ AI  +T+AIEV   P                K+YE+++ DA
Sbjct: 5   ADEYKQEGNTAFVAKDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSS-KQYEQALSDA 63

Query: 155 ESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKV 214
           +  IK+NPS++KGY+R G A   L K EEA + Y   L I+ + A          AK  +
Sbjct: 64  DECIKINPSWAKGYTRKGAALQGLHKYEEAEQCYNETLKIDPNNA---------IAKDSL 114

Query: 215 EQSLNLEKSVPTQTDEQESSTDAGAGASGFPDMASXXXXXXXXXXNNPQVMSAAQKLMQN 274
            Q ++ ++S                 + GFP                P  M   + L ++
Sbjct: 115 AQIVSAQQS----------------ASRGFP-------------GGFPGDMGLGE-LFKD 144

Query: 275 PGAMDEMMKNPAVRQMAEN------FSSGGGTPN--LGDLMSNPAIKDMAKNLFGPN 323
           P  M+++ ++P V ++  +       +S G  P     D+M++P I  +   L G N
Sbjct: 145 PNLMEKLRRDPKVAELMNDQDFVAKINSYGNNPQALTNDMMTDPRIMQLFGALLGLN 201

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 46/203 (22%), Positives = 86/203 (42%), Gaps = 18/203 (8%)

Query: 96  KAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAE 155
           KAE+ +L+G +     D+  A+K YTE I+  P               L  + +++ D  
Sbjct: 384 KAEEARLEGKEYFTKADWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDCN 443

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVE 215
            AI+ +PS+ + Y R    + A+ +   A+E      + +  K  + + + Y  A     
Sbjct: 444 KAIEKDPSFIRAYLRKATCQIAVKEFAGAIETLDLARERDDGKNGNEINQLYAKA----- 498

Query: 216 QSLNLEKSVPTQTDEQESSTDAGAGASGFPDMASXXXXXXXXXXNNPQVMSAAQKLMQNP 275
              + ++  P + +E    T A A     P++A            +P ++S  Q+   +P
Sbjct: 499 ---SAQRFQPAEGNETPEETYARAMKD--PEVAK--------IMQDPVMVSILQQAQNDP 545

Query: 276 GAMDEMMKNPAVRQMAENFSSGG 298
            A+ E MKNP V +  +   + G
Sbjct: 546 AALQEHMKNPEVFRKIQTLIAAG 568

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 39/101 (38%), Positives = 64/101 (63%), Gaps = 3/101 (2%)

Query: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIEV--LPXXXXXXXXXXXXXXXLKKYEESVQDA 154
           A++ K QGN A  +KD+  AI  +T+AIEV   P                KK+EE+++DA
Sbjct: 3   ADEFKQQGNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASN-KKFEEALKDA 61

Query: 155 ESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIE 195
           E  +K++PS+SKGY+R+G A++ L + +EA ++YK  L+++
Sbjct: 62  EECVKISPSWSKGYNRVGAAQFGLSQLDEAEKSYKRALELD 102

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 85/195 (43%), Gaps = 20/195 (10%)

Query: 96  KAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAE 155
           KAE+ +LQG +     D+  A+K YTE ++  P               L  + E+++D  
Sbjct: 379 KAEEARLQGKEFFTKGDWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDCN 438

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVL--DIEGDKATDVMKRDYETAKRK 213
            A+ ++P++ + Y R   A+ A+ +   A+E        D + +K  +V + D   AK  
Sbjct: 439 KAVSIDPNFVRAYIRKATAQIAVKEFAAAIETLNIAREKDAQVNKGANVREIDQLHAKAS 498

Query: 214 VEQ-SLNLEKSVPTQTDEQESSTDAGAGASGFPDMASXXXXXXXXXXNNPQVMSAAQKLM 272
            ++     +   P QT E+         A   P++AS           +P + S   +  
Sbjct: 499 SQRFQPASDNETPEQTYER---------AMRDPEVAS--------IMKDPVMQSILSQAQ 541

Query: 273 QNPGAMDEMMKNPAV 287
           Q+P A+ E +KNP V
Sbjct: 542 QDPAALQEHIKNPEV 556

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 48/110 (43%), Gaps = 6/110 (5%)

Query: 89  EDANTKAKAEDLKLQGNKAMASKDFETAIKKYTEAIEV------LPXXXXXXXXXXXXXX 142
           E+ N++  AE  K +GNK   ++ FE AI+ Y +A E+      L               
Sbjct: 238 EEPNSRVAAEAEKAEGNKLYKARQFEEAIEHYNKAWELHKDITYLNNRSAAEFEKGDYDT 297

Query: 143 XLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVL 192
            +K   ++V+          + +K ++R+G A Y L    +A+E Y   L
Sbjct: 298 AIKTLNDAVEQGRELRADYKTIAKSFARIGNAYYKLKDLRKAIEHYNRSL 347

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 39/101 (38%), Positives = 59/101 (58%), Gaps = 1/101 (0%)

Query: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIEVLPX-XXXXXXXXXXXXXXLKKYEESVQDAE 155
           A++ K QGN A  +KD++ AI+ +T+AIEV                  LKK+ +++ DA 
Sbjct: 5   ADEYKQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDAN 64

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEG 196
             +K+NPS+SKGY+RLG A   LG  +EA   YK  L+++ 
Sbjct: 65  ECVKINPSWSKGYNRLGAAHLGLGDLDEAESNYKKALELDA 105

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 92/208 (44%), Gaps = 24/208 (11%)

Query: 96  KAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAE 155
           KAE+ +L+G +     D+  A+K YTE I+  P               L  + E++ D  
Sbjct: 395 KAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCN 454

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVL--DIE---GDKATDVMKRDYETA 210
            AI+ +P++ + Y R   A+ A+ +   ALE        D E   G  A ++ +  Y+ +
Sbjct: 455 KAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGSSAREIDQLYYKAS 514

Query: 211 KRKVEQSLNLEKSVPTQTDEQESSTDAGAGASGFPDMASXXXXXXXXXXNNPQVMSAAQK 270
           +++ +   + E   P +T ++         A   P++A+           +P + S  Q+
Sbjct: 515 QQRFQPGTSNE--TPEETYQR---------AMKDPEVAA--------IMQDPVMQSILQQ 555

Query: 271 LMQNPGAMDEMMKNPAVRQMAENFSSGG 298
             QNP A+ E MKNP V +  +   + G
Sbjct: 556 AQQNPAALQEHMKNPEVFKKIQTLIAAG 583

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 101/228 (44%), Gaps = 42/228 (18%)

Query: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIEVLPX-XXXXXXXXXXXXXXLKKYEESVQDAE 155
           A++ K QGN A  +KD++ AI  +++AI+V                  LKK+  +++DAE
Sbjct: 5   ADEYKQQGNAAFVAKDYDKAIDLFSKAIDVSEQPNHVLYSNRSACYTSLKKFVNALKDAE 64

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVE 215
             +K+NPS+SKGY+R+G A + +G  +EA   YK  L+++              A  K  
Sbjct: 65  ECVKINPSWSKGYNRVGAAHFGMGDLDEAEAGYKKALELD--------------ASNKAA 110

Query: 216 QSLNLEKSVPTQTDEQESSTDAGAGASGFPDMASXXXXXXXXXXNNPQVMSAAQKLMQNP 275
           Q   LE+   TQ   +           G PDM            N+P ++   + L +NP
Sbjct: 111 QE-GLEQVHRTQESRR-----------GMPDMG------LTQMFNDPNLI---ENLKKNP 149

Query: 276 GAMDEMMKNPAVRQMAENFSSGGGTPNL--GDLMSNPAIKDMAKNLFG 321
               EMMK+P   Q+          P     DL ++P +  +   L G
Sbjct: 150 KTA-EMMKDP---QLVAKLIQYRSNPQAISQDLFTDPRLMTIMATLMG 193

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 55/212 (25%), Positives = 89/212 (41%), Gaps = 16/212 (7%)

Query: 88  AEDANTKAKAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKY 147
           AED     KAE+ +L+G       D+  A+K YTE I+  P               L  +
Sbjct: 388 AEDYINPEKAEEARLEGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAVLSKLMSF 447

Query: 148 EESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGDKATDVMKRDY 207
            E++ D   AI+ +P++ + Y R   A+ A+ +   ALE     LD    K  +V K   
Sbjct: 448 PEAIDDCNKAIEKDPNFVRAYIRKATAQIAVREFSSALE----TLDAARSKDAEVNK--- 500

Query: 208 ETAKRKVEQ-SLNLEKSVPTQTDEQESSTDAGAGASGFPDMASXXXXXXXXXXNNPQVMS 266
               R+++Q  +   +      D  ES       A   P++A+           +P + S
Sbjct: 501 SANTREIDQLYIKASQQRFQPNDSNESPEQTYERAMKDPEVAA--------IMQDPVMQS 552

Query: 267 AAQKLMQNPGAMDEMMKNPAVRQMAENFSSGG 298
             Q+  QNP A+ E MKNP + +  +   + G
Sbjct: 553 ILQQAQQNPAALQEHMKNPEIFKKIQTLIASG 584

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 39/101 (38%), Positives = 59/101 (58%), Gaps = 1/101 (0%)

Query: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIEVLPX-XXXXXXXXXXXXXXLKKYEESVQDAE 155
           A++ K QGN A  +KD++ AI+ +T+AIEV                  LKK+ +++ DA+
Sbjct: 5   ADEYKQQGNSAFTAKDYDKAIELFTKAIEVSKTPNHVLYSNRSACYASLKKFSDALNDAK 64

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEG 196
             I +NPS+SKGY+RLG A   LG  +EA   YK  L+++ 
Sbjct: 65  ECININPSWSKGYNRLGAAHLGLGDLDEAENNYKKALELDA 105

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 83/203 (40%), Gaps = 14/203 (6%)

Query: 96  KAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAE 155
           KAE+ +L+G       D+  A+K YTE I+  P               L  + E++ D  
Sbjct: 395 KAEEARLEGKDYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCN 454

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVE 215
            AI+ +P++ + Y R   A+ A+ +   ALE        + D       R+ +    K  
Sbjct: 455 KAIEKDPNFVRAYIRKATAQIAVQEYAAALETLDAARTKDADVNNGASSREIDQLYYKAS 514

Query: 216 QSLNLEKSVPTQTDEQESSTDAGAGASGFPDMASXXXXXXXXXXNNPQVMSAAQKLMQNP 275
           Q    ++  P   +E    T   A     P++A+           +P + S  Q+  QNP
Sbjct: 515 Q----QRFQPGTGNETPEETYQRAMKD--PEVAA--------IMQDPVMQSILQQAQQNP 560

Query: 276 GAMDEMMKNPAVRQMAENFSSGG 298
            A+ E MKNP V +  +   + G
Sbjct: 561 AALQEHMKNPEVFKKIQTLIAAG 583

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 70.5 bits (171), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 73/128 (57%), Gaps = 4/128 (3%)

Query: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIEVLPX-XXXXXXXXXXXXXXLKKYEESVQDAE 155
           A++ K QGN A  +K+++ AI+ +T+AIEV                  LKK+ +++ DA 
Sbjct: 5   ADEYKQQGNAAFTAKNYDGAIELFTKAIEVSETPSHVLFSNRSACYTSLKKFSDALNDAN 64

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGDK--ATDVMKRDYETAK-R 212
             +K+NPS+SKGY+RLG A   LG  +EA   YK  L+++ +   A D +++ + T + R
Sbjct: 65  ECVKINPSWSKGYNRLGAAHLGLGDLDEAESDYKKALELDANNKAAKDGLEQVHRTQQAR 124

Query: 213 KVEQSLNL 220
           + +  L L
Sbjct: 125 QAQPDLGL 132

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 88/203 (43%), Gaps = 14/203 (6%)

Query: 96  KAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAE 155
           KAE+ +L+G +     D+  A+K YTE I+  P               L  + E++ D  
Sbjct: 395 KAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCN 454

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVE 215
            AI+ +P++ + Y R+  A+ A+ +   ALE     LD+   K  +V K     + ++++
Sbjct: 455 KAIEKDPNFVRAYIRMAAAQIAVKEFAAALE----TLDVARTKDAEVNKG---ASAKEID 507

Query: 216 QSLNLEKSVPTQTDEQESSTDAGAGASGFPDMASXXXXXXXXXXNNPQVMSAAQKLMQNP 275
           Q       +  +  +Q    D G+         +           +P + S  Q+  QNP
Sbjct: 508 Q-------LYYKASQQRFQPDTGSETPEETYQRAMKDPEVAAIMQDPVMQSILQQAQQNP 560

Query: 276 GAMDEMMKNPAVRQMAENFSSGG 298
            A+ E MKNPAV +  +   + G
Sbjct: 561 AALQEHMKNPAVFKKIQTLIAAG 583

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 68/145 (46%), Gaps = 16/145 (11%)

Query: 80  EPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXX 139
           EP++V+   ED N+KA+A++ K +GNK   +  F+ AI+ Y  A E L            
Sbjct: 249 EPMEVD---ED-NSKAEADNEKAEGNKFYKAHQFDEAIEHYNRAWE-LHKDITYLNNRAA 303

Query: 140 XXXXLKKYEESVQDAESAIK----VNPSY---SKGYSRLGFAKYALGKPEEALEAYKTVL 192
                  YE  +     A++    +   Y   SK ++R+G A + LG  ++ +E Y+  L
Sbjct: 304 AEYEKGDYETVIATLNDAVEKGRDMRADYKVISKSFARIGNAYHKLGDLKKTIEYYQKSL 363

Query: 193 DIEGDKATDVMK--RDYETAKRKVE 215
                +  D++   R+ E  ++K E
Sbjct: 364 T--EHRTADILAKLRNVEKEQKKAE 386

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 60/100 (60%), Gaps = 1/100 (1%)

Query: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKK-YEESVQDAE 155
           A+  K +GN+A ASKD+  AI+ +T+AIEV                   K + +++ DA 
Sbjct: 3   ADQFKQEGNQAFASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASNKDFVKALDDAN 62

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIE 195
             +K+NPS++KGY+RLG A Y LG  +EA ++YK  L+++
Sbjct: 63  ECVKINPSWAKGYNRLGAAHYGLGDLDEAEQSYKKALELD 102

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 89/203 (43%), Gaps = 14/203 (6%)

Query: 96  KAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAE 155
           KAE+ +LQG +     D+  A++ YTE I+  P               L  + ++++D +
Sbjct: 388 KAEEARLQGKEYFTKADWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIRDCD 447

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVE 215
            AI+ +P++ + Y R    + A+     A+E   +    + +  +    R+ +    K  
Sbjct: 448 KAIEKDPNFVRAYIRKATGQIAIKDYAGAIETLDSARTKDAEVNSGANTREIDQLYIKAS 507

Query: 216 QSLNLEKSVPTQTDEQESSTDAGAGASGFPDMASXXXXXXXXXXNNPQVMSAAQKLMQNP 275
           Q+   E +   +T E+     A A A+  P++AS           +P + S   +  QNP
Sbjct: 508 QA-RFEPANANETPEE-----AYARATKDPEVAS--------ILQDPVMQSILSQAQQNP 553

Query: 276 GAMDEMMKNPAVRQMAENFSSGG 298
            A+ E M+NP V +  +   + G
Sbjct: 554 AALQEHMRNPDVFKKIQTLIAAG 576

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 53/113 (46%), Gaps = 8/113 (7%)

Query: 87  PAEDANTKAKAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKK 146
           P E  + K+KAE  K +GNK    + F+ AI+KY EA E                     
Sbjct: 245 PMEVDDDKSKAEAAKAEGNKLYKQRKFDEAIEKYNEAWETH-NDITYLNNRAAAEYEKGD 303

Query: 147 YEESVQDAESAI----KVNPSY---SKGYSRLGFAKYALGKPEEALEAYKTVL 192
           YE +++    A+    ++   Y   SK ++R+G + + LG  ++A++ Y+  L
Sbjct: 304 YEAAIETLTKAVEQGRELRADYKVISKSFARMGNSYHKLGDLKKAIDYYEKSL 356

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 62/100 (62%), Gaps = 1/100 (1%)

Query: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKK-YEESVQDAE 155
           A++ K QGN A  +K+++ AI+K+T+AIEV                  KK + + ++DA 
Sbjct: 5   AQEYKDQGNAAFVAKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLEDAN 64

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIE 195
             +K+NP++SKGY+R+G A + +G  +EA +AYK  L+++
Sbjct: 65  ECVKINPTWSKGYNRVGAAHFGMGDLDEAEKAYKKALELD 104

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 54/208 (25%), Positives = 92/208 (44%), Gaps = 24/208 (11%)

Query: 96  KAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAE 155
           KAE+ +L+G +     D+  A+K YTE I   P               L  + E++ D  
Sbjct: 388 KAEEARLEGKEYFTKGDWPNAVKAYTEMIARDPSDARGYSNRAAALSKLMSFPEAITDCN 447

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGK--PE-EALEAYKTVLDIEGDKATDVMKRD--YETA 210
           +AI+ +P++ + Y R   A+ A+    P  E L+A +T  D E +   +  + D  Y  A
Sbjct: 448 TAIEKDPNFIRAYIRKATAQIAIKDFVPAIETLDAARTK-DAELNNGANSREIDQLYLKA 506

Query: 211 KRKVEQSLNLEKSVPTQTDEQESSTDAGAGASGFPDMASXXXXXXXXXXNNPQVMSAAQK 270
            ++  Q  N  ++ P QT E+         A   P++A+           +P + S  Q+
Sbjct: 507 NQQRFQPSNANET-PEQTYER---------AMKDPEVAA--------IMQDPVMQSILQQ 548

Query: 271 LMQNPGAMDEMMKNPAVRQMAENFSSGG 298
              NP A+ E MKNP + +  +   + G
Sbjct: 549 AQTNPAALQEHMKNPEIFKKIQTLIAAG 576

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 57/101 (56%), Gaps = 1/101 (0%)

Query: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIEVLPX-XXXXXXXXXXXXXXLKKYEESVQDAE 155
           A++ K QGN A  +KD+  AI  +T+AIEV                  LKK+ +++ DA 
Sbjct: 5   ADEYKQQGNAAFTAKDYGKAIDLFTKAIEVSEAPNHVLYSNRSACYTSLKKFTDALNDAT 64

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEG 196
             +K+NPS+SKGY+RLG A   LG  ++A   YK  L+++ 
Sbjct: 65  ECVKINPSWSKGYNRLGAAHLGLGDLDDAESNYKKALELDA 105

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 90/208 (43%), Gaps = 24/208 (11%)

Query: 96  KAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAE 155
           KAE+ +L+G +     D+  A+K YTE I+  P               L  + E++ D  
Sbjct: 392 KAEEARLEGKEYFTKSDWPNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADCN 451

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVL--DIE---GDKATDVMKRDYETA 210
            AI+ +P++ + Y R   A+ A+ +   ALE        D E   G  A ++ +  Y+ +
Sbjct: 452 KAIEKDPNFVRAYIRKATAQIAVQEFAGALETLDAARTKDAEVNNGASAKEIDQLYYKAS 511

Query: 211 KRKVEQSLNLEKSVPTQTDEQESSTDAGAGASGFPDMASXXXXXXXXXXNNPQVMSAAQK 270
           +++ +         P +T ++         A   P++A+           +P + S  Q+
Sbjct: 512 QQRFQSGTG--NDSPEETYQR---------AMKDPEVAA--------IMQDPVMQSILQQ 552

Query: 271 LMQNPGAMDEMMKNPAVRQMAENFSSGG 298
             QNP A+ E MKNP V +  +   + G
Sbjct: 553 AQQNPAALQEHMKNPEVYKKIQTLIASG 580

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 73/155 (47%), Gaps = 14/155 (9%)

Query: 78  QSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXX 137
           ++EP++V+   ED ++K +A+  K +GNK   ++ FE AI+ Y +A E L          
Sbjct: 244 EAEPMEVD---ED-DSKVEADKEKAEGNKFYKARQFEEAIEHYNKAWE-LHRDITYLNNR 298

Query: 138 XXXXXXLKKYEESVQDAESAI----KVNPSY---SKGYSRLGFAKYALGKPEEALEAYKT 190
                    YE ++     A+    ++   Y   SK ++R+G A + LG  ++ ++ Y+ 
Sbjct: 299 AAAEYEKGDYETAIATLTDAVEQGREMRADYKVISKSFARIGNAYHKLGDLKKTIDNYQK 358

Query: 191 VL--DIEGDKATDVMKRDYETAKRKVEQSLNLEKS 223
            L      D  T +   + E  K + E  +N EK+
Sbjct: 359 SLTEHRTADILTKLRNAEKELKKAEAEAYINPEKA 393

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 60/100 (60%), Gaps = 1/100 (1%)

Query: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIEVLPX-XXXXXXXXXXXXXXLKKYEESVQDAE 155
           A++ K QGN A  +KD+E A + + +AI+V                  LKK+ E ++DAE
Sbjct: 4   ADEYKQQGNAAFVAKDYEKAAELFGKAIDVSEQPNHVLYSNRSACYTSLKKFAEGLKDAE 63

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIE 195
             +K+NP +SKGY+R+G A++ L   E+A ++Y+  L+++
Sbjct: 64  ECVKINPGWSKGYNRVGAAQFGLNNLEDAEKSYQKALELD 103

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 88/203 (43%), Gaps = 14/203 (6%)

Query: 96  KAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAE 155
           KAE+ +L+G +  +  D+  A+K YTE I+  P               L  + E++ D +
Sbjct: 381 KAEEARLEGKEYFSKADWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIADCD 440

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVE 215
            AI+ +P++ + Y R   A+ A+ +   A+E   TV   + +       R+ +    K  
Sbjct: 441 RAIEKDPNFIRAYIRKASAQIAVKEFAAAVETLDTVRTKDSELNNGANAREIDQLYIKA- 499

Query: 216 QSLNLEKSVPTQTDEQESSTDAGAGASGFPDMASXXXXXXXXXXNNPQVMSAAQKLMQNP 275
              N ++  P   +E    T   A     P++A+           +P + S  Q+  QNP
Sbjct: 500 ---NNQRFQPEDVNENPEQTYQRAMKD--PEVAA--------IMQDPVMQSILQQAQQNP 546

Query: 276 GAMDEMMKNPAVRQMAENFSSGG 298
            A+ E M+NP V +  +   + G
Sbjct: 547 AALQEHMQNPDVFRKIQTLIAAG 569

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 61/229 (26%), Positives = 102/229 (44%), Gaps = 44/229 (19%)

Query: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIEV--LPXXXXXXXXXXXXXXXLKKYEESVQDA 154
           A++ K QGN A A+K ++ A+  +T+AIEV   P                +K+ E+++DA
Sbjct: 5   ADEYKQQGNSAFAAKKYDEAVDLFTKAIEVSETPNHVLYSNRSASYASE-QKFNEALKDA 63

Query: 155 ESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKV 214
               K+NPS++KGY+R G A + +G  ++A  +YK  L+++ +          + AK  +
Sbjct: 64  LECTKINPSWAKGYTREGAAHFGMGNLDDAEASYKKALELDANN---------KIAKEGI 114

Query: 215 EQSLNLEKSVPTQTDEQESSTDAGAGASGFPDMASXXXXXXXXXXNNPQVMSAAQKLMQN 274
           EQ   ++     Q D             G  +M            N+P ++   +KL  N
Sbjct: 115 EQIQRVQSQRQAQPD------------LGLTEM-----------FNDPNLI---EKLKNN 148

Query: 275 PGAMDEMMKNPAVRQMAENFSSGGGTPN--LGDLMSNPAIKDMAKNLFG 321
           P    E+M +P   Q+     S    PN    DL S+P +  +   L G
Sbjct: 149 PKTA-ELMNDP---QLVAKLLSFRSNPNGLAQDLFSDPRLMTIMGTLMG 193

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 92/209 (44%), Gaps = 26/209 (12%)

Query: 96  KAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAE 155
           KAE+ +L+G +     D+ +A+K YTE I+  P               L  + +++ D  
Sbjct: 384 KAEEARLEGKEYFTKGDWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDCN 443

Query: 156 SAIKVNPSYSKGYSRLGFAKYAL---GKPEEALEAYKTVLDIE---GDKATDVMKRDYET 209
            AI+ +P++ + Y R   A+ A+       E L+A +T  D E   G  A ++ +   + 
Sbjct: 444 KAIEKDPNFVRAYIRKATAQIAVKDFSYAIETLDAARTK-DAEVNGGANAREIDQLYMKA 502

Query: 210 AKRKVEQSLNLEKSVPTQTDEQESSTDAGAGASGFPDMASXXXXXXXXXXNNPQVMSAAQ 269
           A+++ + +   E   P QT E+         A   P++A            +P + S  Q
Sbjct: 503 AQQRFQPATGDE--TPEQTYER---------AMRDPEVAK--------IMQDPVLQSILQ 543

Query: 270 KLMQNPGAMDEMMKNPAVRQMAENFSSGG 298
           +   +P A+ E MKNP + +  +   + G
Sbjct: 544 QAQNDPAALQEHMKNPEIFKKIQTLIAAG 572

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 59/124 (47%), Gaps = 8/124 (6%)

Query: 76  PTQSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXX 135
           P ++EP   ++  +   +K  AE+ K++GNKA  +++F+ AI  Y +A E L        
Sbjct: 230 PKEAEPEAESMDVDQDESKVAAEEAKVEGNKAYKARNFDEAIACYNKAWE-LDNNITYLN 288

Query: 136 XXXXXXXXLKKYEESVQDAESAI----KVNPSY---SKGYSRLGFAKYALGKPEEALEAY 188
                     +Y+ ++     AI    ++   Y   +K ++R+G A   +G  +EA+  Y
Sbjct: 289 NRSAAEFEKGEYDTAINTLNEAIEKGREMRADYKIIAKSFARIGNAYVKMGNLKEAINHY 348

Query: 189 KTVL 192
           +  L
Sbjct: 349 QKSL 352

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 58/101 (57%), Gaps = 1/101 (0%)

Query: 97  AEDLKLQGNKAMASKDFETAIKKYTEAI-EVLPXXXXXXXXXXXXXXXLKKYEESVQDAE 155
           AE+ K +GN A  +KDF+ A++ +T AI E                  LKK++E++ DA 
Sbjct: 4   AEEYKKEGNAAFVAKDFKRAVELFTNAIQESEEPNHVLYSNRSGAYASLKKFDEALSDAT 63

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEG 196
             +K+   +SKG++RLG A + LG  +EA E+YK  L+++ 
Sbjct: 64  ECVKIKADWSKGHNRLGAAHFGLGNLDEAEESYKKALELDA 104

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 93/206 (45%), Gaps = 20/206 (9%)

Query: 96  KAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAE 155
           KAE  +L G +     D+ +A+K Y+E I   P               L  + ++++D +
Sbjct: 391 KAEKARLDGKEYFTKGDWPSAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIKDCD 450

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVE 215
            AI+++PS+ + Y R   A+ A+ +   A+E     LD+   K  +V   +  ++ R+++
Sbjct: 451 KAIEIDPSFVRAYIRKATAQIAVQEYSAAIE----TLDVARTKDAEV---NNGSSIREID 503

Query: 216 Q---SLNLEKSVPTQTDEQESSTDAGAGASGFPDMASXXXXXXXXXXNNPQVMSAAQKLM 272
           Q       ++  P  T+E    T A A     P++AS           +P + S   +  
Sbjct: 504 QLYVKATQQRFQPANTNESPEETYARAVKD--PEVAS--------ILQDPVMQSILAQAQ 553

Query: 273 QNPGAMDEMMKNPAVRQMAENFSSGG 298
           QNP A+ E MKNP V +  +   + G
Sbjct: 554 QNPAALQEHMKNPEVFKKMQTLIAAG 579

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/214 (26%), Positives = 90/214 (42%), Gaps = 23/214 (10%)

Query: 77  TQSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKKYTEA------IEVLPXX 130
           T  EP++V++  E+A  KAKAE     GN+    + F+ AI KY EA      I  L   
Sbjct: 244 TPPEPMEVDLDRENAE-KAKAE-----GNQLYKQRKFDEAIAKYEEAWNLQKDITYLNNR 297

Query: 131 XXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKT 190
                        +K   E+V+            +K ++RLG A Y L + ++A+E Y+ 
Sbjct: 298 AAAEYEKGDYNSAIKTLNEAVEQGRELRADYKVIAKSFARLGNAYYKLDEVKKAVEYYEK 357

Query: 191 VLDIEGDKATDVMKR----DYETAKRKVEQSLNLEKSVPTQTDEQESST--DAGAGASGF 244
            L     +  DV+ +    + E  KR+ E  ++ EK+   + D +E  T  D  +    +
Sbjct: 358 SLT--EHRTPDVLNKLRNLEREIKKREAEAYIDPEKAEKARLDGKEYFTKGDWPSAVKAY 415

Query: 245 PDMASXXXXXXXXXXNNPQVMSAAQKLMQNPGAM 278
            +M            N    +S   KLM  P A+
Sbjct: 416 SEMIMRAPHDARGYSNRAAALS---KLMSFPDAI 446

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 54/105 (51%), Gaps = 1/105 (0%)

Query: 91  ANTKAKAEDLKLQGNKAMASKDFETAIKKYTEAI-EVLPXXXXXXXXXXXXXXXLKKYEE 149
           +N    +++LK  GNK    K +E A+  +T A+ +                  LK Y E
Sbjct: 2   SNVSMSSQELKELGNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAE 61

Query: 150 SVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDI 194
           +++D ++ +++ P++ KGYSR+G A   L K +EA E +K  L +
Sbjct: 62  ALEDGKNCVELAPNWDKGYSRVGVAYLGLQKLDEAEENFKKALQL 106

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 88/207 (42%), Gaps = 23/207 (11%)

Query: 96  KAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAE 155
           K E+ +++G +   ++++  A+K YTE I+  P               L    + + D +
Sbjct: 428 KFEEARIEGKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCD 487

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVE 215
            AI V+PSY K Y R GFA+      +EALE +++     GD A    K+ +   K ++ 
Sbjct: 488 KAISVDPSYIKAYVRKGFAQITERDLDEALETWES-----GDAAN---KKYHGNEKNELL 539

Query: 216 QSLN----LEKSVPTQTDEQESSTDAGAGASGFPDMASXXXXXXXXXXNNPQVMSAAQKL 271
           +SL+     E   P +   Q +  +  A A   P++            N+P +     + 
Sbjct: 540 ESLHSKVLFEIHRPKR---QGTREEIRAKAMQVPEVVE--------ALNDPVLKDLLMQS 588

Query: 272 MQNPGAMDEMMKNPAVRQMAENFSSGG 298
             NP A++E M N  +    +     G
Sbjct: 589 QTNPSALEEHMDNADIMNKMQTLMRHG 615

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 66/160 (41%), Gaps = 14/160 (8%)

Query: 47  ERDAVSEIVKNSFDNRKLDELLKSAATALPTQSEPVKVNIPAEDANTKAKAEDLKLQGNK 106
           ER A  E  + SF    ++E ++    +     E  +  +  E+   K +A++ K  GN 
Sbjct: 247 ERKANGEAPEMSFTEPDMNEDIRKHVRS--QMKEKSQQKLSPEETEKKRRADEEKRIGND 304

Query: 107 AMASKDFETAIKKYTEA------IEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKV 160
               ++F+ AI  YT+A      I  L                LK   ++V  AE     
Sbjct: 305 LYKKRNFKEAIIHYTKAWNTFQDITYLNNIGAAQFERGDYGNVLKSLGQAVFFAEH---T 361

Query: 161 NPS---YSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGD 197
           NP     +K Y R+G A + +   E A+ AY+  L + G+
Sbjct: 362 NPEPQVLAKSYIRMGNAYHRIWDHEHAITAYEYGLMLNGN 401

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 79/169 (46%), Gaps = 12/169 (7%)

Query: 87  PAEDANTKAKAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKK 146
           P  D+ T A A D K +GN+ + +KD+  A++ YT AIE                  L +
Sbjct: 28  PRRDSMTAATALDYKNEGNEWVKAKDYARAVEAYTRAIEADGTQSIFFSNRALANLKLDR 87

Query: 147 YEESVQDAESAIKVNPSYSKGYSRLGFAKYAL---GKPEEALEAYKTVLDIEGDKATDVM 203
           ++ +++D+  AI+++    K Y R G A   L   G  +  LE    V    GD+A   +
Sbjct: 88  FQSALEDSARAIELDAGNVKAYHRRGLAHCGLLEWGPAKRDLEV--VVRAKPGDEA---V 142

Query: 204 KRDYETAKRKVEQSLNLEKSVPTQTDEQE---SSTDAGAGASGFPDMAS 249
           +R  E  +R + +    E+++    DE++     T + A  +G  D+AS
Sbjct: 143 RRALEVCERMLRRE-RFERAIRADGDEEQRRLCKTLSLASFAGNADLAS 190

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 67/137 (48%), Gaps = 3/137 (2%)

Query: 96  KAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAE 155
           +A + K QGNK +ASKD+  AI+ YT+AIE+                 L +++ +++D+ 
Sbjct: 8   EALEYKDQGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSS 67

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVE 215
            AI+++ S  KGY R G A   L     A    + VL ++  +AT   KR     +R + 
Sbjct: 68  KAIELDSSNVKGYHRRGMAYAGLQDFISAKRDLEVVLRVKPGEAT--AKRTLLACERMIR 125

Query: 216 QSLNLEKSVPTQTDEQE 232
           +    EK++      +E
Sbjct: 126 RE-RFEKAIRASGGNEE 141

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 55/121 (45%), Gaps = 4/121 (3%)

Query: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAES 156
           A   K +GNK +  +DF+ A + YT+AIE  P               L  +  ++ D  +
Sbjct: 9   ATSYKDEGNKFLKQQDFQRANELYTKAIETDPTQSIFYSNRALANLKLDNFMNALNDCTN 68

Query: 157 AIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGDKATDVM-KRDYETAKRKVE 215
           AI++N S  K Y R G A   L   + A   +  VL     K  D++ K  ++T ++ + 
Sbjct: 69  AIELNSSNLKAYHRRGLANIGLLNFKSARNDFNIVLKY---KPNDIIAKNGFDTCEKVIR 125

Query: 216 Q 216
           +
Sbjct: 126 E 126

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 49/98 (50%)

Query: 95  AKAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDA 154
           AKA + K +GN A+ ++D+  AI+ YTEAI++                 +  ++  + D 
Sbjct: 10  AKALEFKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDC 69

Query: 155 ESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVL 192
           + A++++P   K Y R G +   L + + A +  K VL
Sbjct: 70  DKALEIDPKNIKAYHRRGMSYIGLLEFKNAQKDLKIVL 107

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 78/206 (37%), Gaps = 16/206 (7%)

Query: 88  AEDANTKAKAEDLKLQGNKAMASKDFETAIKKYTEAIEV----LPXXXXXXXXXXXXXXX 143
           A D      AE+ K QGN     K F  A   Y + IEV                     
Sbjct: 68  AYDGEPHEVAENFKNQGNDLYKVKRFRDARVMYNKGIEVKCDDAGISELLLLNRAACELE 127

Query: 144 LKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEA--YKTVLDIEGDKATD 201
           LK Y   + D   A+K+NP   K + R+G A   L K EEA EA  +   +D E +    
Sbjct: 128 LKNYRRCINDCREALKLNPKNPKAFFRIGKAFLQLDKLEEAAEAVDFGLRVDTENEALLS 187

Query: 202 VMKRDYETAKRKVEQSLNLEKSVPTQTDEQESSTDAGAGASGFPDMASXXXXXXXXXXNN 261
           ++    +  K + E    LE S   + +   S  +A         +AS            
Sbjct: 188 LLSAISKKQKARHEHEQKLE-SRRKEMERLASILEAAMAIRNIHMIAS---------KQR 237

Query: 262 PQVMSAAQKLMQNPGAMDEMMKNPAV 287
           P ++ AA+  + NP  ++  +  PA+
Sbjct: 238 PDLLEAAKIKLDNPEDIESQLIFPAM 263

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 41/83 (49%)

Query: 96  KAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAE 155
           +A DLK +GNK +  K +  A++ YT+AIE+                 L  ++  + D  
Sbjct: 12  QAIDLKNEGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCLDDCN 71

Query: 156 SAIKVNPSYSKGYSRLGFAKYAL 178
           SA++++P   K Y R G ++  L
Sbjct: 72  SALELDPKNIKAYHRRGLSQLGL 94

>TBLA0F03220 Chr6 complement(782214..783824) [1611 bp, 536 aa] {ON}
           Anc_3.395 YPR088C
          Length = 536

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 36/65 (55%), Gaps = 5/65 (7%)

Query: 261 NPQVMSAAQ-KLMQNPGAMDEMMKNPAVRQMAENFSSGGGTPNLGD---LMSNPAIKDMA 316
           +PQ+M  AQ +L QNPG M+ MM             S GG PN+ D   +M +P +++MA
Sbjct: 472 SPQMMQQAQQRLRQNPGMMENMMNMFGGAGGMPGMGSAGGMPNMNDMMKMMQDPKMQEMA 531

Query: 317 KNLFG 321
           +  FG
Sbjct: 532 RQ-FG 535

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 46/103 (44%), Gaps = 4/103 (3%)

Query: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXX----XXXXXXXLKKYEESVQ 152
           AE+ K Q N     K F  A + YT+ I+V                     LK Y   V 
Sbjct: 85  AENFKNQANDLYKVKRFRDARELYTKGIKVFCEDKSINESLFANRAACELELKNYRSCVA 144

Query: 153 DAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIE 195
           D + A+++NP   K + R+G A  ALGK +EA +A    L I+
Sbjct: 145 DCQKAMEINPMNLKCFYRMGKAFLALGKFKEAHDAVSFGLKID 187

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 44/86 (51%), Gaps = 1/86 (1%)

Query: 100 LKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIK 159
           LK +GN+   +KDFE AI+ YT AI  L                +  +E+ V+D  +A+K
Sbjct: 107 LKDKGNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSINNFEKVVEDTTAALK 165

Query: 160 VNPSYSKGYSRLGFAKYALGKPEEAL 185
           + P YSK + R   A   LG+  +A+
Sbjct: 166 LKPDYSKCWLRRASAYENLGQFSDAM 191

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 58/137 (42%), Gaps = 19/137 (13%)

Query: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIE----VLPXXXXXXXXXXXXXXXLKKYEESVQ 152
           AE+ K QGN     K F  A + YT+ IE    V                 LK +   + 
Sbjct: 78  AENFKNQGNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNFRSCIS 137

Query: 153 DAESAIKVNPSYSKGYSRLGFAKYALGKPEEALE-------------AYKTVLDIEGDKA 199
           D ++A+  NP   K Y R+G A  A+ K E A E             +++ +L+I  +K 
Sbjct: 138 DCKTALTYNPKNIKCYFRMGKAFTAINKFESARESIEFGQKIDNDNKSFENLLNIIKNKE 197

Query: 200 TDVMKRDYETAKRKVEQ 216
            ++  R YE  K K +Q
Sbjct: 198 EEI--RKYEEKKLKAQQ 212

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 54/116 (46%), Gaps = 5/116 (4%)

Query: 95  AKAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDA 154
           A+A  LK +GN  +  +DF  AI  YT+AI +                 L  ++ S+ D 
Sbjct: 10  AEALKLKNEGNIFIKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQSSLNDC 69

Query: 155 ESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVL-----DIEGDKATDVMKR 205
           + A+K++P  +K Y R G +   L + ++A    + VL     D    +A DV ++
Sbjct: 70  DEALKLDPKNAKAYHRRGLSYIGLLEFKKAKNDLQIVLKAKPGDATASRALDVCEK 125

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 49/127 (38%), Gaps = 16/127 (12%)

Query: 65  DELLKSAATALPTQSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKKYTEAI 124
           D L   A  AL  + EP +V            AE+ K QGN     K F  A   Y + I
Sbjct: 60  DNLELEALKALAYEGEPHEV------------AENFKNQGNDLFTVKRFREARDIYNKGI 107

Query: 125 EVL----PXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGK 180
           E+                     LK Y   + D + A+ +NP   K Y R+G A Y L  
Sbjct: 108 EIKCENDKINEALFANRAACQLELKNYRSCINDCKHALTLNPKNIKCYYRMGKAFYLLNN 167

Query: 181 PEEALEA 187
            EEA E+
Sbjct: 168 IEEAKES 174

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 41/85 (48%)

Query: 94  KAKAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQD 153
           + KA + K +GN  +  K F  AI+KYTEAI++                 +  ++ ++ D
Sbjct: 9   RVKAHERKNEGNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDNFQSALND 68

Query: 154 AESAIKVNPSYSKGYSRLGFAKYAL 178
            + AIK++P   K Y R   +  AL
Sbjct: 69  CDEAIKLDPKNIKAYHRRALSCMAL 93

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 49/102 (48%)

Query: 91  ANTKAKAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEES 150
           A+ K +A   K +GN  +  +++  AI+ Y++AIE+ P               L  ++  
Sbjct: 6   ADAKEQAVAFKNEGNTYIKEQNYMKAIELYSQAIELDPTQSIFFSNRALAQLKLDNFQSC 65

Query: 151 VQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVL 192
           + D + A++++P   K Y R G +   L + ++A    + VL
Sbjct: 66  MNDCDVALRLDPKNIKAYHRRGLSHLGLLQCKKARNDLQVVL 107

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 42/85 (49%)

Query: 94  KAKAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQD 153
           +AKA + K +GN  +  K F  AI+KYTEAI++                 +  ++ ++ D
Sbjct: 9   RAKALERKNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALND 68

Query: 154 AESAIKVNPSYSKGYSRLGFAKYAL 178
            + AIK++P   K Y R   +  AL
Sbjct: 69  CDEAIKLDPKNIKAYHRRALSCMAL 93

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 57/133 (42%), Gaps = 13/133 (9%)

Query: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIEV----LPXXXXXXXXXXXXXXXLKKYEESVQ 152
           A + K QGN     K F+ A   Y +A++V    L                +K Y   + 
Sbjct: 70  ATNFKNQGNDLYKGKRFKDARAMYLKALDVKCDVLSINESLYLNLAACELEIKNYRSCIN 129

Query: 153 DAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGD---------KATDVM 203
               A+K+N    K + R+G A   LG+ E++LEA +  L ++ +         KAT+ +
Sbjct: 130 YCREALKLNAKNVKAFFRIGKAYLELGRFEDSLEAVQVGLAVDPENGALKSIQSKATEKL 189

Query: 204 KRDYETAKRKVEQ 216
           KR  E   R + Q
Sbjct: 190 KRKKELENRTLAQ 202

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 43/88 (48%)

Query: 91  ANTKAKAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEES 150
           A+  AKA + K +GN  +  K F  AI+KYTEAI++                 +  ++ +
Sbjct: 6   ASDCAKALERKNEGNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSA 65

Query: 151 VQDAESAIKVNPSYSKGYSRLGFAKYAL 178
           + D + AIK++P   K Y R   +  AL
Sbjct: 66  LNDCDEAIKLDPKNIKAYHRRALSCMAL 93

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 61/135 (45%), Gaps = 10/135 (7%)

Query: 89  EDANTKAKAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYE 148
           ED N   KA + K QGN  +  K+F  A + Y++AIE+                 L  ++
Sbjct: 7   EDVN---KALEFKNQGNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNFQ 63

Query: 149 ESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIE-----GDKATDVM 203
            ++ D   AI+++P   K Y R G +   L +  +A +  K VL  +       +A DV 
Sbjct: 64  TALNDCNKAIELDPKNVKAYHRRGLSYIGLLEFNKARKDLKIVLRAKPNEPVATRALDVC 123

Query: 204 KRDYETAKRKVEQSL 218
           +R     K K E+++
Sbjct: 124 ER--VIRKEKFEKAI 136

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 61/131 (46%), Gaps = 6/131 (4%)

Query: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXX----XXXXXXXLKKYEESVQ 152
           AE+ K QGN     K F  A + Y++ I+V                     +K Y   + 
Sbjct: 81  AENFKKQGNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIKNYRRCIN 140

Query: 153 DAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEG-DKATDVMKRDYETAK 211
           D + A+++NP   K Y R+  A  AL + +EALE+ +    I+  +K+   +K   ET +
Sbjct: 141 DCKQALQLNPKNIKCYYRIAKAFTALERLDEALESIEFGEKIDNTNKSLKTLKLHIETKQ 200

Query: 212 RKVE-QSLNLE 221
            ++E + L LE
Sbjct: 201 LEIEARRLKLE 211

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 49/107 (45%), Gaps = 4/107 (3%)

Query: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIEVL----PXXXXXXXXXXXXXXXLKKYEESVQ 152
           AE+ K QGN    ++ ++ A + Y + +EV                     LK +   + 
Sbjct: 80  AENFKNQGNDLYRARRYKDARELYNKGVEVHCDDDAINESLFLNRAACELELKNHRRCIN 139

Query: 153 DAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGDKA 199
           D + A++ NP   K + R+G A ++L K EEA EA +  L  + + A
Sbjct: 140 DCKEALRYNPKNVKCFYRMGRAFFSLNKLEEAKEAIEFGLRFDSNNA 186

>NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON}
           Anc_8.506 YBR155W
          Length = 379

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 45/96 (46%), Gaps = 5/96 (5%)

Query: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIEV-----LPXXXXXXXXXXXXXXXLKKYEESV 151
           AE+ K QGN    +K F+ A   Y + I++     +                LK +   +
Sbjct: 76  AENFKNQGNDLYKAKRFKDARDVYLKGIQIENNKDVKIKESLFANKAACELELKNFRRCI 135

Query: 152 QDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEA 187
            D ++A+++NP   K Y R+  A +AL K EEA E+
Sbjct: 136 NDCKNALQLNPKNVKCYFRMTRAFFALDKLEEAKES 171

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 50/116 (43%), Gaps = 4/116 (3%)

Query: 88  AEDANTKAKAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXX----XXXXXXXXXXXXX 143
           A D      AE+ K QGN+    K ++ A + Y + IE+                     
Sbjct: 69  AYDGEPHEVAENFKNQGNELYKVKRYKDAREIYNKGIEIKCDSNKINESLFSNRAACELE 128

Query: 144 LKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGDKA 199
           LK Y   V D   A++ NP+  K + R+  A + L K E+A EA +  L ++ + A
Sbjct: 129 LKNYRRCVNDCRQALQFNPTNIKCFYRIARAFFLLDKCEDAKEAIEFGLKLDSESA 184

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 41/92 (44%), Gaps = 4/92 (4%)

Query: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIEV----LPXXXXXXXXXXXXXXXLKKYEESVQ 152
           AE+ K QGN+   +K F+ A + YT+ I V                     LK Y   ++
Sbjct: 83  AENFKKQGNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELELKNYRRCIE 142

Query: 153 DAESAIKVNPSYSKGYSRLGFAKYALGKPEEA 184
           D   A+ +NP   K Y R   A ++L K EEA
Sbjct: 143 DCSKALTINPKNIKCYYRTSKAFFSLSKLEEA 174

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 52/110 (47%), Gaps = 4/110 (3%)

Query: 100 LKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIK 159
           LK +GN+   +K FE A+K Y+ AIEV                 L + E+ V+D  +A+K
Sbjct: 99  LKDKGNEFFKNKQFEDALKYYSLAIEV-KEDPVFYSNRSACYVSLGQQEKVVEDTTAALK 157

Query: 160 VNPSYSKGYSRLGFAKYALGKPEEA---LEAYKTVLDIEGDKATDVMKRD 206
           + P YSK   R   A  +LGK  +A   L A     D  G     +++R+
Sbjct: 158 LKPDYSKCLLRRASANESLGKFADAMFDLSAVSLYGDFNGSSIEPLLERN 207

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 38/79 (48%)

Query: 100 LKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIK 159
            K +GN  + S+D++ AI+ YT+AIE+                 L  ++ ++ D   AIK
Sbjct: 15  FKDEGNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQSALHDCNDAIK 74

Query: 160 VNPSYSKGYSRLGFAKYAL 178
           ++ +  K Y R G A   L
Sbjct: 75  LDNNNIKAYHRRGLAYVGL 93

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 39/83 (46%)

Query: 96  KAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAE 155
           KA + K +GN  +  +D+  AI+KY +AIE+                 L  ++ + QD +
Sbjct: 8   KALEYKNEGNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCD 67

Query: 156 SAIKVNPSYSKGYSRLGFAKYAL 178
            A+ ++P   K Y R G A   L
Sbjct: 68  KALALDPKNVKAYHRRGLACVGL 90

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 43/98 (43%)

Query: 95  AKAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDA 154
           AKA + K +GN  +  +++  AI+ YT+AIE+ P               L  ++ +  D 
Sbjct: 10  AKAVEFKNEGNVFIKEQNYSKAIELYTKAIELDPNQSIFYSNRALAQLKLDNFQSAYNDC 69

Query: 155 ESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVL 192
             A+ ++    K Y R G A   L + + A      VL
Sbjct: 70  NEALTLDSKNVKAYHRRGLANVGLLEFKRARNDLNVVL 107

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 57/111 (51%), Gaps = 3/111 (2%)

Query: 88  AEDANTKAK-AEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKK 146
           A + N K+K A++LK +GN+   SKD E AIK Y  A+  L                + +
Sbjct: 148 ANNENLKSKFAKELKNKGNQYFKSKDNENAIKYYEYALR-LDQDPVFYSNISACYFAMNQ 206

Query: 147 YEESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGD 197
            ++ ++ +  A+++ P YSK   R   A  ALG  +EAL  + ++L + G+
Sbjct: 207 LDKVIESSNKALELKPDYSKALLRRANAYEALGNNKEALYDF-SILSLFGE 256

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 42/92 (45%), Gaps = 4/92 (4%)

Query: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIEV----LPXXXXXXXXXXXXXXXLKKYEESVQ 152
           AE+ K QGN+   +K F+ A + YT+ + V                     LK Y + V+
Sbjct: 83  AENFKKQGNELYKAKRFKDARELYTKGVAVECEDKSINESLFANRAACELELKNYRKCVE 142

Query: 153 DAESAIKVNPSYSKGYSRLGFAKYALGKPEEA 184
           D   A+ +NP   K Y R+  + + L K EEA
Sbjct: 143 DCGKALTINPKNIKCYYRISKSFFQLRKLEEA 174

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 54/116 (46%), Gaps = 5/116 (4%)

Query: 95  AKAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDA 154
           AKA + K QGN  +  +DF  A + YT+AIE+                    ++ S+ D 
Sbjct: 10  AKALEYKDQGNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDC 69

Query: 155 ESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVL-----DIEGDKATDVMKR 205
           + A++++    K Y R G +   L + ++A    KTVL     D+  D+A  + ++
Sbjct: 70  DKALELDSKNIKAYHRRGLSYVGLLEFKKARTDLKTVLKSKPGDVAADRALQICEK 125

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 41/85 (48%)

Query: 94  KAKAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQD 153
           +A A + K +GN  +  K F  AI+KYT+AI++                 +  ++ ++ D
Sbjct: 9   RANALERKNEGNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALND 68

Query: 154 AESAIKVNPSYSKGYSRLGFAKYAL 178
            + A+K++P   K Y R   +  AL
Sbjct: 69  CDEALKLDPKNIKAYHRRALSCMAL 93

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 47/104 (45%), Gaps = 1/104 (0%)

Query: 94  KAKAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQD 153
           +A A  LK +GN    +K+F  AIK Y  AIE+ P                   E+ ++ 
Sbjct: 124 QAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEF 183

Query: 154 AESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGD 197
              A+++ P +SK   R   A  +LG   +A+    +VL + GD
Sbjct: 184 TTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 226

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score = 38.1 bits (87), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 45/101 (44%), Gaps = 1/101 (0%)

Query: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAES 156
           A  LK +GN    SK+F+ AIK Y  AIE+ P                    + V+    
Sbjct: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184

Query: 157 AIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGD 197
           A+++ P +SK   R   A  +LG   +A+    +VL + GD
Sbjct: 185 ALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 224

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 38.1 bits (87), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 60/129 (46%), Gaps = 3/129 (2%)

Query: 96  KAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAE 155
           KA +LK +GNK +  K +  A + YT+AIE  P               L  ++ S+ DA+
Sbjct: 12  KALELKNEGNKFVKEKLYAKAAEYYTKAIEHDPENTILYSNRAFTNLKLDNFQSSLDDAK 71

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVE 215
            AI+++ +  K Y R   +   L    E  +A K ++ +   K  ++  ++      KV 
Sbjct: 72  RAIELDNNNLKAYHRRAMSYIGL---LEFRKARKDLIIVLKFKPNELTAKNALAICDKVI 128

Query: 216 QSLNLEKSV 224
           Q  N EK++
Sbjct: 129 QKENFEKAI 137

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 38.1 bits (87), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 40/92 (43%), Gaps = 4/92 (4%)

Query: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIEV----LPXXXXXXXXXXXXXXXLKKYEESVQ 152
           AE+ K QGN+   +K F+ A + Y++ + V                     LK Y   ++
Sbjct: 83  AENFKKQGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNYRRCIE 142

Query: 153 DAESAIKVNPSYSKGYSRLGFAKYALGKPEEA 184
           D   A+ +NP   K Y R   A + L K EEA
Sbjct: 143 DCSKALTINPKNVKCYYRTSKAFFQLNKLEEA 174

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 37.7 bits (86), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 60/145 (41%), Gaps = 18/145 (12%)

Query: 95  AKAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDA 154
           A A D K +GN+ +   D+++AI+ Y++AI +                    +  +V D 
Sbjct: 10  ATALDFKNKGNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNFYSAVVDC 69

Query: 155 ESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVL-----DIEGDKATDVMKRDY-- 207
           ++A+K++P   K Y R G +   + +  +A      VL     DI    A  V +     
Sbjct: 70  DNALKLDPKNIKAYHRRGLSYVGILEFRKAKNDLNVVLKAKPNDITASNALKVCENFIRE 129

Query: 208 -----------ETAKRKVEQSLNLE 221
                      + AK  + Q+LNLE
Sbjct: 130 ERFKNAIGGSGDNAKSNICQTLNLE 154

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score = 37.4 bits (85), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 45/101 (44%), Gaps = 2/101 (1%)

Query: 80  EPVKVNIPAEDANTKAK-AEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXX 138
           EPV  ++   +  TK + A  LK +GN     KDFE AIK YT A+  L           
Sbjct: 77  EPVLGDVDLLNDKTKEEWAGALKEKGNALFKKKDFENAIKYYTFALS-LKEDPVYYSNIS 135

Query: 139 XXXXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALG 179
                L  YE+ ++ A  A+ + P YSK   R   A   LG
Sbjct: 136 ACYSSLLNYEKVIEMATKALALRPDYSKVLVRRANAYEKLG 176

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 37.0 bits (84), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 54/115 (46%), Gaps = 5/115 (4%)

Query: 96  KAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAE 155
           KA + K QGN  +  K +  A++ Y++AIE+                 L  +  +++D  
Sbjct: 11  KALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTALEDCN 70

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGD-----KATDVMKR 205
            +I+++P   K   R G +   L +  +A +  KT+L ++ +     KA +V +R
Sbjct: 71  KSIELDPKNIKAIHRRGLSYVGLLEFSKARKDLKTILQVKPNEQSALKALEVCER 125

>ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 379

 Score = 36.6 bits (83), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 47/114 (41%), Gaps = 4/114 (3%)

Query: 88  AEDANTKAKAEDLKLQGNKAMASKDFETAIKKYTEAIEVL----PXXXXXXXXXXXXXXX 143
           A D      AE+ K Q N    +K F+ A + Y + IE+                     
Sbjct: 69  AYDGEPHEVAENFKNQANDLYKAKRFKEAREVYKKGIEIKCNDDKVNESLFANLAACELE 128

Query: 144 LKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGD 197
           +K +   +   + A++ NP   K Y R+  A Y L K +EA E+ K  L I+ +
Sbjct: 129 IKNFRRCINLCQKALQFNPKNMKCYYRIAKAFYQLNKLDEAKESVKFGLTIDSE 182

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score = 36.6 bits (83), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 100 LKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIK 159
           LK +GN+   +K ++ AI+ Y+ AIEV                 L + E+ V+D  +A+K
Sbjct: 98  LKDKGNEFFKNKKYDEAIQYYSWAIEV-KEDPVFYSNRSACYVSLGQQEKVVEDTTAALK 156

Query: 160 VNPSYSKGYSRLGFAKYALGKPEEAL 185
           + P YSK   R   A  +LG   +A+
Sbjct: 157 LKPDYSKCLLRRASANESLGNFADAM 182

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score = 36.6 bits (83), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 39/80 (48%), Gaps = 1/80 (1%)

Query: 100 LKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIK 159
           LK +GN+   +  FE AIK Y  A++ L                L +YE+ ++ A  A+K
Sbjct: 113 LKDKGNELFKTSKFEDAIKYYHYALK-LKDDPIYYSNISACYASLLQYEKVIEYATKALK 171

Query: 160 VNPSYSKGYSRLGFAKYALG 179
           + P++SK   R   A  A+G
Sbjct: 172 LRPTFSKVLMRRALAYEAMG 191

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 40/92 (43%), Gaps = 4/92 (4%)

Query: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIEV----LPXXXXXXXXXXXXXXXLKKYEESVQ 152
           A + K QGN    +K F+ A + Y + IE+                     +K Y   + 
Sbjct: 78  AGNFKNQGNDLYKAKRFKDARELYNKGIEIKCDDTSINESLYANRAACELEIKNYRRCLN 137

Query: 153 DAESAIKVNPSYSKGYSRLGFAKYALGKPEEA 184
           D ++A++ NP   K Y R+G A  AL   EEA
Sbjct: 138 DCKTALQYNPKNLKCYYRMGKAFLALELLEEA 169

>KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {ON}
           some similarities with uniprot|P38042 Saccharomyces
           cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 627

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 54/131 (41%), Gaps = 2/131 (1%)

Query: 102 LQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVN 161
           LQG++  ++  F+TA+  Y +A+   P               L +YEE +   E A  +N
Sbjct: 448 LQGHEYSSNDAFDTAMTCYRKALGSNPQHYNAHYGLGMCCLKLGQYEECLLHFEKARSIN 507

Query: 162 PSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGDKATDVMKR-DYETAKRKVEQSL-N 219
           P         G A   L   E+AL+ Y    +++   +  + KR     A  K   +L N
Sbjct: 508 PVNVILICCCGVALEKLSHQEKALQYYDLACELQPVSSLALFKRAQLLLAMGKYNFALEN 567

Query: 220 LEKSVPTQTDE 230
            EK V    DE
Sbjct: 568 FEKLVTIAPDE 578

>Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR189W
           (SKI3) - Contains 8 copies of the TPR domain [contig 8]
           FULL
          Length = 1410

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 32/47 (68%)

Query: 149 ESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIE 195
           ES++  +SA++V+PS  + +  LG A YA G+ E +++ ++  L++E
Sbjct: 698 ESIEWFQSALRVDPSDLESWVGLGQAYYACGRVEASVKVFEKALEVE 744

>ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR080W (DIA2)
          Length = 685

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 44/100 (44%), Gaps = 11/100 (11%)

Query: 144 LKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGD------ 197
           L K + ++ DA   I V+    KGY R G     LG+ EEAL+ Y+  L   G+      
Sbjct: 83  LNKLDRALADAAYMITVDAYNLKGYIRRGKVLQKLGRYEEALQVYENGLKQAGEAEKTHA 142

Query: 198 -----KATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQE 232
                K  D++ R   T K  ++      +S+  QT  +E
Sbjct: 143 IHAPQKFLDIVYRQRSTIKELLQSRARSSRSLTQQTVAKE 182

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 41/86 (47%), Gaps = 1/86 (1%)

Query: 100 LKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIK 159
           LK +GN+    + +E AIK Y  A++ L                L K E+ V+D  +A+K
Sbjct: 98  LKDKGNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNRSACYVPLNKLEKVVEDTTAALK 156

Query: 160 VNPSYSKGYSRLGFAKYALGKPEEAL 185
           + P YSK   R   A  +LG   +A+
Sbjct: 157 LKPDYSKCLLRRATANESLGNYADAM 182

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 41/86 (47%), Gaps = 1/86 (1%)

Query: 100 LKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIK 159
           +K +GN+    K +E AIK Y+ A+  L                L K E+ V+D  +A++
Sbjct: 101 MKDKGNECFKEKKYEEAIKYYSCALR-LKKDPVFYSNRSACWVPLNKLEKVVEDTTAALE 159

Query: 160 VNPSYSKGYSRLGFAKYALGKPEEAL 185
           + P YSK   R   A  +LG   +A+
Sbjct: 160 LKPDYSKCLLRRATANESLGNFADAM 185

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 48/98 (48%), Gaps = 2/98 (2%)

Query: 100 LKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIK 159
           LK +GNK   +KD+  AIK Y  A++ L                L + ++ ++ +  A++
Sbjct: 125 LKDKGNKYFKAKDYTNAIKYYNLALD-LNKDPIFYSNISACYVSLGQLDKVIESSTKALE 183

Query: 160 VNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGD 197
           +NP+YSK   R   A  +L    +AL    +VL + GD
Sbjct: 184 LNPNYSKALLRRASANESLENYSDALFDL-SVLSLNGD 220

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 46/104 (44%), Gaps = 1/104 (0%)

Query: 94  KAKAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQD 153
           +A A  LK +GN    +K F  AIK Y  AIE+ P                   ++ V+ 
Sbjct: 128 QAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEY 187

Query: 154 AESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGD 197
              A+++ P +SK   R   A  +LG   +A+    +VL + GD
Sbjct: 188 TTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 230

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 55/117 (47%), Gaps = 8/117 (6%)

Query: 83  KVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKKYTEAIEVL--PXXXXXXXXXXXX 140
           K N  AE+ +  A A  LK +GN+   +K ++ AIK Y  A+E+   P            
Sbjct: 87  KANFTAEEKDKYALA--LKDKGNQFFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVS 144

Query: 141 XXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGD 197
              LKK    V+ +  A+++ P YSK   R   A   LGK  +A+    +VL + GD
Sbjct: 145 VGDLKK---VVEMSTKALELKPDYSKVLLRRASANEGLGKFADAMFDL-SVLSLNGD 197

>AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL084C (CDC27)
          Length = 656

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 47/104 (45%)

Query: 102 LQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVN 161
           LQG++   +  F+ A   Y +A+ + P               L +Y+E++   E A  +N
Sbjct: 477 LQGHEYSNNDAFDNAKMCYRKALAINPNHYNAHYGLGMSCIKLGQYDEALLHFEKARSIN 536

Query: 162 PSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGDKATDVMKR 205
           P         G A   LG+ E+AL+ Y+   +++ + +  + K+
Sbjct: 537 PVNVILNCCCGVALERLGRREKALDFYQLACELQPNSSLALFKK 580

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 56/132 (42%), Gaps = 6/132 (4%)

Query: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIEVL----PXXXXXXXXXXXXXXXLKKYEESVQ 152
           AE+ K QGN+A   K +  A   Y   IEV                     +K Y   + 
Sbjct: 74  AENFKKQGNEAYKLKQYRNARVLYERGIEVNCNNDKINELLFVNKAACELEMKNYRSCIN 133

Query: 153 DAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGDKAT--DVMKRDYETA 210
           D + A+  NP   K Y R+  A  A+ K +E+ E+ +  L ++   ++  +++K   +  
Sbjct: 134 DCKKALSFNPLNVKCYFRMAKAFSAIEKYDESRESIEFGLKVDSRNSSLLNLLKTIIKKQ 193

Query: 211 KRKVEQSLNLEK 222
           + K    L LE+
Sbjct: 194 EEKTAYRLKLER 205

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 37/89 (41%), Gaps = 4/89 (4%)

Query: 100 LKLQGNKAMASKDFETAIKKYTEAIEVLPX----XXXXXXXXXXXXXXLKKYEESVQDAE 155
            K QGN+   +K F+ A + Y + + V                     LK Y   ++D  
Sbjct: 86  FKKQGNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAACELELKNYRRCIEDCS 145

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEA 184
            A+ +NP  +K Y R   A + L K EEA
Sbjct: 146 KALSINPKNTKCYYRTSKAFFQLNKLEEA 174

>KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {ON}
           Anc_8.470 YDR244W
          Length = 602

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 43/102 (42%), Gaps = 3/102 (2%)

Query: 109 ASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGY 168
           A+ DF   I  +  A++V P                 + EES++    A+++ PS+ +  
Sbjct: 458 ANDDFNKTIDCFKTALQVNPNDELMWNRLGAALANSNRSEESIKAYHRALQLKPSFVRAR 517

Query: 169 SRLGFAKYALGKPEEALEAYKTVL---DIEGDKATDVMKRDY 207
             L  +   +G  +EA+E   T L   ++EG +  D     Y
Sbjct: 518 YNLAVSSMNIGCYKEAVEHLLTALSMHEVEGLRQKDKDSHHY 559

>Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W
           (REAL)
          Length = 612

 Score = 34.3 bits (77), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 31/49 (63%)

Query: 147 YEESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIE 195
           +++++   ESA+KVNP+    ++RLG +     + EEA++AY   L ++
Sbjct: 474 FDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 522

>Smik_4.774 Chr4 complement(1365084..1366838) [1755 bp, 584 aa] {ON}
           YDR497C (REAL)
          Length = 584

 Score = 34.3 bits (77), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (67%), Gaps = 5/34 (14%)

Query: 197 DKATDVMKRDY-----ETAKRKVEQSLNLEKSVP 225
           +KAT+V+KR Y     E  KRKVE+ + L +S+P
Sbjct: 280 EKATEVLKRSYTDTSEEIIKRKVEELVTLNQSIP 313

>Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL294W
          Length = 675

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 47/104 (45%)

Query: 102 LQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVN 161
           LQG++   +  F+ A   Y +A+ + P               L +Y+E++   E A  +N
Sbjct: 496 LQGHEYSNNDAFDNAKMCYRKALAINPNHYNAHYGLGMSCIKLGQYDEALLHFEKARSIN 555

Query: 162 PSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGDKATDVMKR 205
           P         G A   LG+ E+AL+ Y+   +++ + +  + K+
Sbjct: 556 PVNVILNCCCGVALERLGRREKALDFYQLACELQPNSSLALFKK 599

>Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 31/49 (63%)

Query: 147 YEESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIE 195
           +++++   ESA+KVNP+    ++RLG +     + EEA++AY   L ++
Sbjct: 473 FDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 521

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score = 33.9 bits (76), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 44/98 (44%), Gaps = 1/98 (1%)

Query: 88  AEDANTKAKAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKY 147
           AE A     A +LK +GN     KD+E AI  Y  A++ L                L+  
Sbjct: 77  AETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQ-LKNDPVFYSNMAACYISLEHN 135

Query: 148 EESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEAL 185
           +E+++    A+++NP YSK   +       +GK  +AL
Sbjct: 136 KEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADAL 173

>Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 33.9 bits (76), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 31/49 (63%)

Query: 147 YEESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIE 195
           +++++   ESA+KVNP+    ++RLG +     + EEA++AY   L ++
Sbjct: 473 FDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 521

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 33.9 bits (76), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 54/117 (46%), Gaps = 8/117 (6%)

Query: 83  KVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKKYTEAIEVL--PXXXXXXXXXXXX 140
           K N  AE+ +  A A  LK +GN+   +K ++ AIK Y  A+E+   P            
Sbjct: 87  KANFTAEEKDKYALA--LKDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVS 144

Query: 141 XXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGD 197
              LKK    V+ +  A+++ P YSK   R   A   LG   +A+    +VL + GD
Sbjct: 145 VGDLKK---VVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 33.9 bits (76), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 44/104 (42%)

Query: 102 LQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVN 161
           LQG++  +S  F+ A + Y +AI   P               L +YEE++   E A  +N
Sbjct: 567 LQGHEYTSSDSFDVAKRCYRKAIACDPGHYNAYYGLGMVSMKLGQYEEALLFFEKARSIN 626

Query: 162 PSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGDKATDVMKR 205
           P         G A   L   E+AL+ Y+   +++   +    KR
Sbjct: 627 PINVVLVCCGGVALEKLSYQEKALQYYELACELQPSSSLATFKR 670

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score = 33.9 bits (76), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 44/101 (43%), Gaps = 1/101 (0%)

Query: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAES 156
           A  LK +GN    +K+F  AIK Y  AIE+ P                    + ++    
Sbjct: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183

Query: 157 AIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGD 197
           A+++ P +SK   R   A  +LG   +A+    +VL + GD
Sbjct: 184 ALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 223

>NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {ON}
           Anc_8.470
          Length = 578

 Score = 33.9 bits (76), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 47/114 (41%), Gaps = 3/114 (2%)

Query: 102 LQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVN 161
           ++G    A  DF+  I+ + E++++ P                 K E+++Q    A+ + 
Sbjct: 436 IRGLLYYAEDDFDKTIECFKESLKINPNDEVMWNRLGASLANSNKPEDAIQAYHRALNLK 495

Query: 162 PSYSKGYSRLGFAKYALGKPEEALEAYKTVL---DIEGDKATDVMKRDYETAKR 212
           PS+ +    L  A   +G  +EA E   TVL    +EG    +      E  KR
Sbjct: 496 PSFVRARYNLAVASMNIGCYKEAGEHLLTVLRMHQVEGVNNVETDNNVLEILKR 549

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 33.5 bits (75), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 48/221 (21%), Positives = 85/221 (38%), Gaps = 24/221 (10%)

Query: 71  AATALPTQSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKKYTEAIEVL--- 127
           A  AL  + EP +V            A + K QGN     K ++ A   Y++ IEV    
Sbjct: 65  ALKALAYEGEPHEV------------AANFKNQGNDLYKVKRYKDARTMYSKGIEVKCED 112

Query: 128 -PXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALE 186
                            L+ +   + D + A+  N    K + R+G A + L K EEA  
Sbjct: 113 DSINGSLYLNRAACELELRNFRSCINDCKKALNFNAKCVKAFYRMGQAYFKLKKLEEAKG 172

Query: 187 AYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESSTDAGAGASGFPD 246
           +   +  ++ D   + +    +T  ++ E++  LE+S     D+QE        AS   +
Sbjct: 173 S--VLFGLKLDSQNNALVSLLDTIVKQEEKANVLEES--RFRDQQEKDLH----ASKLKE 224

Query: 247 MASXXXXXXXXXXNNPQVMSAAQKLMQNPGAMDEMMKNPAV 287
             S          N P V+  +  ++  P  ++  +  PA+
Sbjct: 225 ALSWRKITEFKTANPPAVLQNSTLMLSEPEDIESQLSFPAM 265

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 33.9 bits (76), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 54/117 (46%), Gaps = 8/117 (6%)

Query: 83  KVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKKYTEAIEVL--PXXXXXXXXXXXX 140
           K N  AE+ +  A A  LK +GN+   +K ++ AIK Y  A+E+   P            
Sbjct: 87  KANFTAEEKDRYALA--LKDKGNQFFRNKKYDDAIKYYNWALELKDDPVFYSNLSACYVS 144

Query: 141 XXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGD 197
              LKK    V+ +  A+++ P YSK   R   A   LG   +A+    +VL + GD
Sbjct: 145 VGDLKK---VVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score = 33.5 bits (75), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 42/104 (40%), Gaps = 14/104 (13%)

Query: 100 LKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIK 159
           LK +GN    +  FE AIK Y  AIE L                L K EE ++    A++
Sbjct: 114 LKDKGNSLFKADKFEEAIKYYNWAIE-LKENPIFYSNLSACYVSLNKLEEIIKYCNKALE 172

Query: 160 VNPSYSKGYSRLGFAKYALGKPEEALEAYK------TVLDIEGD 197
           + P YSK   R   A        E LE Y       +VL + GD
Sbjct: 173 LKPDYSKVLLRRANAN-------EKLENYADAMFDLSVLSLNGD 209

>YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}
           PEX5Peroxisomal membrane signal receptor for the
           C-terminal tripeptide signal sequence (PTS1) of
           peroxisomal matrix proteins, required for peroxisomal
           matrix protein import; also proposed to have
           PTS1-receptor independent functions
          Length = 612

 Score = 33.5 bits (75), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 30/48 (62%)

Query: 147 YEESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDI 194
           +++++   ESA++VNP+    ++RLG +     + EEA++AY   L +
Sbjct: 473 FDKTIDCFESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQL 520

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 33.1 bits (74), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 69/163 (42%), Gaps = 23/163 (14%)

Query: 71  AATALPTQSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKKYTEAIEVL--- 127
           A  AL  + EP ++            A + K +GN+    K +  A + YT+ I+V    
Sbjct: 60  ALKALAYEGEPHEI------------AGNFKNRGNEFYKLKQYRDAREVYTKGIDVKCDD 107

Query: 128 -PXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALE 186
                            LK + + ++D + A+  N    K Y R+G A  ++ + +E+ E
Sbjct: 108 DKINESLYANRAACELELKNFRKCIEDCKKALSFNVKNIKCYYRMGKAFLSVDRFDESKE 167

Query: 187 AYKTVLDIEGDKAT------DVMKRDYETAKRK-VEQSLNLEK 222
           + +  L I+ +  +       + KR  E  +RK +E  + LEK
Sbjct: 168 SIEFGLKIDSENKSLKNLLQAIEKRQLEIQRRKDMEMKIKLEK 210

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 33.1 bits (74), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 47/121 (38%), Gaps = 16/121 (13%)

Query: 71  AATALPTQSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKKYTEAIEVL--- 127
           A  AL  + EP ++            A + K QGN     K F  A + Y +AI+V    
Sbjct: 60  ALKALAYEGEPHEI------------AGNFKNQGNDLYKVKRFRDARELYNKAIDVKCDD 107

Query: 128 -PXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALE 186
                            LK Y   + D + A+ +NP   K Y R+  A  A+ K ++  E
Sbjct: 108 DKINESLYANRAACELELKNYRRCINDCKMALSLNPKNIKCYFRMAKAFLAIEKFDDCKE 167

Query: 187 A 187
           A
Sbjct: 168 A 168

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 33.1 bits (74), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 46/100 (46%)

Query: 96  KAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAE 155
           +A + K QGN  +  K ++ A++ Y++AIE+                 L  +  + +D +
Sbjct: 9   QALEFKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQEDCD 68

Query: 156 SAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIE 195
            AI ++P   K   R G +   L +  +A +  + VL ++
Sbjct: 69  KAIALDPKNIKAIHRRGLSYVGLLEFFKARKDLRVVLQVK 108

>CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244w PAS10 peroxisomal targeting signal receptor
          Length = 590

 Score = 33.1 bits (74), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 41/92 (44%), Gaps = 3/92 (3%)

Query: 109 ASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGY 168
           A+ +F+  I  +  A++V P                 + EE++Q    A+++ PS+ +  
Sbjct: 436 ANDEFDRTIDCFQAALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRAR 495

Query: 169 SRLGFAKYALGKPEEALEAYKTVL---DIEGD 197
             L  +   +G  +EA E   T L   D+EG+
Sbjct: 496 YNLAVSSMNIGCYKEAAEHLLTALSMHDVEGE 527

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 40/86 (46%), Gaps = 1/86 (1%)

Query: 100 LKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIK 159
           LK +GN+    K F+ AIK Y  A+E L                + + E+ V+D  +A+K
Sbjct: 105 LKDKGNEFFKEKKFDDAIKYYNLALE-LKKDPVFYSNRSACYVSMGQLEKVVEDTTAALK 163

Query: 160 VNPSYSKGYSRLGFAKYALGKPEEAL 185
           +   YSK   R   A  +LG   +A+
Sbjct: 164 LKSDYSKCLLRRASANESLGNYADAM 189

>AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR244W (PEX5)
          Length = 569

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/87 (22%), Positives = 36/87 (41%)

Query: 109 ASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGY 168
           A++DF+  I  +  A+ V P                 + EE++Q    AI++ P++ +  
Sbjct: 429 ANEDFDKTIDCFRAALAVRPDDECMWNRLGASLANSNRSEEAIQAYHRAIQLKPTFVRAR 488

Query: 169 SRLGFAKYALGKPEEALEAYKTVLDIE 195
             L  +   +G   EA E   T L + 
Sbjct: 489 YNLAVSSMNIGCYREAAEHLLTALSMH 515

>NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON}
           Anc_8.470
          Length = 590

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 46/110 (41%), Gaps = 7/110 (6%)

Query: 109 ASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGY 168
           ++ DF+  ++ +  A+++ P                 + EE+++    AI + PS+ +  
Sbjct: 453 SNDDFDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINLKPSFVRAR 512

Query: 169 SRLGFAKYALGKPEEALEAYKTVL---DIEGDKATDVMKRD---YETAKR 212
             L  A   +G  +EA     TVL    + G   T V K D    ET KR
Sbjct: 513 YNLAVASMNIGCYQEAAGHLLTVLKMHQVHGQDNTSV-KTDTAVLETLKR 561

>NCAS0I00870 Chr9 (160192..161949) [1758 bp, 585 aa] {ON} Anc_3.395
           YPR088C
          Length = 585

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 38/66 (57%), Gaps = 15/66 (22%)

Query: 261 NPQVMSAAQ-KLMQNPGAMDEMMKNPAVRQMAENF-SSGGGTPNLGD---LMSNPAIKDM 315
           +PQ+M  AQ +L QNPG    MM+N     M   F  +GGG P++ +   +M +P ++ M
Sbjct: 527 SPQMMQQAQQRLRQNPG----MMQN-----MQNMFGGAGGGMPDMNEMMKMMQDPNMQKM 577

Query: 316 AKNLFG 321
           A+  FG
Sbjct: 578 AQQ-FG 582

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 48/223 (21%), Positives = 91/223 (40%), Gaps = 28/223 (12%)

Query: 71  AATALPTQSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKKYTEAIEVL--- 127
           A  AL  + EP +V            AE+ K QGN    +K ++ A + Y   I++    
Sbjct: 64  ALKALAYEGEPHEV------------AENFKNQGNDLYRAKRYKDAREIYNRGIDIKCDD 111

Query: 128 -PXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALE 186
                            LK Y   V D + A++ N    K Y R+  A   L K E+A +
Sbjct: 112 SKVNESLFSNRAACELELKNYRRCVNDCKRALQYNVKNIKCYYRIAKAFLLLNKLEDAKQ 171

Query: 187 A--YKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESSTDAGAGASGF 244
           A  +   LD E ++A + ++++ +  K+  +     +    T+ +  E+  +A      F
Sbjct: 172 AAEFGLKLDPE-NQALNALRQNVDKKKQDADAFEAKKLKEQTERERLETILEASMILRNF 230

Query: 245 PDMASXXXXXXXXXXNNPQVMSAAQKLMQNPGAMDEMMKNPAV 287
            ++ +          N P+++  A+  ++N   M+  +  PA+
Sbjct: 231 KNVDT---------ANPPELLEEAKICLENKEDMESQLIFPAM 264

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 30/62 (48%)

Query: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAES 156
           AEDLK++GN    + D+ETAI  Y +A  +                 L++++E+V   + 
Sbjct: 41  AEDLKVKGNTFFKNGDYETAILYYEKACALDSSNPIYFSNMATALIKLERWQEAVNACDK 100

Query: 157 AI 158
            +
Sbjct: 101 GL 102

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 54/117 (46%), Gaps = 8/117 (6%)

Query: 83  KVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKKYTEAIEVL--PXXXXXXXXXXXX 140
           K +  AE+ +  A A  LK +GN+   +K ++ AIK Y  A+E+   P            
Sbjct: 87  KADFTAEEKDKYALA--LKDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVS 144

Query: 141 XXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGD 197
              LKK    V+ +  A+++ P YSK   R   A   LG   +A+    +VL + GD
Sbjct: 145 VGDLKKV---VEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 30.0 bits (66), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 39/86 (45%), Gaps = 2/86 (2%)

Query: 98  EDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESA 157
           E+ K  GN      ++  A++ Y + IEV P               L KY E+++   + 
Sbjct: 4   EEYKTTGNTYFKDGNYLKAVEYYKKCIEVEPENPIGYSNSAMSLIKLTKYTEALESCGTG 63

Query: 158 IK-VNPSYSKGYSRLGFAKYALGKPE 182
           +K VN + S+ Y +L + +Y L   E
Sbjct: 64  LKYVNDADSQVYKKLQY-RYNLADTE 88

>KNAG0B01290 Chr2 (244938..246551) [1614 bp, 537 aa] {ON} Anc_3.395
           YPR088C gene spans a gap in the genome sequence
          Length = 537

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 24/63 (38%)

Query: 261 NPQVMSAAQ-KLMQNPGAMD-----------------------EMMKNPAVRQMAENFSS 296
           +PQ+M  AQ +L QNPG M                        +MM++P ++QMA+ F +
Sbjct: 474 SPQMMQQAQQRLKQNPGMMKNMMDMFGGANGGAGGMPNMNDMMKMMQDPKMQQMAQQFGA 533

Query: 297 GGG 299
           G G
Sbjct: 534 GMG 536

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 43/104 (41%)

Query: 102 LQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVN 161
           LQG++ ++   ++TA   Y +AI                   L +YE+++   E A  +N
Sbjct: 629 LQGHEYLSMDSYDTAKTFYRKAISNDLHHYNAYYGMGMCSMKLGEYEQALVYFEKARSIN 688

Query: 162 PSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGDKATDVMKR 205
           PS +      G     LG  E+AL  Y+    I+   +    KR
Sbjct: 689 PSNAILICCCGVTMEKLGNQEKALNYYELACQIQPTSSLAKFKR 732

>ZYRO0E03300g Chr5 complement(259634..260827) [1194 bp, 397 aa] {ON}
           similar to uniprot|P47103 Saccharomyces cerevisiae
           YJR032W CPR7 Peptidyl-prolyl cis-trans isomerase
           (cyclophilin) catalyzes the cis-trans isomerization of
           peptide bonds N-terminal to proline residues binds to
           Hsp82p and contributes to chaperone activity
          Length = 397

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 61/143 (42%), Gaps = 29/143 (20%)

Query: 97  AEDLKLQGNKAMASKDFETAIKKYTEAI----EVLPXXXXXXXXXXXXXXXLKKYEESVQ 152
           A  +K  G      KDF+ A  KY +++    E +P                   EESV 
Sbjct: 239 ANTIKESGTLLYKKKDFQNAYYKYIKSLRYVNEFIP-------------------EESVD 279

Query: 153 DAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIE----GDKATDVMKR-DY 207
            A     +N   SK Y  L    Y L   +E+++    +L++E     D+A  + +R + 
Sbjct: 280 KANRINFINLK-SKLYLNLSLVLYYLQNYDESIKYATYLLEMENIPDADQAKALYRRGNS 338

Query: 208 ETAKRKVEQSLNLEKSVPTQTDE 230
            +AKRK E++L   KS   + D+
Sbjct: 339 YSAKRKWEEALKDYKSCQEKNDQ 361

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 49/123 (39%), Gaps = 2/123 (1%)

Query: 68  LKSAATALPTQSEPVKVNIPAED--ANTKAKAEDLKLQGNKAMASKDFETAIKKYTEAIE 125
           L+  +T L    + VK++I A +   N     +     GN     KD E AIK + +A +
Sbjct: 504 LEIYSTLLWHLHDKVKLSILANELVMNIPNAPQTWCCMGNFLSLQKDHEDAIKAFEKATQ 563

Query: 126 VLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEAL 185
           V P                  ++ +      A+  +P +   Y  LG +   LG+ +EAL
Sbjct: 564 VDPNFAYAYTLQGHEHSSNDSFDTAKNCYRKALACDPQHYNAYYGLGMSCMKLGQYDEAL 623

Query: 186 EAY 188
             +
Sbjct: 624 LHF 626

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 43/104 (41%)

Query: 102 LQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVN 161
           LQG++  ++  F+TA   Y +A+   P               L +Y+E++   E A  +N
Sbjct: 574 LQGHEHSSNDSFDTAKNCYRKALACDPQHYNAYYGLGMSCMKLGQYDEALLHFEKARSIN 633

Query: 162 PSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGDKATDVMKR 205
           P         G A   L   E+AL  Y+   +++   +    KR
Sbjct: 634 PINVILICCCGVALEKLQYQEKALSYYELACELQPSSSLANFKR 677

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 47/104 (45%), Gaps = 14/104 (13%)

Query: 100 LKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIK 159
           LK +GN+    KD++ A+K Y  A+ V+                L + ++ V+++  A++
Sbjct: 104 LKDRGNEFFKKKDYDNALKYYNYAL-VVKKDPVFYSNISACYVSLGQLDKVVENSTKALE 162

Query: 160 VNPSYSKGYSRLGFAKYALGKPEEALEAYK------TVLDIEGD 197
           + P YSK   R   A        E+LE Y       +VL + GD
Sbjct: 163 LKPDYSKALLRRASAN-------ESLENYADAMFDLSVLSLNGD 199

>Suva_3.42 Chr3 (57365..58219) [855 bp, 284 aa] {ON} YCR016W (REAL)
          Length = 284

 Score = 30.4 bits (67), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 32/56 (57%), Gaps = 6/56 (10%)

Query: 15  FLSSTVEKNAVSEDYADSLNVAIDC---ISEAFEFERDAVSEIVKNSFDNRKLDEL 67
           F SS +E  +V E+Y DSL+  +     + E ++F +   + ++K+ F+   LDE+
Sbjct: 116 FPSSVLELESVKENYGDSLDTVVSADSGVVEVWKFSKQKQNWLIKHFFN---LDEI 168

>Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar to
           Ashbya gossypii AFR453W
          Length = 573

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 21/91 (23%), Positives = 39/91 (42%), Gaps = 3/91 (3%)

Query: 109 ASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGY 168
           A+ +F+  I  +  A+ V P                 + EE++Q    AI++ P++ +  
Sbjct: 433 ANDEFDKTIDCFKAALHVRPNDECMWNRLGASLANSNRSEEAIQAYHRAIQLKPAFVRAR 492

Query: 169 SRLGFAKYALGKPEEALEAYKTVL---DIEG 196
             L  +   +G  +EA E   T L   ++EG
Sbjct: 493 YNLAVSSMNIGCYKEAAEQLLTALSMHEVEG 523

>Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON}
           similar to Ashbya gossypii ADR230W
          Length = 688

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 43/96 (44%), Gaps = 7/96 (7%)

Query: 149 ESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVL-------DIEGDKATD 201
           +++ DA+  IKV+    KGY R G     + + +EAL  Y+  L        +  +K   
Sbjct: 88  KALIDADRMIKVDAYNLKGYIRKGKILQKMAQDKEALYVYREGLSKAKEAYQLHFEKPPS 147

Query: 202 VMKRDYETAKRKVEQSLNLEKSVPTQTDEQESSTDA 237
                 E  K +V + LNL+K  PT    + +  +A
Sbjct: 148 KFVEIVEHQKNEVIKRLNLQKLTPTTGASKRTHIEA 183

>KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 566

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 20/92 (21%), Positives = 38/92 (41%)

Query: 104 GNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPS 163
           G    A+++F   I  +  A+EV P                 + EE++Q    A+ + PS
Sbjct: 423 GTLFYANEEFGKTIDCFRTALEVNPNDELMWNRLGASLANSNRSEEAIQAYHKALALKPS 482

Query: 164 YSKGYSRLGFAKYALGKPEEALEAYKTVLDIE 195
           + +    L  +   +G  +EA E+  + L + 
Sbjct: 483 FVRARYNLAISSMNIGCYKEAAESLLSALSMH 514

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 43/98 (43%), Gaps = 2/98 (2%)

Query: 100 LKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIK 159
           LK +GN     +DFE A+K Y  A+  L                L + E+ V+ +  A+K
Sbjct: 108 LKDKGNDYFKKQDFENALKYYNYAL-TLKQDPVFYSNISACYVSLGQLEKVVESSTEALK 166

Query: 160 VNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGD 197
           +   YSK   R   A  +L    +A+    +VL + GD
Sbjct: 167 LKHDYSKALLRRASAYESLANYVDAMVDL-SVLSLNGD 203

>KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]
           {ON} weakly similar to uniprot|Q06677 Saccharomyces
           cerevisiae YDR320C SWA2 auxilin-like protein
          Length = 623

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 31/148 (20%), Positives = 67/148 (45%), Gaps = 29/148 (19%)

Query: 98  EDLKLQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLK----KYEESVQD 153
           E+ K +G  +  + D+  A + Y +++  LP                +    +Y E++ D
Sbjct: 326 EEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSD 385

Query: 154 AESAIKVNP---------------SYSKGYSRL----GFAKYALGKPEEALEAYKTVLDI 194
           A SA+K+ P               +Y + +S++      A   +   E+ALE Y+ +++ 
Sbjct: 386 ASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKALETYQQLIEA 445

Query: 195 EGDKATDVMKRDYETAKRKVEQSLNLEK 222
            G  ++ V++     A+R+ ++++ LEK
Sbjct: 446 -GVTSSKVLE-----ARRQCQKAIALEK 467

>KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1411

 Score = 30.8 bits (68), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 30/46 (65%)

Query: 149 ESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDI 194
           ES++  +SA++V P+  + +  LG A Y+ G+ E +++ ++  L++
Sbjct: 699 ESIEWFQSALRVEPADLESWLGLGQAYYSCGRVEASVKVFEKALEV 744

>Kpol_520.6 s520 (15903..16781) [879 bp, 292 aa] {ON} (15903..16781)
           [879 nt, 293 aa]
          Length = 292

 Score = 30.4 bits (67), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 37/63 (58%), Gaps = 1/63 (1%)

Query: 148 EESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGDKATDVMKRDY 207
           +ES+ +A  +I++N  + KG+S +     A+G  ++ LE  K  L+ E  K+ ++  +D 
Sbjct: 224 QESLNNALRSIELNEMFLKGWSLIAIVSKAMGTKKDILEVSKNKLN-EIAKSNELSVQDV 282

Query: 208 ETA 210
           +TA
Sbjct: 283 KTA 285

>KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {ON}
           Anc_7.412 YBL084C
          Length = 739

 Score = 30.4 bits (67), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 39/87 (44%)

Query: 102 LQGNKAMASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVN 161
           LQG++  A++ ++TA   Y +AI   P               L KY++++   E A  +N
Sbjct: 560 LQGHEHAANETYDTAKIMYRKAIACDPQHYNAYYGLGDCASRLGKYDKALLYFEKARVIN 619

Query: 162 PSYSKGYSRLGFAKYALGKPEEALEAY 188
           P  +      G +   L  P++AL  Y
Sbjct: 620 PVNAILICCCGHSLEKLNLPDQALTYY 646

>NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1403

 Score = 30.8 bits (68), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 31/47 (65%)

Query: 150 SVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEG 196
           S++  +SAI+V+P+  + +  LG A  A G+ E +++ ++  ++++G
Sbjct: 688 SIEWFQSAIRVDPNDIESWVGLGQAYLACGRIEASMKVFEKAMELDG 734

>KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7.546
           YPR189W
          Length = 1418

 Score = 30.8 bits (68), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 30/47 (63%)

Query: 149 ESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIE 195
           ESV+   SA++V+P+  + +  LG A +A G+ E + + ++  ++I+
Sbjct: 703 ESVEWFHSALRVDPNDVESWVALGQAYFACGRVEASTKVFEKAIEID 749

>SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]
           {ON} similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 573

 Score = 30.0 bits (66), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 21/91 (23%), Positives = 40/91 (43%), Gaps = 3/91 (3%)

Query: 109 ASKDFETAIKKYTEAIEVLPXXXXXXXXXXXXXXXLKKYEESVQDAESAIKVNPSYSKGY 168
           A++D++  I  +  A+ V P                 + EE++Q    A+++ PS+ +  
Sbjct: 434 ANEDYDKTIDCFKAALTVKPDDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRAR 493

Query: 169 SRLGFAKYALGKPEEALEAYKTVL---DIEG 196
             L  +   +G  +EA E   T L   ++EG
Sbjct: 494 YNLAVSSMNIGCYKEAAEYLLTALSMHEVEG 524

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.306    0.123    0.325 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 29,378,836
Number of extensions: 1118938
Number of successful extensions: 4967
Number of sequences better than 10.0: 210
Number of HSP's gapped: 4881
Number of HSP's successfully gapped: 255
Length of query: 323
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 213
Effective length of database: 40,868,139
Effective search space: 8704913607
Effective search space used: 8704913607
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 66 (30.0 bits)