Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E01144g6.19ON43024613350.0
Smik_15.1756.19ON31224010881e-147
YOR006C (TSR3)6.19ON31324010861e-147
Kpol_1037.246.19ON36624510841e-146
TDEL0G045006.19ON30124210771e-146
Suva_15.1816.19ON33624010731e-145
KNAG0M011506.19ON30723910691e-145
ZYRO0C07832g6.19ON28124010651e-144
KLLA0D01111g6.19ON31424110601e-143
Skud_15.1676.19ON31224010541e-142
TPHA0J003206.19ON34224310391e-139
Ecym_30236.19ON34924010231e-137
ACR007W6.19ON31324010181e-137
CAGL0E02717g6.19ON32523810151e-136
KLTH0C11264g6.19ON3462409601e-127
NCAS0H008106.19ON3232479461e-126
NDAI0D007906.19ON4012619471e-125
Kwal_56.224216.19ON3372339341e-124
KAFR0L003906.19ON3292238121e-105
TBLA0A072506.19ON3042467881e-102
CAGL0E03454g4.46ON867103850.070
NDAI0I013106.171ON27752679.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E01144g
         (430 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON...   518   0.0  
Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {O...   423   e-147
YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}  ...   422   e-147
Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {O...   422   e-146
TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19...   419   e-146
Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {...   417   e-145
KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {O...   416   e-145
ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar...   414   e-144
KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {O...   412   e-143
Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {O...   410   e-142
TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON...   404   e-139
Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON} s...   398   e-137
ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic hom...   396   e-137
CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {O...   395   e-136
KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} simila...   374   e-127
NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON...   369   e-126
NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {O...   369   e-125
Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {...   364   e-124
KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}...   317   e-105
TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {...   308   e-102
CAGL0E03454g Chr5 complement(316082..318685) [2604 bp, 867 aa] {...    37   0.070
NDAI0I01310 Chr9 (316912..317745) [834 bp, 277 aa] {ON} Anc_6.17...    30   9.2  

>SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 430

 Score =  518 bits (1335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/246 (100%), Positives = 246/246 (100%)

Query: 1   MGKGKNKNHEERSSRPHRGANGHSSRLNHKRMEMKRGGDSSAGNKFPVKLAMWDFDHCDP 60
           MGKGKNKNHEERSSRPHRGANGHSSRLNHKRMEMKRGGDSSAGNKFPVKLAMWDFDHCDP
Sbjct: 1   MGKGKNKNHEERSSRPHRGANGHSSRLNHKRMEMKRGGDSSAGNKFPVKLAMWDFDHCDP 60

Query: 61  KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWARLD 120
           KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWARLD
Sbjct: 61  KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWARLD 120

Query: 121 EVPFGRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLSNFSW 180
           EVPFGRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLSNFSW
Sbjct: 121 EVPFGRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLSNFSW 180

Query: 181 GLGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKEEDIWMMGNVNRR 240
           GLGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKEEDIWMMGNVNRR
Sbjct: 181 GLGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKEEDIWMMGNVNRR 240

Query: 241 RTCDTS 246
           RTCDTS
Sbjct: 241 RTCDTS 246

 Score =  150 bits (379), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 73/73 (100%), Positives = 73/73 (100%)

Query: 358 RCEKMPQENEYDSLGNIIEKHSKETDFKTTRHNSFGSTTSSEEDEYIEELHTKKEAKYDS 417
           RCEKMPQENEYDSLGNIIEKHSKETDFKTTRHNSFGSTTSSEEDEYIEELHTKKEAKYDS
Sbjct: 358 RCEKMPQENEYDSLGNIIEKHSKETDFKTTRHNSFGSTTSSEEDEYIEELHTKKEAKYDS 417

Query: 418 FGNISEGVQNLSL 430
           FGNISEGVQNLSL
Sbjct: 418 FGNISEGVQNLSL 430

>Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  423 bits (1088), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 201/240 (83%), Positives = 220/240 (91%), Gaps = 2/240 (0%)

Query: 1   MGKGKNKNHEERSSRPHRGANGHSSRLNHKRMEMKRGGDSSAGNKFPVKLAMWDFDHCDP 60
           MGKGKNK HE ++ RP RGANGHSSR NH+RMEMK   ++S   KFPVKLAMWDFDHCDP
Sbjct: 1   MGKGKNKAHEPKNGRPQRGANGHSSRQNHRRMEMKY--ENSDKVKFPVKLAMWDFDHCDP 58

Query: 61  KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWARLD 120
           KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNG+GVVCP+D  +VE+HGASVVECSWARL+
Sbjct: 59  KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWARLE 118

Query: 121 EVPFGRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLSNFSW 180
           EVPF +IGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR D ASELLS+FSW
Sbjct: 119 EVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSW 178

Query: 181 GLGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKEEDIWMMGNVNRR 240
           G+GFLELNKELLEIYQQCTDADSVK AEE WL+K+E+E Q+RK Q+KEEDIWMMGN+NRR
Sbjct: 179 GMGFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIWMMGNINRR 238

>YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}
           TSR3Protein required for correct processing of the 20S
           pre-rRNA at site D to generate mature 18S rRNA; green
           fluorescent protein (GFP)-fusion protein localizes to
           both the cytoplasm and the nucleus
          Length = 313

 Score =  422 bits (1086), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 201/240 (83%), Positives = 219/240 (91%), Gaps = 2/240 (0%)

Query: 1   MGKGKNKNHEERSSRPHRGANGHSSRLNHKRMEMKRGGDSSAGNKFPVKLAMWDFDHCDP 60
           MGKGKNK HE ++ RP RGANGHSSR NH+RMEMK   D+S   KFPVKLAMWDFDHCDP
Sbjct: 1   MGKGKNKMHEPKNGRPQRGANGHSSRQNHRRMEMKY--DNSEKMKFPVKLAMWDFDHCDP 58

Query: 61  KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWARLD 120
           KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNG+GVVCP+D  IVE+HGASVVECSWARL+
Sbjct: 59  KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWARLE 118

Query: 121 EVPFGRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLSNFSW 180
           EVPF +IGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR D ASELLS+FSW
Sbjct: 119 EVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSW 178

Query: 181 GLGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKEEDIWMMGNVNRR 240
           G+GFLELNKELLEIYQQCTD DSVK AEE WL+K+E+E Q+RK ++KEEDIWMMGN+NRR
Sbjct: 179 GMGFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIWMMGNINRR 238

>Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {ON}
           complement(54258..55358) [1101 nt, 367 aa]
          Length = 366

 Score =  422 bits (1084), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 196/245 (80%), Positives = 218/245 (88%), Gaps = 1/245 (0%)

Query: 1   MGKGKNKNHEERSSRPHRGANGHSSRLNHKRMEMKR-GGDSSAGNKFPVKLAMWDFDHCD 59
           M KGKNK HE R+ +P RG+NGHSS+LNHK MEMK+ G + S  +KFPVKLAMWDFDHCD
Sbjct: 1   MAKGKNKQHEARTGKPSRGSNGHSSKLNHKHMEMKKYGKNISQDDKFPVKLAMWDFDHCD 60

Query: 60  PKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWARL 119
           PKRCSGK+LERLGLIKSLRVGQKFQG+VVSPNG+GV+CPNDR IVEE GASVVECSWARL
Sbjct: 61  PKRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWARL 120

Query: 120 DEVPFGRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLSNFS 179
           DEVPF +IGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR D A+ELLSNFS
Sbjct: 121 DEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLSNFS 180

Query: 180 WGLGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKEEDIWMMGNVNR 239
           WGLGFLE+N+ELL+IYQQCTD++SVK AEE WL KIE+E Q+RK Q++E DIWMMGN NR
Sbjct: 181 WGLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIWMMGNTNR 240

Query: 240 RRTCD 244
               D
Sbjct: 241 NMNGD 245

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 9/60 (15%)

Query: 368 YDSLGNIIEKHSKETDFKT------TRHNSFGSTTSSEEDEYIEELHTKKEAKYDSFGNI 421
           YD+LGNIIE      D+         +++S G+   + + E  EE   +KE +YDS GN+
Sbjct: 273 YDNLGNIIESEEDYDDYDDEEDRVEVKYDSLGNIIENSDYEQYEE---EKELRYDSLGNL 329

>TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19
           YOR006C
          Length = 301

 Score =  419 bits (1077), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 199/242 (82%), Positives = 218/242 (90%), Gaps = 3/242 (1%)

Query: 1   MGKGKNKNHEERSSRPHRGANGHSSRLNHKRMEMKRGGDSSAGNKFPVKLAMWDFDHCDP 60
           M KGKNKN E ++    +G+NGHSSR NHKRMEMKRG + +   KFPVKLAMWDFDHCDP
Sbjct: 1   MSKGKNKNREAKNGHSGKGSNGHSSRQNHKRMEMKRGTEDT---KFPVKLAMWDFDHCDP 57

Query: 61  KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWARLD 120
           KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNG GVVCP+D+ IVEEHGASVVECSWARLD
Sbjct: 58  KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSWARLD 117

Query: 121 EVPFGRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLSNFSW 180
           EVPF +IGGKHERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGR D ASELLS+FSW
Sbjct: 118 EVPFNKIGGKHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSHFSW 177

Query: 181 GLGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKEEDIWMMGNVNRR 240
           GLGFLELN+ELLEIYQQCTDADSVKAAE AWL KI++E ++RK Q+K+EDIWM GNVNR+
Sbjct: 178 GLGFLELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEERKSQAKDEDIWMTGNVNRK 237

Query: 241 RT 242
            T
Sbjct: 238 GT 239

>Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {ON}
           YOR006C (REAL)
          Length = 336

 Score =  417 bits (1073), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 197/240 (82%), Positives = 217/240 (90%), Gaps = 2/240 (0%)

Query: 1   MGKGKNKNHEERSSRPHRGANGHSSRLNHKRMEMKRGGDSSAGNKFPVKLAMWDFDHCDP 60
           MGKGKNK HE ++ RP RGANGHSSR NHKRMEMK   D+S    FPVKLAMWDFDHCDP
Sbjct: 25  MGKGKNKTHEPKNGRPQRGANGHSSRQNHKRMEMKY--DNSEMTNFPVKLAMWDFDHCDP 82

Query: 61  KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWARLD 120
           KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNG GVVCP+D  +VE+HGASVVECSWARL+
Sbjct: 83  KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWARLE 142

Query: 121 EVPFGRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLSNFSW 180
           EVPF +IGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR D AS LLS+FSW
Sbjct: 143 EVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLSHFSW 202

Query: 181 GLGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKEEDIWMMGNVNRR 240
           GLGFL+LN+ELLEIYQ+CTD++SVK AEE WL+K+E+E Q+RK QSK+EDIWMMGNVNR+
Sbjct: 203 GLGFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKETQERKSQSKDEDIWMMGNVNRK 262

>KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {ON}
           Anc_6.19 YOR006C
          Length = 307

 Score =  416 bits (1069), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 198/239 (82%), Positives = 216/239 (90%), Gaps = 2/239 (0%)

Query: 2   GKGKNKNHEERSSR-PHRGANGHSSRLNHKRMEMKRGGDSSAGNKFPVKLAMWDFDHCDP 60
           GKGKNK+  + +SR  H+G+NGHSSRLNHKRME+ R  D   G KFPVK+AMWDFDHCDP
Sbjct: 4   GKGKNKSRGDETSRGSHKGSNGHSSRLNHKRMEL-RQHDGVKGTKFPVKMAMWDFDHCDP 62

Query: 61  KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWARLD 120
           KRCSGKKLERLGLI SL+VGQKFQGIVVSPNG+GVVCP+DR IVEE GASVVECSWARLD
Sbjct: 63  KRCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWARLD 122

Query: 121 EVPFGRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLSNFSW 180
           EVPF RIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR DLAS+LLSNFSW
Sbjct: 123 EVPFNRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLSNFSW 182

Query: 181 GLGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKEEDIWMMGNVNR 239
           GLGFLELNKELLE+YQ+CTD +SVK AEE WL KIEEEAQQRK ++++ DIWMMGNVNR
Sbjct: 183 GLGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRKNEARDGDIWMMGNVNR 241

>ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar to
           uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 281

 Score =  414 bits (1065), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 196/240 (81%), Positives = 214/240 (89%), Gaps = 1/240 (0%)

Query: 1   MGKGKNKNHEERSSRPHRGANGHSSRLNHKRMEMKRGGDSSAG-NKFPVKLAMWDFDHCD 59
           MGKGKNKNHE RS+RP RGANGH+S+ NHK MEMK GG S++    FPVKL MWDFDHCD
Sbjct: 1   MGKGKNKNHEVRSTRPGRGANGHNSKQNHKHMEMKHGGASNSNKTNFPVKLGMWDFDHCD 60

Query: 60  PKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWARL 119
           PKRCSGKKLERLGLI+SLRVGQKFQG+VV+PNG GVVCPND+ IVEEHGASVVECSWARL
Sbjct: 61  PKRCSGKKLERLGLIRSLRVGQKFQGVVVTPNGTGVVCPNDKSIVEEHGASVVECSWARL 120

Query: 120 DEVPFGRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLSNFS 179
           DEVPF RIGG+HERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGR D ASELLSNFS
Sbjct: 121 DEVPFNRIGGRHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSNFS 180

Query: 180 WGLGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKEEDIWMMGNVNR 239
           +G  FLE+N ELLEIYQQCTDA+SVK AE AWL+KIE+E + RK Q+K EDIWM GNVNR
Sbjct: 181 YGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIWMTGNVNR 240

>KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 314

 Score =  412 bits (1060), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 198/241 (82%), Positives = 218/241 (90%), Gaps = 7/241 (2%)

Query: 1   MGKGKNKNHEERSSRP--HRGANGHSSRLNHKRMEMKRGGDSSAGNKFPVKLAMWDFDHC 58
           MGKGKNK   E S+RP   +G+NGHSSRLNHKRMEMK     S  +KFPVKLAMWDFDHC
Sbjct: 1   MGKGKNK---ESSTRPRSQKGSNGHSSRLNHKRMEMKHV--DSTTSKFPVKLAMWDFDHC 55

Query: 59  DPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWAR 118
           DPKRCSGKKLERLGLIKSLRVGQKFQG+VVSPNG+ VVCP+D+ +VEE+GASVVECSWAR
Sbjct: 56  DPKRCSGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWAR 115

Query: 119 LDEVPFGRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLSNF 178
           LDEVPF +IGGK+ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLA++LLSNF
Sbjct: 116 LDEVPFNKIGGKNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLSNF 175

Query: 179 SWGLGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKEEDIWMMGNVN 238
           SWG  FLELNKELL+IYQQCTD DSVKAAEE WL+KIE+EA +RKQQ+K EDIWM+GNVN
Sbjct: 176 SWGPAFLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIERKQQAKTEDIWMIGNVN 235

Query: 239 R 239
           R
Sbjct: 236 R 236

>Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  410 bits (1054), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 193/240 (80%), Positives = 214/240 (89%), Gaps = 2/240 (0%)

Query: 1   MGKGKNKNHEERSSRPHRGANGHSSRLNHKRMEMKRGGDSSAGNKFPVKLAMWDFDHCDP 60
           MGKGKNK HE ++ R  RGANGHS+R NHK MEMK   D S   KFPVKLAMWDFDHCDP
Sbjct: 1   MGKGKNKTHEPKNERQQRGANGHSARQNHKHMEMKY--DKSEKMKFPVKLAMWDFDHCDP 58

Query: 61  KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWARLD 120
           KRCSGKKLERLGLI+SLRVGQKFQG+VVSPNG+GVVCPND  IVE+HGASVVECSWARL+
Sbjct: 59  KRCSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWARLE 118

Query: 121 EVPFGRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLSNFSW 180
           EVPF +IGGK+ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVG+ D ASELLS+FSW
Sbjct: 119 EVPFNKIGGKYERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLSHFSW 178

Query: 181 GLGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKEEDIWMMGNVNRR 240
           GLGFL+LNKELLEIYQ+CTDADSVK AE+ WL+K+E E Q+RK  +K+ DIWMMGN+NRR
Sbjct: 179 GLGFLDLNKELLEIYQRCTDADSVKKAEKEWLEKLEMETQERKSHTKKTDIWMMGNINRR 238

>TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON}
           Anc_6.19 YOR006C
          Length = 342

 Score =  404 bits (1039), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 189/243 (77%), Positives = 210/243 (86%), Gaps = 4/243 (1%)

Query: 1   MGKGKNKNHEERSSRPHRGANGHSSRLNHKRMEMKRGGDSSAGNK----FPVKLAMWDFD 56
           M KGKNK+ E RS +P RG+NGH +R NHKRMEMK     +  N     FPVKLAMWDFD
Sbjct: 1   MAKGKNKSSETRSGKPSRGSNGHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWDFD 60

Query: 57  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSW 116
           HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNG+GVVCP+D+  VEE GASVVECSW
Sbjct: 61  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSW 120

Query: 117 ARLDEVPFGRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLS 176
           ARLDEVPF +IGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR DLA+ELL 
Sbjct: 121 ARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELLE 180

Query: 177 NFSWGLGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKEEDIWMMGN 236
           +FSWGLGFLELNKELLE+YQ+CTD++SVK  EE WL+KI++E Q+RK QS+E DIW+ GN
Sbjct: 181 HFSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREGDIWLQGN 240

Query: 237 VNR 239
            NR
Sbjct: 241 TNR 243

>Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON}
           similar to Ashbya gossypii ACR007W
          Length = 349

 Score =  398 bits (1023), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 185/240 (77%), Positives = 215/240 (89%), Gaps = 4/240 (1%)

Query: 1   MGKGKNKNHEERSSRPHRGANGHSSRLNHKRMEMKRGGDSSAGNKFPVKLAMWDFDHCDP 60
           MGKG+NK++++  S+  +G+NGHSSR NH+R+E K   ++  G+KFPV LAMWDFDHCDP
Sbjct: 1   MGKGRNKDYDKNHSQ--KGSNGHSSRTNHRRIETKY--NAIQGSKFPVTLAMWDFDHCDP 56

Query: 61  KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWARLD 120
           KRCSGKKLERLGLIKSLRV QKFQGIVVSPNG+ VVCPNDR I E++G SVVECSWARL+
Sbjct: 57  KRCSGKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWARLE 116

Query: 121 EVPFGRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLSNFSW 180
           E+PF +IGG+HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR DLA  LLS+FSW
Sbjct: 117 EIPFEKIGGRHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFSW 176

Query: 181 GLGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKEEDIWMMGNVNRR 240
           GLGFLELNKE+LEIYQ+CTD DS+KAAEEAWLK+IE EA +R++Q+KE DIWMMGNVNR+
Sbjct: 177 GLGFLELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIWMMGNVNRK 236

>ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR006C
          Length = 313

 Score =  396 bits (1018), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 183/240 (76%), Positives = 211/240 (87%), Gaps = 3/240 (1%)

Query: 1   MGKGKNKNHEERSSRPHRGANGHSSRLNHKRMEMKRGGDSSAGNKFPVKLAMWDFDHCDP 60
           M KGKNK  EER  +P +G++ H+ + N +R E+K G   +   +FP KLAMWDFDHCDP
Sbjct: 1   MAKGKNKKTEERQ-KPAKGSSKHNGKSNQRRTELKHG--HTKETEFPAKLAMWDFDHCDP 57

Query: 61  KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWARLD 120
           KRCSGKKLERLGLIKSLR+GQKFQGIVVSPNG+ VVCPND+ IVE+HG SVVECSWARLD
Sbjct: 58  KRCSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLD 117

Query: 121 EVPFGRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLSNFSW 180
           E+PF +IGG+HERLLPYLVAANQVNYGRPWRLNCVEA+AACFAIVGRTDLA ELLS+FSW
Sbjct: 118 EIPFSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSW 177

Query: 181 GLGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKEEDIWMMGNVNRR 240
           G GFLELN+ELLE YQQCTD  S+KAAEEAWL+K+EEEA+QR++Q+ EEDIWMMGNVNR+
Sbjct: 178 GPGFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRK 237

>CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006c
          Length = 325

 Score =  395 bits (1015), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 185/238 (77%), Positives = 209/238 (87%), Gaps = 1/238 (0%)

Query: 2   GKGKNKNHEERSSRPHRGANGHSSRLNHKRMEMKRGGDSSAGNKFPVKLAMWDFDHCDPK 61
           GKGKNK+H+E  S    G+NGH +R NH+ MEMK  G  S  + FPVKLAMWDFDHCDPK
Sbjct: 4   GKGKNKSHDEGRSNKSGGSNGHHTRRNHRHMEMKYCG-GSKDSSFPVKLAMWDFDHCDPK 62

Query: 62  RCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWARLDE 121
           RCSGKKLERLGLIKSLRVGQKFQGIVVSPNG+ VVCP+DR IVE HGASVVECSWARL+E
Sbjct: 63  RCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWARLEE 122

Query: 122 VPFGRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLSNFSWG 181
           VPF +IGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLA ELLS+FSWG
Sbjct: 123 VPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSHFSWG 182

Query: 182 LGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKEEDIWMMGNVNR 239
           LGFLELNK+LLE YQQCTD++S+K  EE WL++I++E Q+RK +++ ED+WMMGN NR
Sbjct: 183 LGFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERKLKAQTEDVWMMGNTNR 240

>KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} similar
           to uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 346

 Score =  374 bits (960), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 177/240 (73%), Positives = 208/240 (86%), Gaps = 6/240 (2%)

Query: 2   GKGKNKNHEERSSRPHRGANGHSSRLNHKRMEMKRGGDSSAGNKFPVKLAMWDFDHCDPK 61
           GKG NK     SS+P   ++GH+S   H+ +E K G + S G  FPVKLAMWDFD CDPK
Sbjct: 7   GKGSNKQRGAHSSKP---SSGHTS--THRHVESKHGANKS-GKNFPVKLAMWDFDQCDPK 60

Query: 62  RCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWARLDE 121
           RCSGKKLERLG+IKSLRVGQKFQGIVVSPNG+ VVCPNDR IVEE+GA+VVECSWARLDE
Sbjct: 61  RCSGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWARLDE 120

Query: 122 VPFGRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLSNFSWG 181
           VPF +IGG++ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR DLA+ELLS+FSWG
Sbjct: 121 VPFNKIGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSHFSWG 180

Query: 182 LGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKEEDIWMMGNVNRRR 241
           L FLELNKELLE+YQ+CTDADS+K AE+AWL++IE+EAQ+RK ++  +D+W+ GNVN ++
Sbjct: 181 LQFLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERKARNPGDDLWLTGNVNHKK 240

>NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON}
           Anc_6.19 YOR006C
          Length = 323

 Score =  369 bits (946), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 170/247 (68%), Positives = 208/247 (84%), Gaps = 8/247 (3%)

Query: 1   MGKGKNKNHEERSS--RPHRGANGHSSRLNHKRMEMKR--GGDSSAGNKFPVKLAMWDFD 56
           MGKGKNK  ++  S  R HRGANGHSSR NHK MEM++    D+S   K PVKL MWDFD
Sbjct: 1   MGKGKNKKRDDGDSKGRQHRGANGHSSRHNHKNMEMRKHENEDTSNVKKIPVKLGMWDFD 60

Query: 57  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSW 116
           HCDPKRCSGKKLERLGLIKSL++GQ+FQG+++SPNG+ VV P D  I++E GA+VVECSW
Sbjct: 61  HCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPEDADIIKEFGAAVVECSW 120

Query: 117 ARLDEVPFGRI----GGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAS 172
           ARLDE+PF ++    GGK+ERLLPYLVAANQVNYGRPW+LNCVEALAACFAI+GR+D A+
Sbjct: 121 ARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEALAACFAIIGRSDWAA 180

Query: 173 ELLSNFSWGLGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKEEDIW 232
           +LLSNFSWG+ FL LN+EL E+Y QCTD+DS++ A+EAWL KI+EEA++RK Q+++ DIW
Sbjct: 181 DLLSNFSWGMNFLTLNEELFELYSQCTDSDSIQEAQEAWLNKIDEEAKERKLQAQDNDIW 240

Query: 233 MMGNVNR 239
           +MGN NR
Sbjct: 241 LMGNTNR 247

>NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {ON}
           Anc_6.19 YOR006C
          Length = 401

 Score =  369 bits (947), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 174/261 (66%), Positives = 211/261 (80%), Gaps = 22/261 (8%)

Query: 1   MGKGKNKNHEE--RSSRPHRGANGHSSRLNHKRMEMKRGGDSSAGN-------------- 44
           MGKGKNK+ ++  ++ R HRGANGHSSR NHK MEMK+  D ++                
Sbjct: 45  MGKGKNKSRDDGPKNPRAHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHS 104

Query: 45  --KFPVKLAMWDFDHCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRV 102
             K PVKL MWDFDHCDPKRCSGKKLERLGLIKSL++GQ+FQG+++SPNG+ VV P+D  
Sbjct: 105 VKKIPVKLGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDAD 164

Query: 103 IVEEHGASVVECSWARLDEVPFGRI----GGKHERLLPYLVAANQVNYGRPWRLNCVEAL 158
           I++E GA+VVECSWARLDE+PF ++    GGK+ERLLPYLVAANQVNYGRPW+LNCVEAL
Sbjct: 165 IIKEFGAAVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEAL 224

Query: 159 AACFAIVGRTDLASELLSNFSWGLGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEE 218
           AACFAI+GR+D AS+LLSNFSWGL FL+LN+EL E+Y +CTD+DSVKAA+E WL KIE+E
Sbjct: 225 AACFAIIGRSDWASDLLSNFSWGLNFLKLNEELFELYSKCTDSDSVKAAQEEWLDKIEQE 284

Query: 219 AQQRKQQSKEEDIWMMGNVNR 239
           A +RK Q++E DIWMMGN NR
Sbjct: 285 ATERKLQAQETDIWMMGNTNR 305

>Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {ON}
           YOR006C - Hypothetical ORF [contig 185] FULL
          Length = 337

 Score =  364 bits (934), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 170/233 (72%), Positives = 201/233 (86%), Gaps = 5/233 (2%)

Query: 12  RSSRPHRGAN----GHSSRLNHKRMEMKRGGDSSAGNKFPVKLAMWDFDHCDPKRCSGKK 67
           +  R ++G+N    GHS+R +   +E K G  ++ G  FPVKLAMWDFD CDPKRCSGKK
Sbjct: 3   KGGRSNKGSNKVRTGHSNRSSSGYVETKHGAHNN-GRNFPVKLAMWDFDQCDPKRCSGKK 61

Query: 68  LERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWARLDEVPFGRI 127
           LERLG+IKSLRVGQKFQGIVVSPNG+GVVCPND+ IVEE GA+VVECSWARL+E+PF +I
Sbjct: 62  LERLGIIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIPFNKI 121

Query: 128 GGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLSNFSWGLGFLEL 187
           GG++ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR DLA+ELL++FSWGLGFLEL
Sbjct: 122 GGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLGFLEL 181

Query: 188 NKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKEEDIWMMGNVNRR 240
           NKEL+E+YQ+CTDA+SVK AE +WL+KIE EA +R+  S  +D+WM GNVNRR
Sbjct: 182 NKELIEVYQKCTDAESVKEAEASWLEKIEREANERRNHSATDDLWMTGNVNRR 234

>KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}
           Anc_6.19 YOR006C
          Length = 329

 Score =  317 bits (812), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 149/223 (66%), Positives = 180/223 (80%), Gaps = 5/223 (2%)

Query: 20  ANGHSSRLNHKRMEMKRGGDSSAGNKFPVKLAMWDFDHCDPKRCSGKKLERLGLIKSLRV 79
           +NGH SR N+K+ME K+    S    FPVKLAMWDFDHCDPKRCSGKKLERL LI+SL++
Sbjct: 23  SNGHHSRHNNKKMEFKQ--HVSRETSFPVKLAMWDFDHCDPKRCSGKKLERLNLIRSLKI 80

Query: 80  GQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWARLDEVPFGRIGG-KHERLLPYL 138
            QKFQGI VSPNG+  V P DR +V E G +VVECSWAR+DE+PF +    K +RLLPYL
Sbjct: 81  NQKFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKFSTPKLDRLLPYL 140

Query: 139 VAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLSNFSWGLGFLELNKELLEIYQQC 198
           VAANQVNYGRPW+LNCVEA+AAC AIVG  DLA ELLS+FSWG+ FL+LN+ELLEIYQQC
Sbjct: 141 VAANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKLNRELLEIYQQC 200

Query: 199 TDADSVKAAEEAWLKKIEEEAQQRKQQSKEE--DIWMMGNVNR 239
           TD+D ++AA++AW+ +IE+E Q+RK  +  +  DIWM GNVNR
Sbjct: 201 TDSDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVNR 243

>TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {ON}
           Anc_6.19 YOR006C
          Length = 304

 Score =  308 bits (788), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 150/246 (60%), Positives = 182/246 (73%), Gaps = 10/246 (4%)

Query: 1   MGKGKNKNHEERSSRPHRGANGHSSRLNHKRMEMKRGGDSSAGNKFPVKLAMWDFDHCDP 60
           M KGKNK HEERS+R       ++SR N  +  +      S    FPVKLAMWDFDHCDP
Sbjct: 1   MAKGKNKGHEERSNR-----KSNNSRRNESKHSLSI---KSTKTNFPVKLAMWDFDHCDP 52

Query: 61  KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWARLD 120
           KRCSGKKLER GL +SLRVGQ+F G+VVSPNG+ VV P DR  +E++G +VVECSWARLD
Sbjct: 53  KRCSGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPADRETIEQYGIAVVECSWARLD 112

Query: 121 EVPFGRIGGK--HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLSNF 178
           EVPF ++GGK  +E LLPYLVAAN VNYGRPWRLNCVEA AAC AIVG  + AS++L  F
Sbjct: 113 EVPFNKLGGKPSNEVLLPYLVAANPVNYGRPWRLNCVEAFAACLAIVGFKEYASKVLEGF 172

Query: 179 SWGLGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKEEDIWMMGNVN 238
           SWG  FLELN ELL+IY  CTD+ SV+ A++ WL+KIE E ++RK++    D W++GN N
Sbjct: 173 SWGHAFLELNDELLDIYGNCTDSISVEKAQDEWLEKIELENKERKEKMNSADAWLIGNTN 232

Query: 239 RRRTCD 244
           R+   D
Sbjct: 233 RKNLND 238

>CAGL0E03454g Chr5 complement(316082..318685) [2604 bp, 867 aa] {ON}
           similar to uniprot|Q06704 Saccharomyces cerevisiae
           YLR309c IMH1
          Length = 867

 Score = 37.4 bits (85), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 52/103 (50%), Gaps = 4/103 (3%)

Query: 130 KHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLSNFSWGLGFLE--L 187
           K+E+  P L+ A +    +  ++  +E + A    VG  D A E L  F   L      L
Sbjct: 55  KYEQKYPLLLQAYKTEKSKSEKIEALEKILAENTPVGNLDDAVESLPTFFKNLNDKNSML 114

Query: 188 NKEL--LEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKE 228
           N+E+  L + Q+ TD D    A EA ++++EE+ + + + SKE
Sbjct: 115 NEEIKRLTMEQKKTDNDEQNDANEAKIRELEEQLETQNRNSKE 157

>NDAI0I01310 Chr9 (316912..317745) [834 bp, 277 aa] {ON} Anc_6.171
           YPL178W
          Length = 277

 Score = 30.4 bits (67), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 5/52 (9%)

Query: 369 DSLGNII--EKHSKETDFKTTRHNSFGSTTSSEEDEYIEELHTKKEAKYDSF 418
           D LGNII  E   KE  F    ++ FG   +  +DEYI++   K E ++D++
Sbjct: 225 DGLGNIIKEEDRIKEEGFD---NDGFGGMKTENQDEYIKKEEIKDEDQHDTY 273

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,461,262
Number of extensions: 1439995
Number of successful extensions: 6960
Number of sequences better than 10.0: 27
Number of HSP's gapped: 7054
Number of HSP's successfully gapped: 36
Length of query: 430
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 318
Effective length of database: 40,638,807
Effective search space: 12923140626
Effective search space used: 12923140626
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 67 (30.4 bits)