Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E01100g6.17ON71071034750.0
Ecym_30216.17ON67471818380.0
Kwal_56.224116.17ON68971718320.0
KLTH0C11308g6.17ON69071218310.0
ACR009W6.17ON68072217130.0
ZYRO0C07876g6.17ON68171916730.0
KLLA0D01067g6.17ON66071116590.0
TDEL0G045206.17ON67971916140.0
Kpol_1045.726.17ON69572214760.0
Skud_5.276.17ON61557813461e-178
YEL062W (NPR2)6.17ON61551313261e-175
Smik_5.256.17ON61551613181e-173
TPHA0J003106.17ON67573413201e-173
NCAS0H008706.17ON61271312801e-168
CAGL0L13288g6.17ON64671612801e-167
TBLA0G010106.17ON71051512521e-162
KNAG0M011406.17ON59455812281e-160
NDAI0D008606.17ON66652212301e-160
Suva_5.56.17ON61936211491e-148
KAFR0L003806.17ON54055111241e-145
Skud_9.352.229ON21092780.59
YIL132C (CSM2)2.229ON213120751.1
Kpol_1008.211.358ON79845743.0
Suva_9.572.229ON21392723.3
Kwal_23.51428.94ON874110724.7
NCAS0E014403.196ON66570709.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E01100g
         (710 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON...  1343   0.0  
Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON} s...   712   0.0  
Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {...   710   0.0  
KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} simila...   709   0.0  
ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic ho...   664   0.0  
ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} simila...   649   0.0  
KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON...   643   0.0  
TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.1...   626   0.0  
Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON} (1670...   573   0.0  
Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)   523   e-178
YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit ...   515   e-175
Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON...   512   e-173
TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON...   513   e-173
NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.1...   497   e-168
CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa...   497   e-167
TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {O...   486   e-162
KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {...   477   e-160
NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.1...   478   e-160
Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)    447   e-148
KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON...   437   e-145
Skud_9.35 Chr9 complement(77052..77684) [633 bp, 210 aa] {ON} YI...    35   0.59 
YIL132C Chr9 complement(99860..100501) [642 bp, 213 aa] {ON}  CS...    33   1.1  
Kpol_1008.21 s1008 (41825..44221) [2397 bp, 798 aa] {ON} (41825....    33   3.0  
Suva_9.57 Chr9 complement(94631..95272) [642 bp, 213 aa] {ON} YI...    32   3.3  
Kwal_23.5142 s23 (1031446..1034070) [2625 bp, 874 aa] {ON} YFR00...    32   4.7  
NCAS0E01440 Chr5 (274594..276591) [1998 bp, 665 aa] {ON} Anc_3.1...    32   9.6  

>SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 710

 Score = 1343 bits (3475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 663/710 (93%), Positives = 663/710 (93%)

Query: 1   MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKL 60
           MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKL
Sbjct: 1   MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKL 60

Query: 61  LTFKYGPYRLACYPVNVNASYYARNSXXXXXXXXXPYNCATSPYEPAVARLGKMFRVLEE 120
           LTFKYGPYRLACYPVNVNASYYARNS         PYNCATSPYEPAVARLGKMFRVLEE
Sbjct: 61  LTFKYGPYRLACYPVNVNASYYARNSFNFNFVFVFPYNCATSPYEPAVARLGKMFRVLEE 120

Query: 121 QSQILSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDTEQGTGLNNSQDSKEQGKI 180
           QSQILSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDTEQGTGLNNSQDSKEQGKI
Sbjct: 121 QSQILSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDTEQGTGLNNSQDSKEQGKI 180

Query: 181 EGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLFPL 240
           EGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLFPL
Sbjct: 181 EGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLFPL 240

Query: 241 LAPPNSCLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTDLVI 300
           LAPPNSCLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTDLVI
Sbjct: 241 LAPPNSCLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTDLVI 300

Query: 301 ECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVTSSDLELYRLPFE 360
           ECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVTSSDLELYRLPFE
Sbjct: 301 ECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVTSSDLELYRLPFE 360

Query: 361 SRPNLLSMHSSRKQNSSSTIHTVGVRNSPNRTNSLDYPSELSTRRNNFXXXXXXXLMRVR 420
           SRPNLLSMHSSRKQNSSSTIHTVGVRNSPNRTNSLDYPSELSTRRNNF       LMRVR
Sbjct: 361 SRPNLLSMHSSRKQNSSSTIHTVGVRNSPNRTNSLDYPSELSTRRNNFSSSSASSLMRVR 420

Query: 421 DRSGQSTTGSAVDEQESRLLLPTKSCLFDLYRSLHQGETVKEWYKINFEIIRDNHIDVRR 480
           DRSGQSTTGSAVDEQESRLLLPTKSCLFDLYRSLHQGETVKEWYKINFEIIRDNHIDVRR
Sbjct: 421 DRSGQSTTGSAVDEQESRLLLPTKSCLFDLYRSLHQGETVKEWYKINFEIIRDNHIDVRR 480

Query: 481 FITFGIVRGLIYRCYAYPVMKNLGALEMLKTLKSASDSRSLRRKLKFREKKNFTNNVFST 540
           FITFGIVRGLIYRCYAYPVMKNLGALEMLKTLKSASDSRSLRRKLKFREKKNFTNNVFST
Sbjct: 481 FITFGIVRGLIYRCYAYPVMKNLGALEMLKTLKSASDSRSLRRKLKFREKKNFTNNVFST 540

Query: 541 ADIKVDLEHSPGGAPAEIFNRKHTSNVDMAEEVLKDAYKKLSIIESMDDNLYHVHNPMSR 600
           ADIKVDLEHSPGGAPAEIFNRKHTSNVDMAEEVLKDAYKKLSIIESMDDNLYHVHNPMSR
Sbjct: 541 ADIKVDLEHSPGGAPAEIFNRKHTSNVDMAEEVLKDAYKKLSIIESMDDNLYHVHNPMSR 600

Query: 601 LYGHDXXXXXXXXXXXXXXXXXXXXMESETRSKVAFEKGRSPWQVXXXXXXXXXXXVSNL 660
           LYGHD                    MESETRSKVAFEKGRSPWQV           VSNL
Sbjct: 601 LYGHDSGESSTKGSRKGSRKGSSSTMESETRSKVAFEKGRSPWQVEEDEKKERTEEVSNL 660

Query: 661 LKEKRHEEFLLLKSVKSVDTFDKICMRLEKDREEVEQLLKEMGHYNIINS 710
           LKEKRHEEFLLLKSVKSVDTFDKICMRLEKDREEVEQLLKEMGHYNIINS
Sbjct: 661 LKEKRHEEFLLLKSVKSVDTFDKICMRLEKDREEVEQLLKEMGHYNIINS 710

>Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON}
           similar to Ashbya gossypii ACR009W
          Length = 674

 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/718 (53%), Positives = 480/718 (66%), Gaps = 52/718 (7%)

Query: 1   MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKL 60
           MS+HFDGFVPIH++FYS+FHPTEGTKVR+QFPP +LEN+ I+FDTIKNYVIPKPQLCNKL
Sbjct: 1   MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKL 60

Query: 61  LTFKYGPYRLACYPVNVNASYYARNSXXXXXXXXXPYNCATSPYEPAVARLGKMFRVLEE 120
           LTFKYG YRL CYPVN+NASYYARNS         PY+ ATSPYEPA+ RLGKMFRVLEE
Sbjct: 61  LTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEE 120

Query: 121 QSQILSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDTEQGTGLNNSQDSKEQGKI 180
           QSQ+LSK E DP+Y+HLK+Q+         VDQ       ++E+    NN Q+  ++ + 
Sbjct: 121 QSQVLSKIERDPIYYHLKTQDVKA------VDQ-------NSEEPESKNNPQNCNDKIRR 167

Query: 181 EGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLFPL 240
                A EKYHEIM  +   +K+LSIEDLITKLY+DLNNYSEC IP+DSGN++DIKLFPL
Sbjct: 168 GHHEHAFEKYHEIMKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPL 227

Query: 241 LAPPNSCLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTDLVI 300
           LAPPNSC S EDVPI+ +NL   +DVNWDPTM+KIVP+ING+NSIAKI+K+S SD  LV+
Sbjct: 228 LAPPNSCFSVEDVPIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVM 287

Query: 301 ECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVTSS-DLELYRLPF 359
           ECVKHLIYY+CVVL D+FQFSNIYA TS +SEFLTDP++A ECQ YV SS D EL++LPF
Sbjct: 288 ECVKHLIYYDCVVLVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQLPF 347

Query: 360 ESRPNLLSMHSSRKQNSSSTIHTV--GVRNSPNRTNSLDYPSELSTRRNNFXXXXXXXLM 417
           E RPN  + HS     S+ T  T+   +  +P R  S    +E + + N          +
Sbjct: 348 EGRPN--ANHSRNPTASTITFGTLKRTIYTNP-RPESFSSNTEFAQKPN------ANTSL 398

Query: 418 RVRDRSGQSTTGSAVDEQESRLL----LPTKSCLFDLYRSLHQGETVKEWYKINFEIIRD 473
                   S+  S  + + ++ +    LPT+SCLFDLYRSL QG+T+K+WYK+NFE+IR 
Sbjct: 399 PSEPSITHSSKNSEFNHENNKGILNRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRK 458

Query: 474 NHIDVRRFITFGIVRGLIYRCYAYPVMKNLGALEMLKTLKSASDSRSLRRKLKFREKKNF 533
           N IDVRRFITFG+ R LIYRCY+YPV K++G L+MLK    AS   +         K N 
Sbjct: 459 NRIDVRRFITFGVFRKLIYRCYSYPVAKSIGTLDMLKRFDYASLPNNF-----MSPKNNN 513

Query: 534 TNNVFSTADIKVDLEHSPGGAPAEIFNRKHTSNVDMAEEVLKDAYKKLSIIESMDDNLYH 593
           +NNVFSTADI VD      G P++   +    N D A+EVL+DAYKKLS+ E + + L  
Sbjct: 514 SNNVFSTADICVDF-----GEPSQFRKKPLVPNTDAADEVLRDAYKKLSLNERLPNPLDQ 568

Query: 594 VHNPMSRLYGHDXXXXXXXXXXXXXXXXXXXXMESETRSKVAFE-KGRSPWQVXXXXXXX 652
           +         +D                      +   +KV F+ K R            
Sbjct: 569 ITRSKKLSLENDASANVDNRKLSS---------STSGTAKVLFDMKDR---LSNKDFEYR 616

Query: 653 XXXXVSNLLKEKRHEEFLLLKSVKSVDTFDKICMRLEKDREEVEQLLKEMGHYNIINS 710
                S  LK KR ++FLLLKS+K+VD+FDKI ++LE +++EVE+LLK  G YNIINS
Sbjct: 617 DQNAASTELKRKRQQQFLLLKSIKNVDSFDKIAIKLEINKQEVEELLKATGEYNIINS 674

>Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {ON}
           YEL062W (NPR2) - Non-membrane-embedded, PEST
           sequence-containing protein [contig 185] FULL
          Length = 689

 Score =  710 bits (1832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/717 (52%), Positives = 480/717 (66%), Gaps = 37/717 (5%)

Query: 1   MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKL 60
           MS HFDGFVP+H + Y++FHPTEGTKVR+QFPP  LE +DI FDTIKNYVIPKPQLCNKL
Sbjct: 1   MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKL 60

Query: 61  LTFKYGPYRLACYPVNVNASYYARNSXXXXXXXXXPYNCATSPYEPAVARLGKMFRVLEE 120
           LTFKYG +RL CYPVNV A YYARNS         PY+CATSPYE A+ARLGKMF VLEE
Sbjct: 61  LTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEE 120

Query: 121 QSQILSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDTE-QGTGLNNSQDSKEQGK 179
           QSQILSKAEN  VYF LK+++S  +++  PV+        D E QGT  NN     E  +
Sbjct: 121 QSQILSKAENSHVYFQLKTRDSHKHTNQEPVN--------DNELQGTLKNN-----EASQ 167

Query: 180 IEGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLFP 239
            E  G A EKYHEI+ DL    KR+S+EDLITK+Y+DLNNYSEC IPIDSGN+VDIKLFP
Sbjct: 168 SESHGYAFEKYHEILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKLFP 227

Query: 240 LLAPPNSCLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTDLV 299
           LL+PP+SCLSFEDVP+ TVNLAKLIDVNWDPTMLKIVP+ING NSIAK+AK S SD +LV
Sbjct: 228 LLSPPSSCLSFEDVPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLV 287

Query: 300 IECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVT-SSDLELYRLP 358
           +EC++HL+YYNCV+LADIFQF NIYA TS +S FLT+P LA+ECQ YVT      +  LP
Sbjct: 288 VECIRHLLYYNCVILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLP 347

Query: 359 FESRPNLLSMHSSRKQNSSSTIHT------VGVRNSPNRTNSLDYPSELSTRRNNFXXXX 412
           FE +P+  + ++   +NSSST+        + ++ S + T  +D      + RN +    
Sbjct: 348 FERKPSRTTYNNIPVRNSSSTLDVQRKGREMSIKES-SFTAGID-----QSGRNQYTPQS 401

Query: 413 XXXLMRVRDRSGQSTTGSAVDEQESRLLLPTKSCLFDLYRSLHQGETVKEWYKINFEIIR 472
               ++  + S  ++ G++     +++   +KSCLFD+YRSL QG+TVKEWYK +FE IR
Sbjct: 402 HTSSIQCHNVS-DASLGNSEGGFNNKVFFTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIR 460

Query: 473 DNHIDVRRFITFGIVRGLIYRCYAYPVMKNLGALEMLKTLKSASDSRSLRRKLKFREKKN 532
              IDVRRFITFG++ GL+YRCY++P+MKN+G LE++K L   SD  S            
Sbjct: 461 AARIDVRRFITFGVIHGLLYRCYSFPIMKNVGYLEVVKAL-GLSDGDSSTEGKWLSGNSE 519

Query: 533 FTNNVFSTADIKVDLEHSPGGAPAEIFNRKHTSNVDMAEEVLKDAYKKLSIIESMDDNLY 592
            TNNV S A+I++ LE S        FN  H SN D AE++L D Y+KL++ E+  +   
Sbjct: 520 PTNNVLSAAEIRIGLESSSSKLRERRFN--HFSNADTAEDILNDVYRKLALNENKVEQSS 577

Query: 593 HVHNPMSRLYGHDXXXXXXXXXXXXXXXXXXXXMESETRSKVAFEKGRSPWQVXXXXXXX 652
              NPM R++G+                       S+TR+ VAF+  R            
Sbjct: 578 QSGNPMMRMFGN----CSDDSSGETSVKDVVSTAGSDTRNTVAFDVRR--LVNSATAEDR 631

Query: 653 XXXXVSNLLKEKRHEEFLLLKSVKSVDTFDKICMRLEKDREEVEQLLKEMGHYNIIN 709
               V  L ++KR +E LLLKSV+ V+ FDKIC RL +DREEVE++L+++G YN+++
Sbjct: 632 KKGEVMRLEEDKRKDELLLLKSVRDVENFDKICTRLGRDREEVEKMLEDLGPYNVVH 688

>KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 690

 Score =  709 bits (1831), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/712 (52%), Positives = 479/712 (67%), Gaps = 24/712 (3%)

Query: 1   MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKL 60
           MS HFDGFVP+H +FYSVFHPTEGTKVR+QFP   LE +DI FDTIKNYVIPKPQLCNKL
Sbjct: 1   MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKL 60

Query: 61  LTFKYGPYRLACYPVNVNASYYARNSXXXXXXXXXPYNCATSPYEPAVARLGKMFRVLEE 120
           LTFKYGP+RL CYPVNV A YYARNS         PY+CATSPYEPA+ RLGKMF VLEE
Sbjct: 61  LTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEE 120

Query: 121 QSQILSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDTEQGTGLNNSQDSKEQGKI 180
           QSQILSKAEN  VYF LK++    N+  H    G ++  K TEQ + L    D  E  + 
Sbjct: 121 QSQILSKAENSSVYFQLKAR----NTQKH----GNTETAKGTEQPSSL----DIGEIAQP 168

Query: 181 EGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLFPL 240
           E QG A  KY+EI+ DLE   K+++I DLITK+Y+DLN+YSEC IPIDSGN+VDIKLFPL
Sbjct: 169 ENQGYASAKYYEILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKLFPL 228

Query: 241 LAPPNSCLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTDLVI 300
           L+PP+SC S EDVPISTVNLAKLIDVNWDPTMLKIVP ING+NSIAK+AKFS SD +LV+
Sbjct: 229 LSPPSSCFSIEDVPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVV 288

Query: 301 ECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVTSSD-LELYRLPF 359
           EC+KHLIYYNCV+L DIFQFSNIYAST+ +S FLT+PTLA+ECQ YV  ++   L  LPF
Sbjct: 289 ECIKHLIYYNCVILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPF 348

Query: 360 ESRPNLLSMHSSRKQNSSSTIHTV-GVRNSPNRTNSLDYPSELSTRRNNFXXXXXXXLMR 418
           E  P+     + R ++S+ T+  +   + +P R NS +   +  + ++          + 
Sbjct: 349 ERGPSRSGQGNIRDRSSNGTLDILRKGKQTPLRENSFNSGMDFLSNKHQHTPQSRSSSIP 408

Query: 419 VRDRSGQSTTGSAVDEQESRLLLPTKSCLFDLYRSLHQGETVKEWYKINFEIIRDNHIDV 478
             + S  S   S    +   +   +KSCLFDLYRSL QG+T++EWYK +FE IR   IDV
Sbjct: 409 YHNTSDASFGNSDAGLKGKLMPFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDV 468

Query: 479 RRFITFGIVRGLIYRCYAYPVMKNLGALEMLKTLKSASDSRSLRRKLKFREKKNFTNNVF 538
           RRFITFG++ GLIYR Y+YPV++N+G  E ++ L + + SR  + K   +  +   NNV 
Sbjct: 469 RRFITFGVLHGLIYRSYSYPVLRNIGFAESVEALGATNHSRYAKYKHLLKTNQPL-NNVL 527

Query: 539 STADIKVDLEHSPGGAPAEIFNRKHTSNVDMAEEVLKDAYKKLSIIESMDDNLYHVHNPM 598
           S ADI++ LE++   A +E    K  S  D AEEVL D Y+KL++ +   D++   +NP+
Sbjct: 528 SAADIRIGLENAGFKARSEKL--KQHSTADAAEEVLSDVYRKLALSDKKTDHVAQGNNPI 585

Query: 599 SRLYGHDXXXXXXXXXXXXXXXXXXXXMESETRSKVAFEKGRSPWQVXXXXXXXXXXXVS 658
           S+++G +                    M S+ ++KVAF+  ++               + 
Sbjct: 586 SKVFGRN-----SEDSTDISTRESANSMGSDIKNKVAFDVRKT--LATSSADERRRSEIL 638

Query: 659 NLLKEKRHEEFLLLKSVKSVDTFDKICMRLEKDREEVEQLLKEMGHYNIINS 710
             ++EKR+EE +LLKSV+SV  FDKIC  L KDRE VE +L E+G YN+++S
Sbjct: 639 RSIEEKRNEELILLKSVRSVHNFDKICTLLGKDRERVESMLSELGPYNVLHS 690

>ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL062W (NPR2)
          Length = 680

 Score =  664 bits (1713), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/722 (49%), Positives = 456/722 (63%), Gaps = 61/722 (8%)

Query: 1   MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKL 60
           M + FDGFVPIH +FY++FHPTEGTKVR+QFP  +LE + I FDTIKNYVIPK QLCNKL
Sbjct: 8   MPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKL 67

Query: 61  LTFKYGPYRLACYPVNVNASYYARNSXXXXXXXXXPYNCATSPYEPAVARLGKMFRVLEE 120
           +TFK+G YRL CYPVN+ A YYARNS         PY+ ATSPYEPA+ARL KM RVLEE
Sbjct: 68  VTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEE 127

Query: 121 QSQILSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDTEQGTGLNNSQDSKEQ--G 178
           QSQ+LSK E DPVY+ LK+ E+                 K  EQ T  ++S+        
Sbjct: 128 QSQMLSKVERDPVYYQLKTGET-----------------KAAEQKTEESDSKAKTHNLDK 170

Query: 179 KIEGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLF 238
           K   Q  A  KYHEIM  +   +K L IEDLITKLY+DLNNYSEC IP+DSGN++DIKLF
Sbjct: 171 KSRAQHNATTKYHEIMKHINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLF 230

Query: 239 PLLAPPNSCLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTDL 298
           PLL PPNSCLSFEDVPI+ VNL  L+DVNWDPTMLKIVPFING+NSIAKI+K S S  +L
Sbjct: 231 PLLTPPNSCLSFEDVPIAKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVEL 290

Query: 299 VIECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVTSS-DLELYRL 357
           V+EC+KHL+YY+CV L D+FQFSNIYA T+L+ +FL D  L  ECQ YV SS D E++RL
Sbjct: 291 VMECIKHLVYYDCVALVDMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRL 350

Query: 358 PFESRPNLLSMHSSRKQNSSSTIHTVGVRNSPNRTNSLDYPSELSTRRNNFXXXXXXXLM 417
           PFESRPN    HS  +  S++T++T+    S NR +S    +E S + +           
Sbjct: 351 PFESRPN--GGHSRNQTASTNTVYTLRRTTSTNRADSFSSNAEFSQKSSGISSL------ 402

Query: 418 RVRDRSGQSTTGSAVD---------EQESRLLLPTKSCLFDLYRSLHQGETVKEWYKINF 468
                  QS T S  D         E   +  LPT+  LFDLYRSL QG+T+KEWYK N+
Sbjct: 403 ------AQSFTQSNKDYYYNRSRNLESNCKRTLPTRRVLFDLYRSLTQGQTLKEWYKANY 456

Query: 469 EIIRDNHIDVRRFITFGIVRGLIYRCYAYPVMKNLGALEMLKTLKSASDSRSLRRKLKFR 528
             IR+N IDVRR I FG+   LIYRCY+YPV K++G LE+LK     S + +        
Sbjct: 457 SAIRENQIDVRRLIIFGVFHRLIYRCYSYPVAKSIGTLELLKRFDYVSTTDNF-----IP 511

Query: 529 EKKNFTNNVFSTADIKVDLEHSPGGAPAEIFNRKHTSNVDMAEEVLKDAYKKLSIIESMD 588
              +  NNVFST+DI+VD + S        F     ++ D+AEEVL++ Y+KLSI + ++
Sbjct: 512 TGTSAGNNVFSTSDIRVDFDGSSRSRNIPPF----LNSSDVAEEVLRETYQKLSIKDILN 567

Query: 589 DNLYHVHNPMSRLYGHDXXXXXXXXXXXXXXXXXXXXMESETRSKVAFEKGRSPWQVXXX 648
           D++    +P+++ Y                       M +   +++ F+           
Sbjct: 568 DSI----DPIAKGY-----QAPSDNEAAMKGTSRKQSMSTLNTTRITFDIRNRHVSKDNE 618

Query: 649 XXXXXXXXVSNLLKEKRHEEFLLLKSVKSVDTFDKICMRLEKDREEVEQLLKEMGHYNII 708
                   +  LLK+KR +EFLLL+SVKSVD+FDKI +RLE ++ EVE+LLK  G YNI+
Sbjct: 619 HREQQNEDIPLLLKKKRLQEFLLLQSVKSVDSFDKIAVRLEMNKHEVERLLKGTGEYNIV 678

Query: 709 NS 710
           NS
Sbjct: 679 NS 680

>ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 681

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/719 (48%), Positives = 459/719 (63%), Gaps = 61/719 (8%)

Query: 1   MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKL 60
           M+  F+GFVPIHT+FY+VFHPT+GT+VRY++PP NLE N+INFD IKNY+IPKPQLC+KL
Sbjct: 15  MTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKL 74

Query: 61  LTFKYGPYRLACYPVNVNASYYARNSXXXXXXXXXPYNCATSPYEPAVARLGKMFRVLEE 120
           LT KY  YR+ CYPV VN+ YYARN          PY+C TS YEPA+ARLGKMFRVLEE
Sbjct: 75  LTLKYKGYRIVCYPVTVNSPYYARNFFSFNFVFVFPYDCETSSYEPAIARLGKMFRVLEE 134

Query: 121 QSQILSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDTEQGTGLNNSQDSKEQGKI 180
           Q+QILSKAENDP+YF  K  +++T                  EQ   LN  +  K  G  
Sbjct: 135 QNQILSKAENDPIYFDFKLADNTT------------------EQDGKLNAEKSFK--GLT 174

Query: 181 EGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLFPL 240
           + QG A+ KY+EIM DLE  K   S++DL+ +++QDLNNYSEC IPID GN+VDIK+FPL
Sbjct: 175 KSQGMALAKYNEIMKDLESEKSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPL 234

Query: 241 LAPPNSCLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTDLVI 300
             PPNSC+S EDVPISTVNL  +IDVNWDPTMLKIVP+I+G+NSI+KIAK S SD  LV+
Sbjct: 235 KTPPNSCISIEDVPISTVNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVL 294

Query: 301 ECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVT-SSDLELYRLPF 359
           ECVKHL+YYNCV+LADIFQFSNIYA TSLI +FLTDPTLASECQ++VT +    L  +PF
Sbjct: 295 ECVKHLVYYNCVILADIFQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEMPF 354

Query: 360 E--SRPNLLSMHSSRKQNSSSTIHTVGVRNSPNRTNSLDYPSELSTRRNNFXXXXXXXLM 417
           E   + +L  M  S+ Q S S   ++  ++         Y +  +  R N          
Sbjct: 355 ERLRKFDLDDMDQSKNQESGSRTTSMSSKSDSKSKRPFFYSAPRNPYRFN---------- 404

Query: 418 RVRDRSGQSTTGSAVDEQESRLLLPTKSCLFDLYRSLHQGETVKEWYKINFEIIRDNHID 477
             R +S  S+T + V    +R  LPTK+CLFDLYR+L QG TV+EWY +N++ I+ N ID
Sbjct: 405 -QRSQSSFSSTNTNVTHDLAR-HLPTKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDID 462

Query: 478 VRRFITFGIVRGLIYRCYAYPVMKNLGALEMLKTLKSASDSRSLRRKLKFREKKNFTNNV 537
           VRRFITFG+++GLIYRC+++PVMK +   ++   L +A +   + +K K ++    +  V
Sbjct: 463 VRRFITFGVIKGLIYRCFSFPVMKKMSIFDLAHKLHTAGNLNQVTKKGKGQKNLAESKYV 522

Query: 538 FSTADIKVDLEHSPGGAPAEIFNRKHTSNVDMAEEVLKDAYKKLSIIE---SMDDNLYHV 594
           FST+D+K+           E        +VD+A+EVL++ YKKLS      S DD     
Sbjct: 523 FSTSDMKL----------GEGSKMHQNFSVDIADEVLRNVYKKLSNTNEPGSRDD----- 567

Query: 595 HNPMSRLYGHDXXXXXXXXXXXXXXXXXXXXMESETRSKVAFEKGRS---PWQVXXXXXX 651
             P+SR+Y  +                     + E  SKVAF+  +    P+ +      
Sbjct: 568 -YPLSRIYREESHVSLSALSGDNVSHPK----KPERVSKVAFDMNKDDPVPYSLSQQKGK 622

Query: 652 XXXXXVSNLLKEKRHEEFLLLKSVKSVDTFDKICMRLEKDREEVEQLLKEMGHYNIINS 710
                 + L + K +++ +LL+S+ + D  DKIC++LEK R EVE+LL E+G Y IINS
Sbjct: 623 NKEREAAKLDRAKNNQKIILLESIAAADCLDKICVKLEKPRHEVEELLHELGDYKIINS 681

>KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 660

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/711 (49%), Positives = 451/711 (63%), Gaps = 52/711 (7%)

Query: 1   MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKL 60
           M+S FDGFVPIHTVFY++FHPTEG+KVR+QFPP +LEN  I+FDTIKNY+IPKPQLCNKL
Sbjct: 1   MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKL 60

Query: 61  LTFKYGPYRLACYPVNVNASYYARNSXXXXXXXXXPYNCATSPYEPAVARLGKMFRVLEE 120
           LTFKYG YR+ CYPVNVNA YYARNS         PY+CATSPYEPA+ARLGKMF+VLEE
Sbjct: 61  LTFKYGEYRIVCYPVNVNARYYARNSFNFNFVFVFPYDCATSPYEPAIARLGKMFKVLEE 120

Query: 121 QSQILSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDTEQGTGLNNSQDSKEQGKI 180
           QSQILSK+E +PVYF LKS +S+    S             TE G     S    E   I
Sbjct: 121 QSQILSKSEQNPVYFQLKSNDSNAADQS-------------TEMG-----SITISEHTDI 162

Query: 181 EGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLFPL 240
           +  G   EKY EI+ +L K +K L IEDL+ KL+ DLNNYSEC IPID GNS+DIKLFP+
Sbjct: 163 KSTGDDGEKYLEIIKELAKNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPV 222

Query: 241 LAPPNSCLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTDLVI 300
             PP+S +S EDVPI+ VNL+ +IDVNWDPTM+KIVP+ING+NS+A+IA  + SD +LV 
Sbjct: 223 RTPPSSNISVEDVPIAVVNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQ 282

Query: 301 ECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVTSSDLELYRLPFE 360
           EC+KHL+YYNCV+L+DIFQFSNIYA TS I  FLT+P +A  CQ +V    L+   LPFE
Sbjct: 283 ECIKHLMYYNCVILSDIFQFSNIYAPTSEIHNFLTNPAVAKACQLFVQGDSLKQSLLPFE 342

Query: 361 SRPNLLSMHSSRKQNSSSTIHTVGVRNSPNRTNSLDYPSELSTRRNNFXXXXXXXLMRVR 420
            RPN +   + RKQ S+ST+H+   R+S +   +    S   T RN           R  
Sbjct: 343 GRPNNI-YPTGRKQASTSTVHS-RRRDSNDTATTGSTSSVRDTHRNYLSSSSTSSYFRAH 400

Query: 421 DRSGQSTTGSAVDEQESRLLLPTKSCLFDLYRSLHQGETVKEWYKINFEIIRDNHIDVRR 480
                  T  A  E + + +LPT+SCLFDLY+SL QG+TVK+WYK NFEIIRDN IDVR+
Sbjct: 401 ---ASENTSLATGENQMKRILPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRK 457

Query: 481 FITFGIVRGLIYRCYAYPVMKNLGALEMLKTLKSASDSRSLRRKLKFREKKNFTNNVFST 540
            I FGI R LIYR  +YP++KN+G  ++LK+L S        ++ K       + N+FS 
Sbjct: 458 LIMFGITRRLIYRVNSYPIVKNVGTWDILKSLVS--------KEPKTHYGSGSSKNIFSA 509

Query: 541 ADIKVDLEHSPGGAPAEIFNRKHTSNVDMAEEVLKDAYKKLSIIESMDDNLYHVHNPMSR 600
           ADIKV      G           +  +D A+E+LK  Y+KLS+ +        V N MS+
Sbjct: 510 ADIKVVDTKEEGN---------QSDKLDAADELLKSLYQKLSLKQD-------VPNTMSK 553

Query: 601 LYGHDXXXXXXXXXXXXXXXXXXXXMESETRSKVAFEKGRSPWQ-VXXXXXXXXXXXVSN 659
              +                       S +  KV+F+ G +  Q                
Sbjct: 554 FARY----YDDSPSNNAFTESTSRKSSSGSHQKVSFDFGTAGQQKTVTEVPDLGDGEKVE 609

Query: 660 LLKEKRHEEFLLLKSVKSVDTFDKICMRLEKDREEVEQLLKEMGHYNIINS 710
           + K+K+ EE +LL+S+ + +TFDK+C +L+K R EVE LLK++GHYNI+NS
Sbjct: 610 VWKKKKEEELILLESLSNAETFDKVCTKLKKSRHEVELLLKDLGHYNIVNS 660

>TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.17
           YEL062W
          Length = 679

 Score =  626 bits (1614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/719 (47%), Positives = 451/719 (62%), Gaps = 49/719 (6%)

Query: 1   MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKL 60
           M   F+GF+PIHT+FY+VFHPTEGTKVRY+FPP NLE+++INFD IKNY+IPKPQLC+KL
Sbjct: 1   MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKL 60

Query: 61  LTFKYGPYRLACYPVNVNASYYARNSXXXXXXXXXPYNCATSPYEPAVARLGKMFRVLEE 120
           LT KY  YR+A YPV VN+  YARN          PY+C TSPYEPA+ARLGKMF+VLEE
Sbjct: 61  LTLKYKNYRIASYPVTVNSPIYARNFFSFNFVFVFPYDCQTSPYEPAIARLGKMFKVLEE 120

Query: 121 QSQILSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDTEQGTGLNNSQDSKEQGKI 180
           Q+ ILSKAE DP+++H K  E          DQ    +P   E+G+              
Sbjct: 121 QNLILSKAEKDPIFYHFKQVEIKD-------DQDAKSKP---EKGS----------HNLS 160

Query: 181 EGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLFPL 240
           + Q  A EKYH+IM D+E      S++DL+ ++YQDLNNYSEC IPID GN+VDIK+FP+
Sbjct: 161 KSQAYASEKYHKIMTDIESADSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPM 220

Query: 241 LAPPNSCLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTDLVI 300
           + PPNS +S EDVP+STVNL K+IDVNWDPTMLKIVP+ING+NSI+KIAK S SD  LVI
Sbjct: 221 MTPPNSNISIEDVPVSTVNLNKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVI 280

Query: 301 ECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVT-SSDLELYRLPF 359
           EC+KHLIYYNCV+LADIFQFSNIYA TS +  FLTD  L++ECQ+YV    D  L RLPF
Sbjct: 281 ECIKHLIYYNCVLLADIFQFSNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPF 340

Query: 360 ESRPNLLSMHSSRKQ--NSSSTIHTVGVRNSPNRTNSLDYPSELSTRRNNFXXXXXXXLM 417
           + R N  +  S   +  +S  +  T G R +   +N   +PS      NN          
Sbjct: 341 K-RVNHSATESVDHELADSHRSQRTSGSRTTSMSSNGKFFPSS-----NNEMPALISEES 394

Query: 418 RVRDRSGQSTTGSAVDEQESRLL---LPTKSCLFDLYRSLHQGETVKEWYKINFEIIRDN 474
             R      ++ S+ +   S +L   LPTKSCLFDLYRSL QG +++EWY +++  IR N
Sbjct: 395 LYRTGKHSQSSFSSNNTNPSNMLARYLPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRAN 454

Query: 475 HIDVRRFITFGIVRGLIYRCYAYPVMKNLGALEMLKTLKSASDSRSLRRKLKFREKKNFT 534
            IDVRRFITFG++ GLIYRCY+YP+MKNL   ++ K L     S      +K  + KN +
Sbjct: 455 RIDVRRFITFGVINGLIYRCYSYPIMKNLEIFDLAKRLHREDIS---NHTVKHNKAKNPS 511

Query: 535 NNVFSTADIKVDLEHSPGGAPAEIFNRKHTS-NVDMAEEVLKDAYKKLSIIESMDDNLYH 593
            N+FST+DIK  +E+          N+ H + N+D+A+EVL++ YKKLS+  S D    +
Sbjct: 512 KNIFSTSDIKFGVEYERQR------NKHHKALNLDIADEVLRNVYKKLSVTNSTDTRP-N 564

Query: 594 VHNPMSRLYGHDXXXXXXXXXXXXXXXXXXXXMESETRSKVAFEKGRSPWQVXXXXXXXX 653
             +P++RLY                         S+  SKV+F+K +    +        
Sbjct: 565 SADPIARLY----RERSLGSLADGSTNNIYRLQNSDRPSKVSFDKQQEIGHISKGMSSSN 620

Query: 654 XXXVSN--LLKEKRHEEFLLLKSVKSVDTFDKICMRLEKDREEVEQLLKEMGHYNIINS 710
                +     E+R  + +LL+SV++ D+ D IC++LE  R +VE L++ +G Y IINS
Sbjct: 621 DKVKMDEEAKLERRERDLILLESVEAADSLDTICVKLEMSRYDVEALIQNLGEYKIINS 679

>Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON}
           (167096..169183) [2088 nt, 696 aa]
          Length = 695

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/722 (45%), Positives = 426/722 (59%), Gaps = 46/722 (6%)

Query: 5   FDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKLLTFK 64
           FDGF PIHT+FYSVFHPTEG KV YQFPP NL+N  INFD+I++YVIPKPQLCNKLLT K
Sbjct: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63

Query: 65  YGPYRLACYPVNVNASYYARNSXXXXXXXXXPYNCATSPYEPAVARLGKMFRVLEEQSQI 124
           YG YR+  YP+ +N S YARN+         PY C TSPYE  + +LGKMFRVLEEQSQ 
Sbjct: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123

Query: 125 LSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDTEQGTGLNN-------------S 171
           LSKAE D  YF  K+   S+      +DQ    +P+    G    N             +
Sbjct: 124 LSKAEKDLAYFDFKAILHSS------LDQDSKLKPEKDSSGNNNGNSNNSNNDQSNSANA 177

Query: 172 QDSKEQGKIEGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGN 231
            DSK+           EKY EI + +   +   SI+D I +LYQDLNNYSEC IPID+GN
Sbjct: 178 TDSKKNS-----SYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGN 232

Query: 232 SVDIKLFPLLAPPNSCLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKF 291
           +VDIKLFPLL PP + +S EDVPIS VNL ++IDVNWDPTMLKIVP I+GVNSIAKIAK 
Sbjct: 233 AVDIKLFPLLRPPPATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKL 292

Query: 292 SSSDTDLVIECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVTSSD 351
           S SDT LVIEC+KH IYY CVV++DIFQFSNIYA TSL+  FLTDP +A+ECQTYVT  +
Sbjct: 293 SDSDTVLVIECIKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPE 352

Query: 352 LE-LYRLPFESRPNL-LSMHSSRKQNSSSTIHTVGVRNSPNRTNSLDYPSELSTRRNNFX 409
              L++LP ES   L L    S  QN   + + +      +R  S       S+   N  
Sbjct: 353 SSTLHQLPLESLSKLKLDSDGSDSQNLRKSKNGID-----SRAASFVSSRGASSHNENSS 407

Query: 410 XXXXXXLMRVRDRSGQSTTGSAVDEQESRL-LLPTKSCLFDLYRSLHQGETVKEWYKINF 468
                 L   R RS  S +    ++    +  LPT+S LFDLYRSL QG T+KEWYK NF
Sbjct: 408 LYSRSDLYLNRHRSESSISSQNTNDLNGNVKQLPTRSTLFDLYRSLSQGVTLKEWYKENF 467

Query: 469 EIIRDNHIDVRRFITFGIVRGLIYRCYAYPVMKNLGALEMLKTLKSASDSRSLRRKLKFR 528
             IR+N ID+R+FI FGI+ GL+YRC ++PV  N   +  +K  K   + +  R+    +
Sbjct: 468 FEIRNNGIDIRKFIIFGIINGLLYRCQSFPVTANFEEINKVKKFKDIQNRKETRKD---K 524

Query: 529 EKKNFTNNVFSTADIKVDLEHSPGGAPAEIFNRKHTSNVDMAEEVLKDAYKKLSIIESMD 588
            +K  + ++FST+DIKV  +   G        R  T ++D+A+ VLK+ YKKL++    +
Sbjct: 525 LQKQLSQDIFSTSDIKVGEDLISGRN-----RRIQTLDLDIADSVLKNVYKKLTLKTEEE 579

Query: 589 DNLYHVHNPMSRLYGHDXXXXXXXXXXXXXXXXXXXXMESETRSKVAFEKGRSPWQVXXX 648
           ++     N        +                        T SKV+F++  +       
Sbjct: 580 NSSNRALN------SQELEKKSVQSLFESSNPYSKVPKRPGTLSKVSFQQNSNMQYSASS 633

Query: 649 XXXXXXXXVSNLLKEKRHEEFLLLKSVKSVDTFDKICMRLEKDREEVEQLLKEMGHYNII 708
                   ++NL K ++  E +LL++++S +  DKIC+ LEK R EVE++LK +  + +I
Sbjct: 634 GDVTENEDINNLEKLRKQNEQILLEALESTENLDKICVLLEKPRSEVEEMLKHLVDFKVI 693

Query: 709 NS 710
           NS
Sbjct: 694 NS 695

>Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)
          Length = 615

 Score =  523 bits (1346), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 276/578 (47%), Positives = 378/578 (65%), Gaps = 41/578 (7%)

Query: 1   MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKL 60
           M S+F GFVPIHT+FYSVFHPTEG+K++Y+FPP NL+N+ INF+TIKNY+IPKP LC+KL
Sbjct: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 60

Query: 61  LTFKYGPYRLACYPVNVNASYYARNSXXXXXXXXXPYNCATSPYEPAVARLGKMFRVLEE 120
           +TFKYG YR+ CYPV +N+  YARN          PY+C TSPYEPA+ RLGKMF+VLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QSQILSKAENDPVYFHLKSQESSTNSSSHPVDQGG--SDRPKDTEQGTGLNNSQDSKEQG 178
           Q+Q+LSK+E D V+F LK+ E   NS+  P   G   +  P      T   + +D+K+  
Sbjct: 121 QNQLLSKSEKDAVFFDLKALE---NSTITPSTAGAPTTSNPSSNTTPTYPTSDKDAKDLR 177

Query: 179 KIEGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLF 238
                     +Y+++  DL   +   SI+DL+ +++QDLNNYSEC IPID GN+VDIK+F
Sbjct: 178 S--------SRYNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIF 229

Query: 239 PLLAPPNSCLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTDL 298
           PLL PP +C+S EDVP+S+VNL K+IDVNWDPTM+ IVP+I+G+NSIAKI+K S SD  L
Sbjct: 230 PLLRPPTTCVSLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSL 289

Query: 299 VIECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVTSSDL-ELYRL 357
           VIEC++HLIYY CV L+DIFQFSNIYA +SLI  FLTD  +AS+CQ+YV   ++ ++  L
Sbjct: 290 VIECIRHLIYYKCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSL 349

Query: 358 PFESRPNLLSMHSS----RKQNSSSTIHTVGVRNSPNRTNSLDYPSELSTRRNNFXXXXX 413
           P     +     S     R+++ SS+I +    N  +RT S    S++S   +       
Sbjct: 350 PLSKNLDSADRDSPSLFVRRKSKSSSIPS----NPDSRTTSFSSNSKVSQNSSLNSSFSS 405

Query: 414 XXLMRVRDRSGQSTTGSAVDEQESRLLLPTKSCLFDLYRSLHQGETVKEWYKINFEIIRD 473
                 + ++  S++    ++  +R  LPT+SCLFDLYRSL QG T+K WY+    I+++
Sbjct: 406 VCKDWRQSQTSLSSSNLRANDNRNR-FLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKE 464

Query: 474 NHIDVRRFITFGIVRGLIYRCYAYPVMKNLGALEMLKTLK-----SASDSRSLRRKLKFR 528
           N+IDVRRFITFG+ R +IYRCY++PVM N+ + E  +  +     S +D RSL++K    
Sbjct: 465 NNIDVRRFITFGLERRIIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKK---N 521

Query: 529 EKKNFT----------NNVFSTADIKVDLEHSPGGAPA 556
           +  +F+          NNV S    KV  E    G+ A
Sbjct: 522 QDASFSVVGSKNSGQPNNVKSERPSKVSFEMQRAGSLA 559

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 45/85 (52%), Gaps = 9/85 (10%)

Query: 626 MESETRSKVAFEKGRSPWQVXXXXXXXXXXXVSNLLKEKRHEEFLLLKSVKSVDTFDKIC 685
           ++SE  SKV+FE  R+                + + K    EE +L  S++S ++FD IC
Sbjct: 540 VKSERPSKVSFEMQRA---------GSLATGEATIPKLSDEEERILENSIRSAESFDNIC 590

Query: 686 MRLEKDREEVEQLLKEMGHYNIINS 710
           + L K + EVE  L E+G + +INS
Sbjct: 591 VLLSKSKLEVENYLNELGEFKVINS 615

>YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit of
           SEA (Seh1-associated), Npr2/3, and Iml1p complexes;
           Npr2/3 complex mediates downregulation of TORC1 activity
           upon amino acid limitation; SEA complex is a
           coatomer-related complex that associates dynamically
           with the vacuole; Iml1p complex (Iml1p-Npr2p-Npr3p) is
           required for non-nitrogen-starvation (NNS)-induced
           autophagy; Iml1p interacts primarily with phosphorylated
           Npr2p; homolog of human NPRL2; target of Grr1p; required
           for growth on urea and proline
          Length = 615

 Score =  515 bits (1326), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 260/513 (50%), Positives = 355/513 (69%), Gaps = 21/513 (4%)

Query: 1   MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKL 60
           M S+F GFVPIHT+FYSVFHPTEG+K++Y+FPP NL+N+ INF+T KNY+IPKP LC+KL
Sbjct: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKL 60

Query: 61  LTFKYGPYRLACYPVNVNASYYARNSXXXXXXXXXPYNCATSPYEPAVARLGKMFRVLEE 120
           +TFKYG YR+ CYPV +N+  YARN          PY+C TSPYEPA+ RLGKMF+VLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QSQILSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDTEQGTGLNNSQDSKEQGKI 180
           Q+Q+LSK+E DPV+F LK  E   NS++ P   G S  P  +      +N+  +    + 
Sbjct: 121 QNQLLSKSERDPVFFDLKVLE---NSTTTPSTAGPSSTPNPS------SNTTPTHPTSEK 171

Query: 181 EGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLFPL 240
           + +     +Y +++ DL   +   SI+DL+ +++QDLNNYSEC IPID GN+VDIK+FPL
Sbjct: 172 DTKDMRSSRYSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPL 231

Query: 241 LAPPNSCLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTDLVI 300
           L PP +C+S EDVP+S+VNL K+IDVNWDPTM+ IVP+I+G+NSIAKI+K S+SD  LVI
Sbjct: 232 LRPPTTCVSLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVI 291

Query: 301 ECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVTSSDL-ELYRLPF 359
           EC++HLIYY CV L+DIFQFSNIYA +SLI  FLTDP +AS+CQ+YVT  ++ ++  LP 
Sbjct: 292 ECIRHLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPL 351

Query: 360 ESRPNLLSMHSSRKQNSS-STIHTVGVRNSPNRTNSLDYPSELSTRRNNFXXXXXXXLMR 418
                  S+ S  + + S S        + P+  +S       ++R +            
Sbjct: 352 NK-----SLGSGDQDSPSFSVRRKSKSSSIPSNPDSRTTSFSSTSRVSQNSSLNSSFSSI 406

Query: 419 VRD-RSGQSTTGSA---VDEQESRLLLPTKSCLFDLYRSLHQGETVKEWYKINFEIIRDN 474
            +D R  Q++  S+   V    +R  LPT+SCLFDLYRSL QG+T+K WY+  + I+++N
Sbjct: 407 YKDWRQSQTSCSSSNIHVINNRNR-FLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKEN 465

Query: 475 HIDVRRFITFGIVRGLIYRCYAYPVMKNLGALE 507
           +ID+RRFITFG+ + +IYRCY++PVM N G+ E
Sbjct: 466 NIDIRRFITFGLEKRIIYRCYSFPVMINAGSRE 498

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 45/85 (52%), Gaps = 9/85 (10%)

Query: 626 MESETRSKVAFEKGRSPWQVXXXXXXXXXXXVSNLLKEKRHEEFLLLKSVKSVDTFDKIC 685
           ++ E  SKV+FE  R                 S + K    EE +L +S+++ +TFDKIC
Sbjct: 540 LKPERPSKVSFEMQR---------VSSLATGKSTMPKLSDEEEGILEESIRNAETFDKIC 590

Query: 686 MRLEKDREEVEQLLKEMGHYNIINS 710
           + L K + EVE  L E+G + +INS
Sbjct: 591 VLLSKPKLEVESYLNELGEFKVINS 615

>Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON}
           YEL062W (REAL)
          Length = 615

 Score =  512 bits (1318), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 262/516 (50%), Positives = 354/516 (68%), Gaps = 19/516 (3%)

Query: 1   MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKL 60
           M S+F GFVPIHT+FYSVFHPTEG+K++Y+FPP NL+N+ INF+TIKNY+IPKP LC+KL
Sbjct: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKL 60

Query: 61  LTFKYGPYRLACYPVNVNASYYARNSXXXXXXXXXPYNCATSPYEPAVARLGKMFRVLEE 120
           +TFKYG YR+ CYPV +N+  YARN          PY+C TSPYEPA+ RLGKMF+VLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QSQILSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDTEQGTGLNNSQDSKEQGKI 180
           Q+Q+LSK+E DPV+F LK+ E+ST + S       S+   +T   T   + +D+K+    
Sbjct: 121 QNQLLSKSEKDPVFFDLKALENSTIAPSTACPPATSNTSSNT-TPTHPTSDKDAKDLRN- 178

Query: 181 EGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLFPL 240
                   +Y++++ D E  +   SI+DL+ +++QDLNNYSEC IPID GN+VDIK+FPL
Sbjct: 179 -------SRYNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPL 231

Query: 241 LAPPNSCLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTDLVI 300
           L PP +C+S EDVP+S+VNL K+IDVNWDPTM+ IVP+I+G+NSIAKI+K S+SD  LVI
Sbjct: 232 LRPPTTCVSLEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVI 291

Query: 301 ECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVTSSDL-ELYRLPF 359
           EC++HLIYY CV L+DIFQFSNIYA +S I  FLTDP +A++CQ YVT  ++ ++  LP 
Sbjct: 292 ECIRHLIYYKCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPL 351

Query: 360 ESRPNLLSMHSSRKQNSSSTIHTVGVRNSPNRTNSLDYPSELSTRRNNFXXXXXXXLMRV 419
               NL S        S S        + P+   S       +++ +             
Sbjct: 352 NK--NLTS--GDLDSPSFSVRRKSKSSSIPSNPGSRTTSFSSTSKVSQNSSINSSFSSAY 407

Query: 420 RD-RSGQSTTGSA---VDEQESRLLLPTKSCLFDLYRSLHQGETVKEWYKINFEIIRDNH 475
           RD R  Q++  S+   +    +R  LPT+SCLFDLYRSL QG+T+K WY+  + II+DN+
Sbjct: 408 RDWRQSQTSCSSSNIHISNNRNR-FLPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNN 466

Query: 476 IDVRRFITFGIVRGLIYRCYAYPVMKNLGALEMLKT 511
           ID+RRFITFG+ + +IYR Y+YPVM ++G  E  +T
Sbjct: 467 IDIRRFITFGLEKRIIYRSYSYPVMLSVGPRETKET 502

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 34/53 (64%)

Query: 658 SNLLKEKRHEEFLLLKSVKSVDTFDKICMRLEKDREEVEQLLKEMGHYNIINS 710
           S + K    EE +L +SV+S + FDKIC+ L K + EVE  L E+G + IINS
Sbjct: 563 STIPKLSDDEERILEESVRSAENFDKICVLLGKPKLEVENYLNELGEFKIINS 615

>TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON}
           Anc_6.17 YEL062W
          Length = 675

 Score =  513 bits (1320), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 316/734 (43%), Positives = 426/734 (58%), Gaps = 85/734 (11%)

Query: 1   MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKL 60
           M++ FDGFVPIH +FYSVFHPTEGTKV Y+FPP+NL  + INFD IKNYVIPKPQLC+KL
Sbjct: 1   MNNSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKL 60

Query: 61  LTFKYGPYRLACYPVNVNASYYARNSXXXXXXXXXPYNCATSPYEPAVARLGKMFRVLEE 120
           LT KY  YR+  YP+ +N+S YARN+         PY C TSPYEP V RLGKMF  LE 
Sbjct: 61  LTLKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEG 120

Query: 121 QSQILSKAENDPVYFHLK-------SQESSTNSSSHPVDQGGS---DRPKDTEQGTGLNN 170
           Q Q LSK E D  YF  K         +S+T   ++ + +  S       + +   G  N
Sbjct: 121 QCQFLSKCEKDMAYFDFKLISNLIDQDKSNTEPDNNILSKTNSMILPTISNIDTTVGSTN 180

Query: 171 SQDSKEQGKIEGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSG 230
           +QD     ++E       KY+ I + ++  K +LS+ D++ +++QDLN+YSEC+IPID G
Sbjct: 181 TQDKANSKEVE---YLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDG 237

Query: 231 NSVDIKLFPLLAPPNSCLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAK 290
           N++DIKLFP L PP   +S EDVPI TVNL K+IDVNWDPTMLKIVP+I+G+NSI KIA 
Sbjct: 238 NAIDIKLFPTLMPPIDSISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIAN 297

Query: 291 FSSSDTDLVIECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVTS- 349
            S+SD  LVIEC++H +YY CV+L+DIFQFSNIYA TS I++FLTDPTLA+ECQ YVTS 
Sbjct: 298 LSNSDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSP 357

Query: 350 SDLELYRLPFES--------RPNLLSMH----SSRKQNSSSTIHTVGVRNSPNRTNSLDY 397
            D  L  LPF+         R   ++ H    SS +QN +S   +  + +  +  +   Y
Sbjct: 358 EDSLLSALPFKKGRKMVKNRRSASIASHFTSSSSLRQNLNSKASSF-ISDEGHHNDDTAY 416

Query: 398 PSELSTRRNNFXXXXXXXLMRVRDRSGQSTTGSAVDEQESRLLLPTKSCLFDLYRSLHQG 457
           P+  S   N             R      ++G+  +  ++R  LPTKS LFDLYRSL QG
Sbjct: 417 PNHDSIYEN------------RRRSESSFSSGNNDEMHQNRNYLPTKSTLFDLYRSLSQG 464

Query: 458 ETVKEWYKINFEIIRDNHIDVRRFITFGIVRGLIYRCYAYPVMKNLGALEMLKTLKSASD 517
             ++EWY+INF  IRDN ID+RRFI FGI++ +IYRC++YP+ KN  A   L  LK+  +
Sbjct: 465 VKLEEWYQINFNSIRDNFIDIRRFIIFGIIKRIIYRCHSYPLPKNYEAFSKLNDLKNLQN 524

Query: 518 SRSLRRKLKFREKKNFTNNVFSTADIK--VDLEHSPGGAPAEIFNRKHTSNVDMAEEVLK 575
              + +     + +++T N+FST+DIK  VDL         +   + HT +VD+A+ VL 
Sbjct: 525 GPKIVK----NKSQSYTYNIFSTSDIKFGVDLY-------TDTKKKLHTLDVDVADRVLN 573

Query: 576 DAYKKLSIIESMDDNLYHVHNPMSRLYGHDXXXXXXXXXXXXXXXXXXXXMESETRSKVA 635
           + YKKLS              P + + G                       + +  SKVA
Sbjct: 574 NVYKKLST----------NGRPTTSING-----------------------QGQHPSKVA 600

Query: 636 FEKGRSPWQVXXXXXXXXXXXVSNLLKEKRHEEFLLLKSVKSVDTFDKICMRLEKDREEV 695
           F+       +                +   +++  LL +++S +  D IC  LE  REEV
Sbjct: 601 FKNQSYDNDLPGLMNNLGIEATKFSREININDKIYLLDALQSAENLDNICSNLELSREEV 660

Query: 696 EQLLKEMGHYNIIN 709
           E LL E+  Y IIN
Sbjct: 661 ETLLNELTEYRIIN 674

>NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.17
           YEL062W
          Length = 612

 Score =  497 bits (1280), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 298/713 (41%), Positives = 405/713 (56%), Gaps = 119/713 (16%)

Query: 3   SHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKLLT 62
           +HF+GF+PIHT+FYS+FHPTEGTKV Y+FPP NL N  INFDTIKNY+IPK QLCN+LLT
Sbjct: 10  NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 69

Query: 63  FKYGPYRLACYPVNVNASYYARNSXXXXXXXXXPYNCATSPYEPAVARLGKMFRVLEEQS 122
           FKY  YR+  YP+ +NA YYARN          PY C TSPYEP++ARLGKMF++LEEQS
Sbjct: 70  FKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQS 129

Query: 123 QILSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDTEQGTGLNNSQDSKEQGKIEG 182
           QILSKAENDP+YF  KS    T  ++  + Q              ++ S  +K       
Sbjct: 130 QILSKAENDPIYF--KSDYVPTEPTTTIIPQ--------------ISPSHRNKRNNDHND 173

Query: 183 QGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLFPLL- 241
                    +   + E G  + S++DLI ++YQDLNNYSEC IPID GN ++IK+FPLL 
Sbjct: 174 NNDGSRFETDFFGEEEDGVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLK 233

Query: 242 APPNSCLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTDLVIE 301
            PPN  +S EDVP+S +NL  +IDVNWDPTML IVP+INGVN I+KIAK + +D  LVIE
Sbjct: 234 PPPNHLISLEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIE 293

Query: 302 CVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVTSSDLELYRLPFES 361
           C+KHL+YYNCV++ DIFQFSN+YA TSLI  FLTD  +A++CQ YV         LP  S
Sbjct: 294 CIKHLVYYNCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVV--------LPIGS 345

Query: 362 RPNLLSMHSSRKQNSSSTIHTVGVRNSPNRTNSLDYPSELSTRRNNFXXXXXXXLMRVRD 421
           + + L   ++  +  S+  H+                + LS+  +          M    
Sbjct: 346 KLSHLPFENNGNKQPSTPKHSRT--------------TSLSSSMSGSVNSHEHSYMDTIQ 391

Query: 422 RSGQSTTGSAVDEQESRL---LLPTKSCLFDLYRSLHQGETVKEWYKINFEIIRDNHIDV 478
           +S  S + S+ D          LPTK+CLFDLYRSL  G T++ WY+ N  II +N++DV
Sbjct: 392 KSETSLSLSSTDPNNPHFELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDV 451

Query: 479 RRFITFGIVRGLIYRCYAYPVMKNLGALEMLKTLKSASDSRSLRRKLKFREKKNFTNNVF 538
           R+FI FGI+RGLIYRC++YP+ +   + E ++ ++  +D  + R +++         +  
Sbjct: 452 RKFIKFGIIRGLIYRCHSYPIPQR-PSNEGIQRIERLNDIDAHRLQIR---------SSG 501

Query: 539 STADIKVDLEHSPGGAPAEIFNRKHTSNVDMAEEVLKDAYKKL---SIIESMDDNLYHVH 595
           S A            +P+ I       NVD A+E+LK+ YKKL   S +  MD       
Sbjct: 502 SAARSNSGSGSGSSASPSSI-------NVDGADELLKNVYKKLERHSKVSFMD------- 547

Query: 596 NPMSRLYGHDXXXXXXXXXXXXXXXXXXXXMESETRSKVAFEKGRSPWQVXXXXXXXXXX 655
                                          + +  S    EKGR               
Sbjct: 548 -------------------------------KEKNESMKTDEKGRP-------------- 562

Query: 656 XVSNLLKEKRHEEFLLLKSVKSVDTFDKICMRLEKDREEVEQLLKEMGHYNII 708
             S + KE+R    +LLKS++S++  DKIC++L K R++VE+ L E+G+Y II
Sbjct: 563 --STMTKEERS---VLLKSIESLENLDKICVKLGKSRQQVERWLDELGNYKII 610

>CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa]
           {ON} similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062w nitrogen permease regulator
          Length = 646

 Score =  497 bits (1280), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 290/716 (40%), Positives = 408/716 (56%), Gaps = 78/716 (10%)

Query: 1   MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKL 60
           M+S F+GFV IH++FYS FHPTEG+KV++ FPP +LEN+ INFD+IKNYVIPK  LC++L
Sbjct: 1   MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRL 60

Query: 61  LTFKYGPYRLACYPVNVNASYYARNSXXXXXXXXXPYNCATSPYEPAVARLGKMFRVLEE 120
           +TFKYG YR+ACYPV VN+S YARN          P+NC TSPYEPA+ RLGKMFRVLE 
Sbjct: 61  ITFKYGNYRIACYPVTVNSSIYARNFFSFNFVFVFPFNCETSPYEPAIERLGKMFRVLEI 120

Query: 121 QSQILSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDTEQGTGLNNSQDSKEQGKI 180
           Q+QILSK+END + F+LKS + + N     +D   S+     +  + +   Q  K     
Sbjct: 121 QNQILSKSENDTIMFNLKSADKNFN-----IDNDSSNYILGDDISSIMTTQQKDK----- 170

Query: 181 EGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLFPL 240
                  E+ + I+ +++K     +I DL+ +LYQDLN YSEC IPID GN+VDIKLFPL
Sbjct: 171 ------YERLNNIISNIKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPL 224

Query: 241 LAPPNSCLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTDLVI 300
           L PP   +S E VPIS VNL K++DVNWDP ML I+P+ING+N+I +I++ S ++  LVI
Sbjct: 225 LTPPTPYISIEHVPISLVNLFKIVDVNWDPIMLTIIPYINGINNIYRISQLSHNEESLVI 284

Query: 301 ECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVTSSDLELYRLPFE 360
           EC++HL+YY C+VL DIF+FSN+YA TS +  FL DP +A+ECQ+YV         LP  
Sbjct: 285 ECIRHLVYYRCIVLTDIFEFSNVYAPTSSLRLFLLDPNMATECQSYVM--------LPIN 336

Query: 361 SRPNLLSMHSSRKQNSSSTIHTVGVRNSPNRTNSLDY---PSELSTRRNNFXXXXXXXLM 417
           S+ N LS++    ++S+     +G RN+   T+   +    S   +R ++          
Sbjct: 337 SKMNDLSLYPHHGKHSAFN-GDIGSRNNSVSTSLYSFNGNDSRPQSRSSSVDQSQTNFYK 395

Query: 418 RVRDRSGQSTTGSAVDEQESRLLLPTKSCLFDLYRSLHQGETVKEWYKINFEIIRDNHID 477
             +      +TG++ + Q     LPT+S LFDLYRSL QG T+KEWY  N +IIRDN ID
Sbjct: 396 NKKQSESSISTGNSNNGQNIHKHLPTRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRID 455

Query: 478 VRRFITFGIVRGLIYRCYAYPVMKNLGALEMLKTLKSASDSRSLRRKLKFREKKNFTNNV 537
           VRRFITFG++R +IYRC  Y V+ +   L+ L  L    +  S+    K +     +N++
Sbjct: 456 VRRFITFGVLRRIIYRCETYSVINSTDHLQNLWKLNELENPISMENISKLQ-----SNHI 510

Query: 538 FSTADIKVDLEHSPGGAPAEIFNRKHTSNVDMAEEVLKDAYKKLSI-IESMDDNLYHVHN 596
            S A                            A+E L +AYKKLS+ + S          
Sbjct: 511 DSLA----------------------------ADEALMNAYKKLSLKVPS---------- 532

Query: 597 PMSRLYGHDXXXXXXXXXXXXXXXXXXXXMESETRSKVAFE---KGRSPWQVXXXXXXXX 653
               L  H+                      ++  SKV+FE   + R+ ++         
Sbjct: 533 -KGALKSHNTSHSSFSLTPTAPEMENSQAKRNKRLSKVSFEALPEDRNGFRWGSNIKTPI 591

Query: 654 XXXVSNLLKEKRHEEFLLLKSVKSVDTFDKICMRLEKDREEVEQLLKEMGHYNIIN 709
               +   K  + +  ++LK++   +T DKIC+ LE  R+ V  +L E+G   +IN
Sbjct: 592 QE--TTWKKLSKMQRRIMLKALADAETLDKICVLLEMPRQNVVNILHELGELKLIN 645

>TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {ON}
           Anc_6.17 YEL062W
          Length = 710

 Score =  486 bits (1252), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 254/515 (49%), Positives = 332/515 (64%), Gaps = 49/515 (9%)

Query: 1   MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKL 60
           M  HF+GFVPIHTVFYS+FHPTEGTKVRY+FPP NL+  +INFDTIKNY+IPKPQLC+KL
Sbjct: 1   MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKL 60

Query: 61  LTFKYGPYRLACYPVNVNASYYARNSXXXXXXXXXPYNCATSPYEPAVARLGKMFRVLEE 120
           LT KYG YRL  YPV +N+S YARN          P NC TSPYEP +ARLGKMFRVLEE
Sbjct: 61  LTLKYGDYRLVSYPVTINSSLYARNFFSFNFVFVFPINCETSPYEPIIARLGKMFRVLEE 120

Query: 121 QSQILSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDTEQGTGLNNSQDSKEQGKI 180
           Q+Q+LS+AEND VYF           +SH +     D     ++ T +      +     
Sbjct: 121 QNQLLSRAENDSVYF----------DNSHSLLSSEQDSIMHQDKNTSILGFSRKRFSFSK 170

Query: 181 EGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLFPL 240
                ++ +Y     D E G    S++DLI +++QDLNNYSEC IPID GNSVDIK+FP 
Sbjct: 171 RPTDLSLSEY----PDNESGSN-FSVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIFPS 225

Query: 241 LAPPNSCLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTDLVI 300
           + PP+  +S+EDVP++ V+L+ ++DVNWDPTMLKIVPFI+ +NSI++IA  S+SD D V+
Sbjct: 226 MVPPSISISYEDVPVAMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDFVV 285

Query: 301 ECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVT-SSDLELYRLPF 359
           EC++HL+YY  V+L+DIFQF+NIYA TS + +FLTD  LA++CQTYV    +    +LP 
Sbjct: 286 ECIRHLVYYQLVILSDIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPKNSNFGKLPL 345

Query: 360 ESRPNL-LSMHSSRKQNSSSTIHTVGVRNSPN-----RTNSLDYPSELSTRRNNFXXXXX 413
           E   N  L  +S    NS S I+       PN       + L +P               
Sbjct: 346 EKSINTDLDEYS----NSGSAIY-------PNNEILENDDRLRWP--------------- 379

Query: 414 XXLMRVRDRSGQSTTGSAVDEQESRLLLPTKSCLFDLYRSLHQGETVKEWYKINFEIIRD 473
               + R+     ++G +   + +   LPTKSCLFDLYRSL QG  + +WY  ++ +I  
Sbjct: 380 -MYYKPRNSQSSLSSGISSGNERTSNYLPTKSCLFDLYRSLSQGTVLHDWYNEHYSLIHF 438

Query: 474 NHIDVRRFITFGIVRGLIYRCYAYPVMKNLGALEM 508
           N ID+RRFITFG+VRGL+YRCYA P+MKN G  ++
Sbjct: 439 NKIDIRRFITFGLVRGLLYRCYAIPIMKNAGIFDI 473

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%)

Query: 662 KEKRHEEFLLLKSVKSVDTFDKICMRLEKDREEVEQLLKEMGHYNIIN 709
           +EK H   LLL+S++  D  DKIC++L+K R+EVE+LL E+G Y IIN
Sbjct: 662 QEKNHIRRLLLESLREADNMDKICIKLQKPRKEVEELLSEIGDYVIIN 709

>KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {ON}
           Anc_6.17 YEL062W
          Length = 594

 Score =  477 bits (1228), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 267/558 (47%), Positives = 341/558 (61%), Gaps = 70/558 (12%)

Query: 1   MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKL 60
           M S F+GFVPIHT+FY++FHPTEG+KV YQFPP NL++ DINFD IKNY+IPKPQLC++L
Sbjct: 1   MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRL 60

Query: 61  LTFKYGPYRLACYPVNVNASYYARNSXXXXXXXXXPYNCATSPYEPAVARLGKMFRVLEE 120
           LT KYG YR+  YPV V +S YARN          PY CATSPYEPA+ RLGKMFRVLEE
Sbjct: 61  LTMKYGNYRIVSYPVAVQSSSYARNYFRFNFVFVFPYECATSPYEPAITRLGKMFRVLEE 120

Query: 121 QSQILSKAENDPVYFHLKSQESSTNSSSH--PVDQGGSDRPKDTEQGTGLNNSQDSKEQG 178
           QSQ+LS+AE D   F         NS+ +  P+      + K          S D K +G
Sbjct: 121 QSQVLSRAERDDSLFKGDKLPFDNNSAKNQAPLTHALISKTKSF--------SPDKKTEG 172

Query: 179 KIEGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLF 238
            I                       +S++DLI ++YQDLNNYSEC IPID GN++DIK+F
Sbjct: 173 DIH---------------------LISVQDLIMRIYQDLNNYSECLIPIDEGNAIDIKIF 211

Query: 239 PLLAPPNSC-LSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTD 297
           PL+ PP S  LS EDVP+  V L K+ID+NWDPTM+ I+PFINGVNSI  IA+ S SD +
Sbjct: 212 PLINPPTSVHLSIEDVPMLVVKLKKIIDLNWDPTMVSILPFINGVNSILNIARLSDSDPE 271

Query: 298 LVIECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVTSSDLELYRL 357
           LVIEC+KHLIYY CV++ DIFQFSNIYA +SLI+EFLTDPT+A +CQ YVT        L
Sbjct: 272 LVIECIKHLIYYKCVIITDIFQFSNIYAPSSLINEFLTDPTMAYDCQEYVT--------L 323

Query: 358 PFESR----PNLLSMHSSR--KQNSSSTIHTVGVRNSPNRTNSLDYPSELSTRRNNFXXX 411
           P  SR    P   S+  SR  K   S+++ + GV +  + +   +  SE  +  N     
Sbjct: 324 PKSSRLIHMPLQTSVPGSRNNKHKKSNSLSSTGVLSWQSNSQYSNNSSEFYSMSN----- 378

Query: 412 XXXXLMRVRDRSGQSTTGS--AVDEQESRLLLPTKSCLFDLYRSLHQGETVKEWYKINFE 469
                 + R  S  S+ G+  A    +  +  PT+  LFDLYRSL QG T+++WY  NF 
Sbjct: 379 ------KKRSESSLSSEGTPGAGRSDDHTIYYPTRMVLFDLYRSLSQGITLEKWYTTNFT 432

Query: 470 IIRDNHIDVRRFITFGIVRGLIYRCYAYPVMKNLGALEMLKTLKSASDSRSLRRKLKFRE 529
            IR N+IDVR+FI FG ++ +IYR  +YPV++      + K +           K K  E
Sbjct: 433 TIRSNYIDVRKFIQFGTIKKIIYRVLSYPVLEKRRNSIIAKQMG----------KSKMAE 482

Query: 530 KKNFTNNV-FSTADIKVD 546
           K   + N  FST+DIK D
Sbjct: 483 KAPHSKNAFFSTSDIKFD 500

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 32/45 (71%)

Query: 665 RHEEFLLLKSVKSVDTFDKICMRLEKDREEVEQLLKEMGHYNIIN 709
           + E+  LL ++ ++++FDKIC++L + R E+  L+ ++G Y +IN
Sbjct: 549 KEEKLQLLGALDNLESFDKICVQLGRSRVEIANLIADIGEYRVIN 593

>NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.17
           YEL062W
          Length = 666

 Score =  478 bits (1230), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 250/522 (47%), Positives = 332/522 (63%), Gaps = 44/522 (8%)

Query: 3   SHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKLLT 62
           +HF+GF+PIHT+FYS+FHPTEGTKVRY+FPP+NL  +DI+FD IKNY+IPK QLCNKLLT
Sbjct: 11  NHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQLCNKLLT 70

Query: 63  FKYGPYRLACYPVNVNASYYARNSXXXXXXXXXPYNCATSPYEPAVARLGKMFRVLEEQS 122
           FKY  YR+  YP+ +N+ +YARN          PY+C TSPYEPA+ARLGKMF+VLEEQ+
Sbjct: 71  FKYANYRIVSYPITINSDFYARNFFSFNFVFVFPYDCETSPYEPAIARLGKMFKVLEEQN 130

Query: 123 QILSKAENDPVYFHLKSQESSTNSS----SHPVDQGGSDRPKDTEQGTGLNNSQDSKEQG 178
           QILSKAENDP+YF  KS  +    +    ++  + G  ++    ++ T  +  Q      
Sbjct: 131 QILSKAENDPIYF--KSDYTPYQPTLIIPTNNDNDGKRNKKLMKKENTIFSTRQQRSNSN 188

Query: 179 KI-------------EGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFI 225
           +I                G   +  +  ++       R+S++DLI ++YQDLNNYSEC I
Sbjct: 189 RILEENSNSNSNSNSNSNGNENDNNYNTIEQYLNNNSRISVQDLIMRIYQDLNNYSECLI 248

Query: 226 PIDSGNSVDIKLFPLLAPPNS-CLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNS 284
           PID GN+VDIK+FPLL PP +  LS EDVP+S V+L K+ DVNWDPTMLK++PFING+N 
Sbjct: 249 PIDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDLTKITDVNWDPTMLKLIPFINGIND 308

Query: 285 IAKIAKFSSSDTDLVIECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQ 344
           I+KI+K S+S   LVIEC+KHLIYYNCV++ DIFQFSN Y++TSLIS FLTDP +A+ CQ
Sbjct: 309 ISKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQFSNTYSTTSLISTFLTDPNMATLCQ 368

Query: 345 TYVTSSDLELYRLPFESRPNLLSMHSSRKQNSSSTIHTVGVRNSPNRTNSLDYPSELSTR 404
            YV         LP  S+   L  H   + +  S+       N   +T S       +  
Sbjct: 369 NYVV--------LPLGSKLTRLPFHIETETSVQSSSAYRHHHNRHEKTPSFGSSITSNNG 420

Query: 405 RNNFXXXXXXXLMRVRDRSGQSTTGSAVDEQE------SRLLLPTKSCLFDLYRSLHQGE 458
           R++F            D   QS T              S   LPTK  LF+LYRSL+Q  
Sbjct: 421 RSSFSA----------DDRKQSETSLNSSNDPSNSNLISTAHLPTKMSLFELYRSLNQRT 470

Query: 459 TVKEWYKINFEIIRDNHIDVRRFITFGIVRGLIYRCYAYPVM 500
            +K WYK+N+  I +N+ID+R+FI FGI++GLIYRC++YP++
Sbjct: 471 DLKNWYKLNYTTIIENNIDIRKFIKFGIIKGLIYRCHSYPIV 512

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 28/40 (70%)

Query: 670 LLLKSVKSVDTFDKICMRLEKDREEVEQLLKEMGHYNIIN 709
           +LL S+ ++D  DKIC++L + R ++E+ L E G Y +IN
Sbjct: 626 ILLDSISNMDNMDKICVKLGRPRSQIEEWLSEFGDYKVIN 665

>Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)
          Length = 619

 Score =  447 bits (1149), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 212/362 (58%), Positives = 276/362 (76%), Gaps = 9/362 (2%)

Query: 1   MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKL 60
           M S+F GFVPIHT+FYSVFHPTEG+K++Y+FPP NL+++ INF+TIKNY+IPKP LC+KL
Sbjct: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKL 60

Query: 61  LTFKYGPYRLACYPVNVNASYYARNSXXXXXXXXXPYNCATSPYEPAVARLGKMFRVLEE 120
           +TFKYG YR+ CYPV +N+  YARN          PY+C TSPYEPA+ RLGKMF+VLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QSQILSKAENDPVYFHLKSQESS--TNSSSHPVDQGGSDRPKDTEQGTGLNNSQDSKEQG 178
           Q+Q+LSK+E DPV+F LK+ E+S  T S++ P     +  P      T   + +D+K+  
Sbjct: 121 QNQLLSKSERDPVFFDLKAIENSLLTPSTAGP---PATSNPSSNTTPTHPTSDKDAKDLR 177

Query: 179 KIEGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLF 238
                G   EKY++I+ DL   +   SI+DL+ +++QDLNNYSEC IPID GN+VDIK+F
Sbjct: 178 SNRFNG---EKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIF 234

Query: 239 PLLAPPNSCLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTDL 298
           PLL PP +C+S EDVP+S+VNL K+IDVNWDPTM+ IVP+I+G+NSIAKI+KFS SD  L
Sbjct: 235 PLLRPPTTCVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSL 294

Query: 299 VIECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVTSSDL-ELYRL 357
           VIEC++HLIYY CV L+DIFQFSNIYA +SLI  FLTDP +A++CQ+YVT  ++ +L  L
Sbjct: 295 VIECIRHLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNL 354

Query: 358 PF 359
           P 
Sbjct: 355 PL 356

 Score = 51.2 bits (121), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 47/85 (55%), Gaps = 9/85 (10%)

Query: 626 MESETRSKVAFEKGRSPWQVXXXXXXXXXXXVSNLLKEKRHEEFLLLKSVKSVDTFDKIC 685
           ++SE  SKV+FE  R+                + + K    E+ +L KS++S + FDKIC
Sbjct: 544 VKSERPSKVSFEMQRA---------NSLATGKNKIPKLSDEEKKILEKSIRSAENFDKIC 594

Query: 686 MRLEKDREEVEQLLKEMGHYNIINS 710
           + L K ++EVE  L E+G + +INS
Sbjct: 595 VLLGKSKQEVENYLSELGEFKVINS 619

>KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON}
           Anc_6.17 YEL062W
          Length = 540

 Score =  437 bits (1124), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 244/551 (44%), Positives = 320/551 (58%), Gaps = 95/551 (17%)

Query: 1   MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKL 60
           M++ F+GF PIHT+F+S+FHPTEG+KV YQFPP NL+  +INFD+IKN+VIPKPQLC++L
Sbjct: 1   MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRL 60

Query: 61  LTFKYGPYRLACYPVNVNASYYARNSXXXXXXXXXPYNCATSPYEPAVARLGKMFRVLEE 120
           LT +Y  YRL  YPVNV++S YARN           Y+C T PYEPA+ RLGKMF+ LEE
Sbjct: 61  LTLEYKNYRLVSYPVNVSSSSYARNFFSFNFVFIFSYDCQTLPYEPAIERLGKMFKTLEE 120

Query: 121 QSQILSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDTEQGTGLNNSQDSKEQGKI 180
           QSQILSK++    +F                        KD E                 
Sbjct: 121 QSQILSKSQRTSAFF------------------------KDGE----------------- 139

Query: 181 EGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLFPL 240
                          D++    + SI+DL+ +LYQDLNNYSEC IPID GN ++IK+FP+
Sbjct: 140 ---------------DVDFVDTKFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPV 184

Query: 241 LAPPNSC-LSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTDLV 299
           L PP S  +S EDVP+S VNL K++D+NWDPTML I+PFI+GVNSI  I+  S SD +LV
Sbjct: 185 LKPPTSVQISIEDVPLSIVNLDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLV 244

Query: 300 IECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVTSSDLELYRLPF 359
           IEC+KHLIYYNCV++ DIFQFSNIYA +SLI+ FL DP +A  CQ+YV         LP 
Sbjct: 245 IECIKHLIYYNCVIITDIFQFSNIYAPSSLINNFLRDPMIAFNCQSYVV--------LPP 296

Query: 360 ESRPNLLSMHSSRKQNSSSTIHTVGVRNSPNRTNSLDYPSELSTRRNNFXXXXXXXLMRV 419
            S+ N L + S +            + NS     +L       +   +            
Sbjct: 297 GSKINDLPLASEQDDE---------INNSDMTQKALSSSRSSFSSYFSHKSAYARVSETA 347

Query: 420 RDRSGQSTTGSAVDEQES---RLLLPTKSCLFDLYRSLHQGETVKEWYKINFEIIRDNHI 476
                 ST  S+  +Q++     +LP+K  LFDLYRSL+ G TV+ WYK NF  I++NHI
Sbjct: 348 HHHQSTSTLSSSEGQQDNPRQGQVLPSKCTLFDLYRSLNYGCTVEAWYKQNFSTIKENHI 407

Query: 477 DVRRFITFGIVRGLIYRCYAYPVMKNLGALEMLKTLKSASDSRSLRRKLKFREKKNFTNN 536
           DVR+FI FG++  +IYR + YP+M++       KT KS   S     K+           
Sbjct: 408 DVRKFIKFGVINKIIYRVHQYPIMEH-------KTFKSPLLSDRQNDKI----------- 449

Query: 537 VFSTADIKVDL 547
           V ST+DIK D+
Sbjct: 450 VLSTSDIKFDV 460

 Score = 40.4 bits (93), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 30/44 (68%)

Query: 667 EEFLLLKSVKSVDTFDKICMRLEKDREEVEQLLKEMGHYNIINS 710
           E+ +L  +++  ++FD+IC +L K + EVE ++ E+G Y  INS
Sbjct: 497 EKNILFNALERHESFDRICSKLGKSKNEVESIISEIGEYMTINS 540

>Skud_9.35 Chr9 complement(77052..77684) [633 bp, 210 aa] {ON}
           YIL132C (REAL)
          Length = 210

 Score = 34.7 bits (78), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 42/92 (45%), Gaps = 24/92 (26%)

Query: 227 IDSGNSVDIKLFPLLAPP--------------NSCLSFEDVPISTVNLAKLIDVN----- 267
           ID+ NS  +  F  L PP              N+CL  E++   TV + +++ +N     
Sbjct: 40  IDATNSFPLSQFQQLVPPTLPENVKIYENIRINTCLDLEELSAITVKILQMLSMNKISAQ 99

Query: 268 -----WDPTMLKIVPFINGVNSIAKIAKFSSS 294
                 +   LKI+ +ING+  + + ++F SS
Sbjct: 100 KGTKDAEVDSLKIILYINGLEVMCRNSQFKSS 131

>YIL132C Chr9 complement(99860..100501) [642 bp, 213 aa] {ON}
           CSM2Component of the Shu complex, which promotes
           error-free DNA repair; Shu complex mediates inhibition
           of Srs2p function; structural analysis reveals a similar
           DNA-binding region in both Psy3p and Csm2p and that both
           regions work together to form a single DNA binding site;
           required for accurate chromosome segregation during
           meiosis
          Length = 213

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 54/120 (45%), Gaps = 39/120 (32%)

Query: 201 KKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLFPLLAPP--------------NS 246
           K+ LS E ++T+L+            ID+ +S  +  F  L PP              N+
Sbjct: 25  KQNLSKEHVVTQLFF-----------IDATSSFPLSQFQKLVPPTLPENVRIYENIRINT 73

Query: 247 CLSFEDVPISTVNLAKLIDVN------------WDPTMLKIVPFINGVNSIAKIAKFSSS 294
           CL  E++   TV L +++ +N             +P  LKI+ +ING+  + + ++F SS
Sbjct: 74  CLDLEELSAITVKLLQILSMNKINAQRGTEDAVTEP--LKIILYINGLEVMFRNSQFKSS 131

>Kpol_1008.21 s1008 (41825..44221) [2397 bp, 798 aa] {ON}
           (41825..44221) [2397 nt, 799 aa]
          Length = 798

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 4/45 (8%)

Query: 236 KLFPLLAPPNS----CLSFEDVPISTVNLAKLIDVNWDPTMLKIV 276
           ++ P++ PPN      L F+ VP  T +L K +DV   PTM  I 
Sbjct: 708 EILPIMVPPNDFSTRALQFQAVPSKTSSLNKTLDVESPPTMTPIT 752

>Suva_9.57 Chr9 complement(94631..95272) [642 bp, 213 aa] {ON}
           YIL132C (REAL)
          Length = 213

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 41/92 (44%), Gaps = 24/92 (26%)

Query: 227 IDSGNSVDIKLFPLLAPP--------------NSCLSFEDVPISTVNLAKLIDVN----- 267
           ID+ NS  +  F  L PP              N+CL  E++   TV + +++ +N     
Sbjct: 40  IDATNSFPLSHFQQLVPPDLSENVKIYENIRINTCLDLEELSAITVKILQILSMNKINAQ 99

Query: 268 -----WDPTMLKIVPFINGVNSIAKIAKFSSS 294
                     LKI+ +ING+  + + ++F SS
Sbjct: 100 KDTEDAAAGPLKIILYINGLEIMCRNSQFKSS 131

>Kwal_23.5142 s23 (1031446..1034070) [2625 bp, 874 aa] {ON} YFR002W
           (NIC96) - 96 kDa nucleoporin-interacting component
           [contig 8] FULL
          Length = 874

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 51/110 (46%), Gaps = 11/110 (10%)

Query: 267 NWDPTMLK-----IVPFINGVNSIAKIAKFSSSDTDLVIECVKHLIYYNCVVLADIFQFS 321
           NW   + K     I+PF++ V+S  K  +FSS  T+ + + + +L+      +++I    
Sbjct: 766 NWQQALQKVEEIDIIPFVDEVSSRKKAQEFSSLSTE-IAKNIPNLLIMTMTCVSNIVNQL 824

Query: 322 NI--YASTSLISEFLTDPTLASECQTYVTSSDLELYRLPFESRPNLLSMH 369
           N   Y S +   +      LA  C  Y   + +  YR+P E+   L+++ 
Sbjct: 825 NQSEYQSAAKTQQVAAMKRLAKNCMIY---AGMIQYRMPRETYSVLINLE 871

>NCAS0E01440 Chr5 (274594..276591) [1998 bp, 665 aa] {ON} Anc_3.196
           YBR007C
          Length = 665

 Score = 31.6 bits (70), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 33/70 (47%), Gaps = 1/70 (1%)

Query: 18  VFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKP-QLCNKLLTFKYGPYRLACYPVN 76
           VFH  E +      PP+++EN   ++ ++ +   P   Q   KL T  Y P++    P +
Sbjct: 371 VFHFGENSSTTNAKPPSSVENTPTHYRSLSDLQSPNGNQKHEKLATRTYHPFKERSLPPS 430

Query: 77  VNASYYARNS 86
            N   +AR S
Sbjct: 431 TNQRPHARRS 440

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 73,832,736
Number of extensions: 3265756
Number of successful extensions: 12292
Number of sequences better than 10.0: 51
Number of HSP's gapped: 12708
Number of HSP's successfully gapped: 66
Length of query: 710
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 593
Effective length of database: 40,065,477
Effective search space: 23758827861
Effective search space used: 23758827861
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)