Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E01078g6.16ON94894847540.0
KLTH0C11330g6.16ON94189627140.0
Kwal_56.224036.16ON94389226570.0
Ecym_30206.16ON94495425710.0
ACR010C6.16ON94593325440.0
TDEL0G045306.16ON95886425380.0
KLLA0D01045g6.16ON96587725130.0
NCAS0H008806.16ON100489322390.0
KNAG0M011306.16ON95088016870.0
ZYRO0C07898g6.16ON97462016670.0
NDAI0D008706.16ON106960016010.0
Smik_5.266.16ON100262515600.0
YEL061C (CIN8)6.16ON100062715470.0
Skud_5.286.16ON99861715400.0
Suva_5.66.16ON99962815250.0
Kpol_1032.66.16ON100461815200.0
KAFR0L003706.16ON96363614470.0
Kpol_1045.736.16ON96289913941e-177
CAGL0B03641g6.16ON98865313921e-176
TBLA0A072306.16ON109760113901e-175
TPHA0M002406.16ON93959013761e-175
TPHA0J003006.16ON9829029931e-118
Ecym_46887.387ON11345419491e-111
ZYRO0B03234g7.387ON11385169031e-104
KAFR0L017107.387ON11514848931e-103
Smik_2.537.387ON11135996471e-69
YBL063W (KIP1)7.387ON11114606337e-68
Skud_2.417.387ON11102176293e-67
Suva_2.547.387ON11102176284e-67
ACR228C7.387ON11294076275e-67
SAKL0F12298g7.387ON11122306249e-67
TPHA0E008907.387ON12323776199e-66
NCAS0E026407.387ON11023006132e-65
TDEL0C016007.387ON11052456044e-64
NDAI0E043007.387ON11862436011e-63
TBLA0D006407.387ON11423014552e-45
TPHA0D012708.678ON6964143709e-36
KLTH0G03850g5.531ON4731753611e-35
ZYRO0F07414g8.678ON6544133601e-34
SAKL0G05016g5.531ON5041753541e-34
Kwal_47.186085.531ON4791733486e-34
SAKL0G18920g2.633ON6491743404e-32
KLLA0B00759g5.531ON4561743263e-31
KLTH0D11286g8.678ON6784223235e-30
ADR145C2.633ON6352143163e-29
KAFR0F042103.528ON6721783164e-29
Ecym_34152.633ON6621893138e-29
Kpol_1004.255.531ON5061913062e-28
Ecym_40665.531ON4781743025e-28
Kwal_47.190933.528ON8191743085e-28
TBLA0C039403.479ON7391813077e-28
Suva_7.443.528ON8051733069e-28
SAKL0F01760g3.528ON8091883061e-27
KLTH0G01606g3.528ON8191743042e-27
ZYRO0E08668g3.528ON7781813042e-27
Skud_7.533.528ON8051733042e-27
Smik_7.483.528ON8051753042e-27
KNAG0B005203.528ON7231742995e-27
NDAI0I029603.528ON8681843005e-27
TDEL0D059603.528ON7331742996e-27
CAGL0I07029g3.528ON7051752978e-27
ZYRO0D12650g5.531ON4782032911e-26
Kpol_423.83.528ON8061782971e-26
NCAS0E005503.528ON7841752961e-26
YGL216W (KIP3)3.528ON8051732962e-26
KNAG0A078803.479ON7641432916e-26
AER441C3.528ON8181752908e-26
Ecym_12003.528ON8331712853e-25
KLLA0A01606g3.528ON7691742844e-25
Kpol_505.393.479ON6921592835e-25
CAGL0D04994g3.479ON6921722827e-25
TPHA0D034803.528ON8471742837e-25
TBLA0C049603.528ON8011802828e-25
SAKL0F03168g3.479ON7061942818e-25
TBLA0C053103.479ON6761722782e-24
Kpol_1013.78.678ON6201562728e-24
KLTH0F14498g3.479ON7021672738e-24
KAFR0B065903.479ON7061482729e-24
AGR253W3.479ON7091692729e-24
NCAS0F034703.479ON6981512702e-23
NCAS0C013508.678ON6551782692e-23
Ecym_44073.479ON7111692665e-23
TPHA0D032003.479ON7241582666e-23
Kpol_1050.1033.479ON6971522648e-23
TDEL0F036403.479ON7041522622e-22
YPR141C (KAR3)3.479ON7291442603e-22
Suva_16.4693.479ON7311442603e-22
NDAI0B057703.479ON7631552603e-22
ZYRO0B04290g3.479ON7311522594e-22
Skud_16.4353.479ON7291442585e-22
KLLA0B10956g3.479ON6901472576e-22
Smik_16.3883.479ON7291442578e-22
Kwal_26.88068.678ON7152502532e-21
SAKL0H06490g8.678ON6572622523e-21
KAFR0H024108.678ON6582262451e-20
TDEL0A062408.678ON6374062423e-20
KLLA0D05951g8.678ON6684322381e-19
NDAI0E02090singletonON6851912334e-19
CAGL0M02189g8.678ON6721902325e-19
ACR145W8.678ON6852032335e-19
Skud_16.1278.678ON7061952319e-19
YPL155C (KIP2)8.678ON7061962301e-18
Ecym_23958.678ON6872082282e-18
TBLA0C018808.678ON4681482243e-18
Smik_6.3528.678ON7152022246e-18
KNAG0J017208.678ON6251802237e-18
TPHA0D041903.479ON6721442211e-17
TDEL0B072702.633ON6442062192e-17
Suva_16.1558.678ON7041952023e-15
YKL079W (SMY1)2.633ON6561291835e-13
Kwal_55.21164singletonOFF5881631782e-12
Kwal_YGOB_55.211643.479ON6571631772e-12
Kpol_1019.112.633ON6471741763e-12
Suva_11.1452.633ON6571091683e-11
Smik_11.1602.633ON6561091593e-10
KNAG0M025402.633ON5221151575e-10
Skud_11.1482.633ON6561091576e-10
TPHA0N016502.633ON6822031532e-09
NCAS0H031802.633ON6601061423e-08
ZYRO0E01078g2.633ON6681181301e-06
NDAI0C004802.633ON5981761272e-06
TBLA0C008002.633ON6931311263e-06
TBLA0A008202.633ON8031671245e-06
KAFR0C040202.633ON6672661236e-06
CAGL0L05104g2.633ON6751881164e-05
KNAG0H003602.633ON6811341093e-04
NCAS0C052002.633ON5721031020.002
NCAS0C028308.401ON874127810.58
TBLA0A026005.466ON60137762.1
TBLA0F002206.373ON2083134772.2
KLLA0B13882g1.513ON551125762.5
Kwal_55.219147.518ON264248753.1
ZYRO0A03036g3.265ON867167743.8
Smik_13.2442.632ON501132734.3
Cgla_YGOB_Anc_5.6395.639ON483134734.4
TPHA0D021105.360ON35686709.2
Kpol_1008.29singletonON53857719.2
TBLA0F032103.393ON48183719.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E01078g
         (948 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar ...  1835   0.0  
KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {...  1050   0.0  
Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061...  1028   0.0  
Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to ...   994   0.0  
ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON} S...   984   0.0  
TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {O...   982   0.0  
KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar ...   972   0.0  
NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {...   867   0.0  
KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6....   654   0.0  
ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {...   646   0.0  
NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {...   621   0.0  
Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON} ...   605   0.0  
YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}  C...   600   0.0  
Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON} Y...   597   0.0  
Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON} YE...   592   0.0  
Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON} (9109..1...   590   0.0  
KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16...   561   0.0  
Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa] ...   541   e-177
CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} simila...   540   e-176
TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON} Anc_...   540   e-175
TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16...   534   e-175
TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16...   387   e-118
Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} simila...   370   e-111
ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa] ...   352   e-104
KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa] ...   348   e-103
Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W (R...   253   1e-69
YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}  KIP1Kines...   248   7e-68
Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W (R...   246   3e-67
Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W (...   246   4e-67
ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON} ...   246   5e-67
SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa] ...   244   9e-67
TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7....   243   9e-66
NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7....   240   2e-65
TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7....   237   4e-64
NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {...   236   1e-63
TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7....   179   2e-45
TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.6...   147   9e-36
KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some s...   143   1e-35
ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} simila...   143   1e-34
SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly...   140   1e-34
Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {...   138   6e-34
SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]...   135   4e-32
KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some sim...   130   3e-31
KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} simila...   129   5e-30
ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON} S...   126   3e-29
KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {O...   126   4e-29
Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar t...   125   8e-29
Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON} (54983....   122   2e-28
Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar t...   120   5e-28
Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]...   123   5e-28
TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {O...   122   7e-28
Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)   122   9e-28
SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} simila...   122   1e-27
KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} simila...   121   2e-27
ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {...   121   2e-27
Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)   121   2e-27
Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)   121   2e-27
KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528...   119   5e-27
NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {O...   120   5e-27
TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa] ...   119   6e-27
CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} simila...   119   8e-27
ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some...   116   1e-26
Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON} (11134..13...   119   1e-26
NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}...   118   1e-26
YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}  KIP3Kinesin-...   118   2e-26
KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa] ...   116   6e-26
AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}...   116   8e-26
Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar t...   114   3e-25
KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} simila...   114   4e-25
Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}...   113   5e-25
CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {...   113   7e-25
TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {O...   113   7e-25
TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa] ...   113   8e-25
SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} simila...   112   8e-25
TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON} Anc_3...   111   2e-24
Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON} (11880.....   109   8e-24
KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]...   109   8e-24
KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa] ...   109   9e-24
AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic ...   109   9e-24
NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {O...   108   2e-23
NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {O...   108   2e-23
Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar t...   107   5e-23
TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {O...   107   6e-23
Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]...   106   8e-23
TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {O...   105   2e-22
YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON} ...   104   3e-22
Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {...   104   3e-22
NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa] ...   104   3e-22
ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} simila...   104   4e-22
Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {...   103   5e-22
KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} simila...   103   6e-22
Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {...   103   8e-22
Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C...   102   2e-21
SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {...   101   3e-21
KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {O...    99   1e-20
TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON} Anc_8...    98   3e-20
KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} simila...    96   1e-19
NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {O...    94   4e-19
CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa] ...    94   5e-19
ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic ho...    94   5e-19
Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {...    94   9e-19
YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON} ...    93   1e-18
Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}...    92   2e-18
TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.6...    91   3e-18
Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C ...    91   6e-18
KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8....    91   7e-18
TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {O...    90   1e-17
TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa] ...    89   2e-17
Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {...    82   3e-15
YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Prote...    75   5e-13
Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa] {...    73   2e-12
Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)...    73   2e-12
Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {O...    72   3e-12
Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079...    69   3e-11
Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079...    66   3e-10
KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2....    65   5e-10
Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079...    65   6e-10
TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {...    64   2e-09
NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633     59   3e-08
ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar ...    55   1e-06
NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}...    54   2e-06
TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {O...    53   3e-06
TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.6...    52   5e-06
KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.6...    52   6e-06
CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa] ...    49   4e-05
KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633...    47   3e-04
NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON} Anc_2...    44   0.002
NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401     36   0.58 
TBLA0A02600 Chr1 complement(630904..632709) [1806 bp, 601 aa] {O...    34   2.1  
TBLA0F00220 Chr6 complement(34471..40722) [6252 bp, 2083 aa] {ON...    34   2.2  
KLLA0B13882g Chr2 (1216203..1217858) [1656 bp, 551 aa] {ON} high...    34   2.5  
Kwal_55.21914 s55 (1034239..1042167) [7929 bp, 2642 aa] {ON} YLR...    33   3.1  
ZYRO0A03036g Chr1 (245136..247739) [2604 bp, 867 aa] {ON} simila...    33   3.8  
Smik_13.244 Chr13 (383826..385331) [1506 bp, 501 aa] {ON} YMR065...    33   4.3  
Cgla_YGOB_Anc_5.639 Chr12 (1072242..1072856,1072860..1073696) [1...    33   4.4  
TPHA0D02110 Chr4 (433197..434267) [1071 bp, 356 aa] {ON} Anc_5.3...    32   9.2  
Kpol_1008.29 s1008 complement(62595..64211) [1617 bp, 538 aa] {O...    32   9.2  
TBLA0F03210 Chr6 complement(779351..780796) [1446 bp, 481 aa] {O...    32   9.6  

>SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar to
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 948

 Score = 1835 bits (4754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 903/948 (95%), Positives = 903/948 (95%)

Query: 1   MHPLSSRELSEENGQELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEL 60
           MHPLSSRELSEENGQELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEL
Sbjct: 1   MHPLSSRELSEENGQELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEL 60

Query: 61  GITAQMNSKTYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTM 120
           GITAQMNSKTYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTM
Sbjct: 61  GITAQMNSKTYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTM 120

Query: 121 TGDERLYDGELSDAAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQES 180
           TGDERLYDGELSDAAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQES
Sbjct: 121 TGDERLYDGELSDAAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQES 180

Query: 181 GVIKKLRIFDXXXXXXXXXXXXXXXXPNLVGTSGTFKRIFKTPVPYKXXXXXXXXXXXXX 240
           GVIKKLRIFD                PNLVGTSGTFKRIFKTPVPYK             
Sbjct: 181 GVIKKLRIFDSNTTSSNSRNNSRNNSPNLVGTSGTFKRIFKTPVPYKQQQQHQQHLQQQQ 240

Query: 241 XXXPRLINNKQQSLSEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSS 300
              PRLINNKQQSLSEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSS
Sbjct: 241 QQQPRLINNKQQSLSEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSS 300

Query: 301 RSHTIFTIMLYKNHNGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGR 360
           RSHTIFTIMLYKNHNGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGR
Sbjct: 301 RSHTIFTIMLYKNHNGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGR 360

Query: 361 VINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAK 420
           VINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAK
Sbjct: 361 VINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAK 420

Query: 421 NIKNKPQLGTLVMKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKT 480
           NIKNKPQLGTLVMKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKT
Sbjct: 421 NIKNKPQLGTLVMKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKT 480

Query: 481 EVQECKREIEKMNSQNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQD 540
           EVQECKREIEKMNSQNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQD
Sbjct: 481 EVQECKREIEKMNSQNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQD 540

Query: 541 LVCTIHTLKDAIYTVQNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHS 600
           LVCTIHTLKDAIYTVQNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHS
Sbjct: 541 LVCTIHTLKDAIYTVQNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHS 600

Query: 601 SRHLGIDGNIDIIQEELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTV 660
           SRHLGIDGNIDIIQEELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTV
Sbjct: 601 SRHLGIDGNIDIIQEELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTV 660

Query: 661 VDSYSNELVKNLGDISEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSK 720
           VDSYSNELVKNLGDISEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSK
Sbjct: 661 VDSYSNELVKNLGDISEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSK 720

Query: 721 FKEMMDSHLEENKSLMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFD 780
           FKEMMDSHLEENKSLMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFD
Sbjct: 721 FKEMMDSHLEENKSLMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFD 780

Query: 781 STVKDALRRLEGNIEGSLEFSKNTAGDVKDSLKKFDGISEVLKNNTKVVNNINEVKEKHT 840
           STVKDALRRLEGNIEGSLEFSKNTAGDVKDSLKKFDGISEVLKNNTKVVNNINEVKEKHT
Sbjct: 781 STVKDALRRLEGNIEGSLEFSKNTAGDVKDSLKKFDGISEVLKNNTKVVNNINEVKEKHT 840

Query: 841 FLRDQVERTSSYIEAANEKFEGIDQFIRQIIDKKLPTHLVGNGELVNVMLEQLGKTHLKP 900
           FLRDQVERTSSYIEAANEKFEGIDQFIRQIIDKKLPTHLVGNGELVNVMLEQLGKTHLKP
Sbjct: 841 FLRDQVERTSSYIEAANEKFEGIDQFIRQIIDKKLPTHLVGNGELVNVMLEQLGKTHLKP 900

Query: 901 IGXXXXXXXXXXXXXMKTLDNNIFNGISPSKRKVDETENDRSKSQRIK 948
           IG             MKTLDNNIFNGISPSKRKVDETENDRSKSQRIK
Sbjct: 901 IGSASRTPSSRSVSPMKTLDNNIFNGISPSKRKVDETENDRSKSQRIK 948

>KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {ON}
           similar to uniprot|P27895 Saccharomyces cerevisiae
           YEL061C CIN8 Kinesin motor protein involved in mitotic
           spindle assembly and chromosome segregation
          Length = 941

 Score = 1050 bits (2714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/896 (59%), Positives = 674/896 (75%), Gaps = 22/896 (2%)

Query: 9   LSEENGQELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNS 68
           +SEE  +ELNITV+VRCRGRNE+E+KAKSSVVV VPDVTG+NEVSINTT + GITAQ+NS
Sbjct: 1   MSEE--EELNITVAVRCRGRNEKEVKAKSSVVVAVPDVTGTNEVSINTTGDTGITAQINS 58

Query: 69  KTYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYD 128
           KTYTVD+VFGPSADQ LIFK IAEPLF DFIKGYNCTVLVYGMTSTGKTYTMTGDERLYD
Sbjct: 59  KTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYD 118

Query: 129 GELSDAAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQESGVIKKLRI 188
           GELS+ AGIIPR+LFKLFD L+  ++DY++KCSFIELYNEELKDLL+E  +S + +KLRI
Sbjct: 119 GELSEGAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPDSSMPRKLRI 178

Query: 189 FDXXXXXXXXXXXXXXX--XPNLVGTSGTFKRIFKTPVPYKXXXXXXXXXXXXXXXXPRL 246
           FD                  P    TSGT +RI +    YK                 R 
Sbjct: 179 FDSVTNPNSSRSSSRNSSPKPPEGSTSGTKRRI-RPNTMYKPS---------------RS 222

Query: 247 INNKQQSLSEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIF 306
              K    SE +SAI+IQNLQEFHI +AK+GI LLQRGL+HRQVASTKMND SSRSHTIF
Sbjct: 223 PTVKPTLSSELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIF 282

Query: 307 TIMLYKNHNGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA 366
           TIMLY+  NGE FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA
Sbjct: 283 TIMLYRKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA 342

Query: 367 DKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKP 426
           DKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKIN+EETSSTLEYATKAKNIKNKP
Sbjct: 343 DKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKP 402

Query: 427 QLGTLVMKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQECK 486
           Q+G+ +MKD+LVKN+T EL KI+SD L+TKSKDGIYM+Q++YKELT++LENYKTEVQECK
Sbjct: 403 QVGSFIMKDVLVKNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECK 462

Query: 487 REIEKMNSQNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIH 546
           R IE++++QN LL K+KR ++EV+E QR+KIK L++ I  LYDK+D+QHKNEQ+L   + 
Sbjct: 463 RAIERLSTQNGLLTKEKRITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQ 522

Query: 547 TLKDAIYTVQNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSRHLGI 606
            L  A+ T+QNSLK  ED   + ++EME VLY+++ SFK S+  ++  +K +       +
Sbjct: 523 ELMRALRTMQNSLKVYEDQGHRFQTEMERVLYENIGSFKHSLLNEIEKLKGTEED-GFDV 581

Query: 607 DGNIDIIQEELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVVDSYSN 666
           D NID + +EL+++ + I ++++++CR  + KI E  P + + IR  +  I+ VV SYS+
Sbjct: 582 DANIDTLTKELNRIYDFINTSTIEICRKFMNKITEQTPTYLQDIRNQVESITHVVGSYSS 641

Query: 667 ELVKNLGDISEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKFKEMMD 726
           +L+ +L  ISEEYN+ ++YLNEH FKNN ++ L +HVD+TYH LK SA  +F K +EMM+
Sbjct: 642 DLMMHLSSISEEYNHLKDYLNEHFFKNNFQDALDVHVDRTYHQLKVSANSIFLKLREMMN 701

Query: 727 SHLEENKSLMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFDSTVKDA 786
             LE NK +M++SLK A+ EVVAKE+ L  PVKQ WESSLENIN+CD LN+ F+  +   
Sbjct: 702 EELETNKEIMMQSLKNAASEVVAKEMGLLDPVKQAWESSLENINECDKLNSGFEKDIGSV 761

Query: 787 LRRLEGNIEGSLEFSKNTAGDVKDSLKKFDGISEVLKNNTKVVNNINEVKEKHTFLRDQV 846
           +R +   I   L+FS++  GD    L +F   S  L+ +  +  +I E+K+KH  L+ +V
Sbjct: 762 VRDVFEKINEGLQFSESAVGDANLDLSRFQDASRALRTDDVIPGSIEEIKKKHNMLKLKV 821

Query: 847 ERTSSYIEAANEKFEGIDQFIRQIIDKKLPTHLVGNGELVNVMLEQLGKTHLKPIG 902
           + ++SY+EAA +KF  ID  I+ +++ +  +        +  +LEQL    LKP+G
Sbjct: 822 QDSASYMEAATQKFGEIDDSIQGLLNSQAVSQPHSENR-IEGLLEQLNGKPLKPLG 876

>Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061C
           (CIN8) - 1:1 [contig 185] FULL
          Length = 943

 Score = 1028 bits (2657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/892 (58%), Positives = 670/892 (75%), Gaps = 22/892 (2%)

Query: 15  QELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVD 74
           +ELNITV+VRCRGRNE+E+KA+SSVVV VPDVTG+NEVSINTT + GITAQ+NSKTYTVD
Sbjct: 5   EELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64

Query: 75  KVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSDA 134
           KVFGPSADQ LIFK IAEPLF DFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELS+ 
Sbjct: 65  KVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEG 124

Query: 135 AGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQESGVIKKLRIFDXXXX 194
           AGIIPR+LFKLFD L  Q +DY++KCSFIELYNEELKDLL+E  +S + KKLRIFD    
Sbjct: 125 AGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPDSSMPKKLRIFDSVSN 184

Query: 195 XXXXXXXXXXX---XPNLVGTSGTFKRIFKTPVPYKXXXXXXXXXXXXXXXXPRLINNKQ 251
                          PN   + GT +R  + P  ++                     +K 
Sbjct: 185 VSSNSRASSRNNSPKPNEGSSFGT-RRKTRAPSIHRPTKSPV---------------SKP 228

Query: 252 QSLSEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLY 311
            S  E SSAI+IQNLQEFHI +AK+GI LLQRGL+HRQVASTKMND SSRSHTIFTIMLY
Sbjct: 229 VSPCEPSSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLY 288

Query: 312 KNHNGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAH 371
           K  NGE FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK+ H
Sbjct: 289 KKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLH 348

Query: 372 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGTL 431
           IPFRESKLTRLLQDSLGGNTKTALIATISPAKIN+EETSSTLEYATKAKNIKNKPQ+G+ 
Sbjct: 349 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSF 408

Query: 432 VMKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQECKREIEK 491
           +MKD+L+K++T EL KIKSD LSTKSKDGIYM+Q++YKELT++LENYKTEV+ECKR +EK
Sbjct: 409 IMKDVLLKSVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEK 468

Query: 492 MNSQNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHTLKDA 551
           +++QN LL+K+KR S+EV+E Q++K++ L + I  LYDK+D+QHKNEQ+L   +  L  A
Sbjct: 469 VSAQNSLLIKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRA 528

Query: 552 IYTVQNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSRHLGIDGNID 611
           ++T+Q SL+  ED   +  +EME VLYD++ SFK+S+ +++  +K +       ++ N+D
Sbjct: 529 LHTMQQSLRIYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKINVDENGDDVEVNVD 588

Query: 612 IIQEELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVVDSYSNELVKN 671
            +  EL+++ + + S++++V R+ ++K+ +  P +F+ I   +  I++VV SYS+ L+ +
Sbjct: 589 AVTTELTRIFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQVESITSVVSSYSSNLMIH 648

Query: 672 LGDISEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKFKEMMDSHLEE 731
           L  ISEEYNN ++YLNEH FKNN +E L +HVD+TYH LK SA  +F K +EM++  L+ 
Sbjct: 649 LSSISEEYNNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEELDT 708

Query: 732 NKSLMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFDSTVKDALRRLE 791
           NK  M++SL+ A+ EVVAKE+ L  PVKQ WE+SLENIN+CD LNN F++ +   +  + 
Sbjct: 709 NKEFMMQSLRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENKIGVTVNEIF 768

Query: 792 GNIEGSLEFSKNTAGDVKDSLKKFDGISEVLKNNTKVVNNINEVKEKHTFLRDQVERTSS 851
             I+   + S+ T  D K  L +       L+NN  ++ N++ +K+KH  L+ QV+ +++
Sbjct: 769 KTIDQGQKTSQVTTEDAKSELTRVRAAFSSLQNNGIILQNVDSIKKKHNLLKSQVQDSAN 828

Query: 852 YIEAANEKFEGIDQFIRQIIDKK-LPTHLVGNGELVNVMLEQLGKTHLKPIG 902
           Y++AA +KF  ID  I+ +++ + +P     N   ++ +LEQL    LKP+G
Sbjct: 829 YMQAATQKFGEIDNSIQDLLNAQTIPQPQSENP--IDGLLEQLNDKSLKPLG 878

>Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to
           Ashbya gossypii ACR010C
          Length = 944

 Score =  994 bits (2571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/954 (53%), Positives = 687/954 (72%), Gaps = 32/954 (3%)

Query: 7   RELSEENGQELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQM 66
           R + ++  +ELNITV+VRCRGRNEREIKAKS+VVVTVPDVTGSNEVSINTT ++GI  +M
Sbjct: 11  RTMLDDGNEELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKM 70

Query: 67  NSKTYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERL 126
           NS+TYTVD+VFGPSADQ LIFK IAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDE+L
Sbjct: 71  NSRTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKL 130

Query: 127 YDGELSDAAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQESGVIKKL 186
           YDGELSD+AGIIPR+LF+LFDTLE  + D+LVKCS+IELYNEELKDLL++  +    K+L
Sbjct: 131 YDGELSDSAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDYS--KRL 188

Query: 187 RIFDXXXXXXXXXXXXXXXXPNLVGTSGTFKRIFKTPVPYKXXXXXXXXXXXXXXXXPRL 246
           RIFD                    GTS +  +   T +P K                P+ 
Sbjct: 189 RIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTK----------------PKR 232

Query: 247 INNKQQSLSEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIF 306
            +  +Q L EQSSAIYIQNLQEFHITNA++GI++LQ+GLKHRQVASTKMNDFSSRSHTIF
Sbjct: 233 PSLNKQLLYEQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIF 292

Query: 307 TIMLYKNHNGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA 366
           TIMLYK++ GE+FR+SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA
Sbjct: 293 TIMLYKSYEGELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA 352

Query: 367 DKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKP 426
           DK+ HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINA+ETSSTLEYATKAKNIKN+P
Sbjct: 353 DKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRP 412

Query: 427 QLGTLVMKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQECK 486
           QLG+ +MKDILVK+I+ EL+K+KSDFLSTK+K+GIYM+ +HY+E+ +DLENY+TE+QE K
Sbjct: 413 QLGSFMMKDILVKSISSELSKLKSDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQESK 472

Query: 487 REIEKMNSQNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIH 546
           R++E  +SQN LLLKDK+AS +++ELQ +KI  L + I +L DK+++QH+NE DLV TIH
Sbjct: 473 RQVESFSSQNSLLLKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTIH 532

Query: 547 TLKDAIYTVQNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSRHLGI 606
            LK+A++T++ SL+N E ++L+ ++++++VLY  +TS+++S+ + L  +K     ++L I
Sbjct: 533 KLKEALHTMKGSLQNYETHELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLDKNLSI 592

Query: 607 DGNIDIIQEELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVVDSYSN 666
           + N+D I+    + L+S+ S   D+C + V+ + +     ++  +  L D+ T V +YS 
Sbjct: 593 NHNMDEIRTIFHETLDSVRSAGSDMCTNIVKIVKDQPSTSYQQFKEALGDLDTKVQTYSV 652

Query: 667 ELVKNLGDISEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKFKEMMD 726
            L   L +++EE NN +EYL+EH  KNN++E L + ++K YH  K ++  L S    MM+
Sbjct: 653 TLTNKLTEMTEENNNMKEYLDEHFLKNNNQEMLDLRMEKAYHKSKTASDALISSVVSMME 712

Query: 727 SHLEENKSLMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFDSTVKDA 786
           SH+EE+++LM+ S+K A  E++ KE+++F PVK++W  S ENIN+CD+ +  F++     
Sbjct: 713 SHMEESRNLMLSSMKDAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQQFENKSTKL 772

Query: 787 LRRLEGNIEGSLEFSKNTAGDVKDSLKKFDGISEVLKNNTKVVNNINEVKEKHTFLRDQV 846
           L  L+   + S+  + + A  V++++  F+GI         +V  +N++ +KH  L D  
Sbjct: 773 LTNLKELADNSVVAADDVAKQVQENVTNFEGIVRQASAKESIVKQMNDINDKHKMLEDHF 832

Query: 847 ERTSSYIEAANEKFEGIDQFIRQIIDKKLPTHLVGNGELVNVMLEQL-----------GK 895
           E    Y + +++ FE +D  I++II +  P   VG+ + +  +LE++           GK
Sbjct: 833 ENNIKYFKESSKGFEEMDCSIKKIIREMSPE--VGDIKQIEALLERVNSRSFGPIASTGK 890

Query: 896 THLKP-IGXXXXXXXXXXXXXMKTLDNNIFNGISPSKRKVDETENDRSKSQRIK 948
           T ++P +              +K+LD N+ + +   KR   + E D    ++IK
Sbjct: 891 TPMRPELKNPIPKTRSRSMSPIKSLDTNVVHVVPLIKRGTMDIEVDGPAMKKIK 944

>ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL061C
           (CIN8)
          Length = 945

 Score =  984 bits (2544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/933 (54%), Positives = 663/933 (71%), Gaps = 37/933 (3%)

Query: 15  QELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVD 74
           +ELNITV+VRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDE+GI A+MNS+TYTVD
Sbjct: 19  EELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVD 78

Query: 75  KVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSDA 134
           KVFGPSADQSLIFK+IAEPLFDDF+KGYNCTVLVYGMTSTGKTYTMTGDE+LYDG+LSD+
Sbjct: 79  KVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDS 138

Query: 135 AGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQESGVIKKLRIFDXXXX 194
           AGIIPRI+FKLFD LE  D D+LVKCS+IELYNEELKDLL+E  +S   K+LRIFD    
Sbjct: 139 AGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSS--KRLRIFDSSSM 196

Query: 195 XXXXXXXXXXXXPNL--VGTSGTFKRIFKTPVPYKXXXXXXXXXXXXXXXXPRLINNKQQ 252
                       P    V  +G F R  + P P K                 R+   KQQ
Sbjct: 197 NHSSRASSQSNSPREPEVAHNG-FSRRRQRPPPVKAN---------------RMSATKQQ 240

Query: 253 SLSEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYK 312
            LSE  S IY+QN+QEFHI NA++GIN+LQ+GLKHRQVASTKMNDFSSRSHTIFTIMLYK
Sbjct: 241 -LSESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYK 299

Query: 313 NHNGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHI 372
           N +GE+FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK+ HI
Sbjct: 300 NCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHI 359

Query: 373 PFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGTLV 432
           PFRESKLTRLLQDSLGGNTKTALIATISPAKINA+ETSSTLEYA KAKNIKN+PQLG L+
Sbjct: 360 PFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALM 419

Query: 433 MKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQECKREIEKM 492
           MKDILVKNI+ ELAKIKSDFLSTKSKDGIYM+ +HY+E+ +DLEN +TE+QE KR+IE +
Sbjct: 420 MKDILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESKRQIESL 479

Query: 493 NSQNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHTLKDAI 552
            SQN LLLKDK+AS EV+ELQ  KIK L   I +LYDK+++QH NE +L  TIH LK+A+
Sbjct: 480 TSQNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATTIHKLKEAL 539

Query: 553 YTVQNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSRHLGIDGNIDI 612
           +T+Q SLK+ E ++L+ ++++++VLY  +TS+++S+++ L  +K S   ++L I  NI+ 
Sbjct: 540 HTMQGSLKSYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSMLDKNLSIKENINN 599

Query: 613 IQEELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVVDSYSNELVKNL 672
           I       L+S+ +   D+C + V+ I E+   + +     +  + + + SYSN L   L
Sbjct: 600 ITTIFDDTLKSVEANGSDMCDTLVKLIKETPSMYLKEFNETVSSLKSELSSYSNALTNKL 659

Query: 673 GDISEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKFKEMMDSHLEEN 732
            +ISEE N+ REYL++HLFKN+ +E L + ++  Y  +K  + +L SK   M+ +H+EE+
Sbjct: 660 TEISEENNHLREYLDQHLFKNSTQEVLDLRMESVYQKVKNDSDQLLSKLVSMVGAHVEES 719

Query: 733 KSLMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFDSTVKDALRRLEG 792
           ++LM+ S+K   +E++  E  LF P++ +W +S +NIN+CD+ +  F++     L +L+ 
Sbjct: 720 RTLMVNSMKDTVNEIIDNERSLFQPIRDRWIASCDNINQCDASHQNFEAKSTSGLDKLKE 779

Query: 793 NIEGSLEFSKNTAGDVKDSLKKFDGISEVLKNNTKVVNNINEVKEKHTFLRDQVERTSSY 852
             + SL+ S++     K     F    + L  +  +   ++++ +KH  L D  +    Y
Sbjct: 780 LSDASLKSSEDAVNKAKHRTDSFHDFVQKLCCDQSLKKQMHDISDKHRMLEDHFDDNVKY 839

Query: 853 IEAANEKFEGIDQFIRQIIDKKLPTHLVGNGELVNVMLEQLGKTHLKPI----------- 901
            + +++ FE +D  I++II +  P   VG+ + V  ++E++      P+           
Sbjct: 840 FKESSKGFEDMDCSIKKIIHEMSPE--VGDIKSVETLMERINARTFSPVRPTGKTPSRQV 897

Query: 902 --GXXXXXXXXXXXXXMKTLDNNIFNGISPSKR 932
                           +KTLD N+   ISP KR
Sbjct: 898 LKNAITSKASSRSMSPIKTLDTNV-RIISPVKR 929

>TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {ON}
           Anc_6.16 YEL061C
          Length = 958

 Score =  982 bits (2538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/864 (58%), Positives = 645/864 (74%), Gaps = 14/864 (1%)

Query: 8   ELSEENGQELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMN 67
           + S E+ +ELNITV+VRCRGRNEREIKAKSSVVV+VPDVTGSNEVSINTT ++GITAQ+N
Sbjct: 6   QASGEDVEELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQIN 65

Query: 68  SKTYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLY 127
           SKTYTVD+VFGPSA+QSL+F++IAEPLF DFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY
Sbjct: 66  SKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY 125

Query: 128 DGELSDAAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQESGVIKKLR 187
           DGELS++AGIIPRILFKLF+TLE Q EDY+VKCSF+ELYNEELKDLL + QE    +KLR
Sbjct: 126 DGELSESAGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIASSRKLR 185

Query: 188 IFDXXXXXXXXXXXXXXXXPNLVGTSGTFKRIFKTPVPYKXXXXXXXXXXXXXXXXPRLI 247
           IFD                 N + T  + K                          P + 
Sbjct: 186 IFDSNTMSAAT---------NSMSTGNSTKNSRNNSPRSSSELPTATFLRKRWKTAPSVT 236

Query: 248 NNKQQSLSEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFT 307
            + Q S  +Q++ IYIQNLQ+FHITNAK+GI LLQ+GLKHRQVA+TKMNDFSSRSHTIFT
Sbjct: 237 QSHQNS-QDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFT 295

Query: 308 IMLYKNHNGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD 367
           I LYK +NGE+FRVSKMNLVDLAGSENISRSGAQ+QRAKEAGSINQSLLTLGRVINSL D
Sbjct: 296 ITLYKEYNGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTD 355

Query: 368 KNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQ 427
           K+ H+PFRESKLTRLLQDSLGGNTKTALIATISPAKIN+EET STL+YA KAKNIKNKPQ
Sbjct: 356 KSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQ 415

Query: 428 LGTLVMKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQECKR 487
           LG+++MKDILVKNIT ELAKIK+D LSTKSK+GIYM+QD+YKELT+DLE+YKTEV+ECKR
Sbjct: 416 LGSVIMKDILVKNITGELAKIKADLLSTKSKEGIYMSQDNYKELTNDLESYKTEVKECKR 475

Query: 488 EIEKMNSQNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHT 547
            IE + SQN LLLKDK+AS+EV++LQRIK++++ D ++ LY K +KQ+K EQ+LV T  T
Sbjct: 476 AIETLTSQNTLLLKDKKASNEVNDLQRIKLQNMRDAMSDLYSKAEKQNKREQNLVATAST 535

Query: 548 LKDAIYTVQNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSRHLGID 607
           LK  + T+Q+ +K  E  +   +S+M D+  +     KQ+I   +  ++      ++G+ 
Sbjct: 536 LKTTVGTMQSIIKEHERRERDIESKMGDLFNNEFARVKQTILSNIRDIEQQIDWENIGVQ 595

Query: 608 GNIDIIQEELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVVDSYSNE 667
           GNID I+ E+S++LE     + D+ + CVEKIL+  P HF+     + ++  ++ +   +
Sbjct: 596 GNIDSIRGEISKLLERAQQQTDDMYKDCVEKILDETPGHFQLAAEKVSEVEKLIATCHRD 655

Query: 668 LVKNLGDISEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKFKEMMDS 727
           L +NL D+SEE+NN R+YLN+H FKNNHEE L  H+D+TYH ++ SA +LF +FKEMMD+
Sbjct: 656 LTENLSDVSEEFNNLRQYLNDHFFKNNHEEILVSHIDRTYHHIQTSADDLFQQFKEMMDN 715

Query: 728 HLEENKSLMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFDSTVKDAL 787
           HLE+NK LM++SLKTA+ +V+ KE++LF P K+KWE S + INKCDS+N  F + VK  L
Sbjct: 716 HLEKNKDLMLESLKTATYDVIRKEMQLFEPQKKKWEDSFKYINKCDSINFAFQNGVKSPL 775

Query: 788 RRLEGNIEGSLEFSKNTAGDVKDSLKKFDGISEVLKNNTKVVNNINEVKEKHTFLRDQVE 847
             ++  +  S E    T   VK+ + + +  + +L N+       + +  K + L + ++
Sbjct: 776 LGIKSTLGSSQEAINKTITKVKEQMDEHESPASMLSNSRVFSEQFSGILNKQSLLHESLK 835

Query: 848 R----TSSYIEAANEKFEGIDQFI 867
           +    TS + +A ++  E ID  +
Sbjct: 836 KSVIITSDHADAVDKLKEAIDHVV 859

>KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar to
           uniprot|Q8J1G7 Ashbya gossypii ACR010C CIN8 Kinesin-like
           protein CIN8 and some similarites with YEL061C
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 965

 Score =  972 bits (2513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/877 (55%), Positives = 649/877 (74%), Gaps = 16/877 (1%)

Query: 14  GQELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTV 73
           G ELNITV+VRCRGRNE+EIKAKSSVVV  PDV G+NEVSINT+ ++GITA+MNSKTYTV
Sbjct: 10  GDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTV 69

Query: 74  DKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSD 133
           DKVFGPSADQSL+FK+IA+P+F DFIKGYNCT+LVYGMTSTGKTYTMTGDE+LYDGELS+
Sbjct: 70  DKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSE 129

Query: 134 AAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQESGV--IKKLRIFDX 191
           AAGIIPR+LFKLFDTLE Q+ DY+VKCSFIELYNEELKDLL++ Q+SG    +KLRI+D 
Sbjct: 130 AAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRIYDS 189

Query: 192 -----XXXXXXXXXXXXXXXPNL-------VGTSGTFKRIFKTPVPYKXXXXXXXXXXXX 239
                               P +       +     +K   K  +P +            
Sbjct: 190 LNSSNNVTNVNSRSSSRSNSPTVNLEAKRRIRAGALYKP--KPKLPTQSQSNGQQQQQQQ 247

Query: 240 XXXXPRLINNKQQSLSEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFS 299
                +     Q  ++EQSSAIYIQ+LQEFHIT+AK+G+ LLQ+GL HRQVASTKMND S
Sbjct: 248 QQQQQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVS 307

Query: 300 SRSHTIFTIMLYKNHNGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLG 359
           SRSHTIFT+ LYKN NGE FRVSK+NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLG
Sbjct: 308 SRSHTIFTLTLYKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLG 367

Query: 360 RVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKA 419
           RVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKIN+EETSSTLEYATKA
Sbjct: 368 RVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKA 427

Query: 420 KNIKNKPQLGTLVMKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYK 479
           KNIKNKPQLG+ +MKDILVKNI+ ELAK+KSDFLSTKSK+GIYM+  HY E+ +D+ENYK
Sbjct: 428 KNIKNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYK 487

Query: 480 TEVQECKREIEKMNSQNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQ 539
           TE+QE +REIEK++SQN LL KDK++S +  E QR++I++L   + +LY+K+D +HKNE 
Sbjct: 488 TEIQESRREIEKLSSQNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEI 547

Query: 540 DLVCTIHTLKDAIYTVQNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASH 599
           +L   I  LKDA+  +Q +LK  ED++ + +S+++ +LYD++  +++ I  +L  +K   
Sbjct: 548 ELTNMIMKLKDAVRNMQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQA 607

Query: 600 SSRHLGIDGNIDIIQEELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDIST 659
             +   ID +I+ +++ L  +LE++   ++ +C +  +K++   PK F S+  +L D+ +
Sbjct: 608 LEQSFTIDDDINNVKDSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFS 667

Query: 660 VVDSYSNELVKNLGDISEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFS 719
            VD +++ L + L  I+ E NN + YL+ H F+NNH+E L++H DKTYH L  S+  L S
Sbjct: 668 KVDEHTDRLKEGLSQITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMS 727

Query: 720 KFKEMMDSHLEENKSLMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTF 779
           K   ++  H+E+N++L++ +LKTA+ EV+ +E+  F PV++ WE S  +IN CDSL+N F
Sbjct: 728 KITNIISDHVEQNRTLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKF 787

Query: 780 DSTVKDALRRLEGNIEGSLEFSKNTAGDVKDSLKKFDGISEVLKNNTKVVNNINEVKEKH 839
                ++L  L+ ++E ++  S   A  +KD+L  F   +++    T +   ++++K KH
Sbjct: 788 KDDTTESLNSLKSHMESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGTVDDIKNKH 847

Query: 840 TFLRDQVERTSSYIEAANEKFEGIDQFIRQIIDKKLP 876
           + LRD++E+  S+I A++E F+ ID  +++I++ ++P
Sbjct: 848 SVLRDELEKNVSFIHASSEGFKAIDSSLKRIMNFRMP 884

>NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {ON}
           Anc_6.16
          Length = 1004

 Score =  867 bits (2239), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/893 (51%), Positives = 618/893 (69%), Gaps = 47/893 (5%)

Query: 3   PLSSRELSEENGQELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGI 62
           PL++     E   ELNITV+VRCRGRNEREI +KS VVVTVPD+TG+ E+SINTT E GI
Sbjct: 15  PLTTTREPPEEDTELNITVAVRCRGRNEREINSKSPVVVTVPDITGAQEISINTTGETGI 74

Query: 63  TAQMNSKTYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTG 122
           TAQMNSKTYTVDKVFGP+ADQ LIF+++AEPLF DF+KGYNCTVLVYGMTSTGKTYTMTG
Sbjct: 75  TAQMNSKTYTVDKVFGPAADQDLIFQEVAEPLFRDFVKGYNCTVLVYGMTSTGKTYTMTG 134

Query: 123 DERLYDGE--LSDAAGIIPRILFKLFDTLETQDE--------DYLVKCSFIELYNEELKD 172
           DE+LY     LSDAAGIIPRILFKLFDTL+            D++VKCSF+ELYNE+LKD
Sbjct: 135 DEKLYQNGTMLSDAAGIIPRILFKLFDTLDNHRHSDVTGSTTDFVVKCSFVELYNEDLKD 194

Query: 173 LLN-----EPQESGVI--KKLRIFDXXXXXXXXXX--------------XXXXXXPNLVG 211
           LLN     E Q+   +  +KLRIFD                              PN   
Sbjct: 195 LLNYDSNDEQQQQQQLGSRKLRIFDSTNNNNNNSNSNASSRASSRNNSPRTSSILPNANA 254

Query: 212 TSGTFKRIFKTPVPYKXXXXXXXXXXXXXXXXPRLINNKQQSLS---EQSSAIYIQNLQE 268
           T+   +   K  + Y                     N++  S++   E ++ IYIQNLQE
Sbjct: 255 TNLAMR---KKSIRYNYNSNNKAKSSNNTRPN---TNDEPSSIAGPDENTNGIYIQNLQE 308

Query: 269 FHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHNGEVFRVSKMNLVD 328
           FHITNAK+G++LLQ+GLKHRQVASTKMNDFSSRSHTIFTI LYK H   +FR+SKMNLVD
Sbjct: 309 FHITNAKEGLSLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKEHKDNLFRLSKMNLVD 368

Query: 329 LAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLG 388
           LAGSENI+RSGA NQRAKE GSINQSLLTLGRVINSLADK+ H+PFRESKLTRLLQDSLG
Sbjct: 369 LAGSENINRSGAMNQRAKETGSINQSLLTLGRVINSLADKSPHVPFRESKLTRLLQDSLG 428

Query: 389 GNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGTLVMKDILVKNITRELAKI 448
           GNTKTALIATISPAK+ +EET STLEYA+KAKNIKNKPQLG++++KDIL+KNIT ELAK+
Sbjct: 429 GNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSVILKDILLKNITSELAKV 488

Query: 449 KSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQECKREIEKMNSQNVLLLKDKRASHE 508
           KSD +STKSKDGIYM+ +HY+EL  +LE+ KTEVQE KR IEK++SQN +LLKDKR+++E
Sbjct: 489 KSDLMSTKSKDGIYMSHEHYQELIMELESSKTEVQESKRMIEKLSSQNSMLLKDKRSANE 548

Query: 509 VSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHTLKDAIYTVQNSLKNCEDYQLQ 568
           V+ELQRIK+ +L D +++L +K++ Q+  E  L+  I  L+ +   + + +KN +  Q Q
Sbjct: 549 VNELQRIKLNNLKDSMSNLNEKLEIQNGKETKLMEQIGQLEKSREKLNSLVKNYQTKQSQ 608

Query: 569 CKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSRHLGIDGNIDIIQEELSQVLESICSTS 628
            K+++ ++L +++   K+ ++    A++ S    +  ++ N+ +I++E++ +LE     +
Sbjct: 609 LKTQISNILNENLFELKKILNSHKDAIRQSEG--NFDVEMNLKVIKDEITSMLEKTQHKT 666

Query: 629 VDVCRSCVEKILESNPKHFESIRRDLLDISTVVDSYSNELVKNLGDISEEYNNFREYLNE 688
             + +  +E+ LE  P + + I   +  +  +V  Y NE+ +NL DISEEYNN ++YL+ 
Sbjct: 667 EMMYKEFIEEFLEQTPINLQKIFEHVTQVEFMVTGYYNEITENLSDISEEYNNLKQYLDN 726

Query: 689 HLFKNNHEETLSIHVDKTYHMLKKSAGELFSKFKEMMDSHLEENKSLMIKSLKTASDEVV 748
             F+NNHE+ L+IH++ T  +L +S+ ELF+KFK MMD+HL ENK LMI + +TA+++V+
Sbjct: 727 DFFQNNHEDLLNIHINATSDILAQSSAELFNKFKIMMDAHLMENKKLMIDNFRTATNDVI 786

Query: 749 AKEVKLFAPVKQKWESSLENINKCDSLNNTFDSTVKDALRRLEGNIEGSLEFSKNTAGDV 808
            KE++LF P + KWE S+E IN+CDS+NN F   +   + +++ N+  S     N    +
Sbjct: 787 TKEMELFKPKRNKWEESIELINRCDSINNGFHHNMTGQVSKIKTNLASSSSSIHNAIASI 846

Query: 809 K----DSLKKFDG-ISEVLKNNTKVVNNINEVKEKHTFLRDQVERTSSYIEAA 856
           K    + L   D  +   L+N+     + NE+ EK+  L+   +   +Y + +
Sbjct: 847 KSQVLEQLSNDDSDVKTALENDPMFNKHFNEIIEKNMILQKNRKNAINYTDKS 899

>KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6.16
           YEL061C
          Length = 950

 Score =  654 bits (1687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/880 (43%), Positives = 551/880 (62%), Gaps = 46/880 (5%)

Query: 16  ELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVDK 75
           ++NITV+VRCRGRN+REI+AKS +VVTVPDVT + EVSINT+   GI AQ+ +KTYTVDK
Sbjct: 24  DINITVAVRCRGRNKREIEAKSPIVVTVPDVTTTPEVSINTSGGSGIEAQLQAKTYTVDK 83

Query: 76  VFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGD-ERLYDGELSDA 134
           V+GP + Q L+F+  AEPLF DF++GYNCT+LVYGMTSTGKTYTMTGD E   +G+++  
Sbjct: 84  VYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDVNGQ 143

Query: 135 AGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNE---------------PQE 179
           AGI PRIL KLF+ L+   +DY+VKCSF+ELYNE+L+DLL+E               P+ 
Sbjct: 144 AGIAPRILVKLFECLQ---DDYVVKCSFVELYNEDLRDLLSEGQDDFSNGTENSSKQPES 200

Query: 180 SGVIKKLRIFDXXXXXXXXXXXXXXXXPNLVGTSGTFKRIFKTPVPYKXXXXXXXXXXXX 239
               KKLRIFD                      + T     K    Y             
Sbjct: 201 LNASKKLRIFDSNNSRSNSP------------VTNTNNPTHKARSDYLKKKLKSNRKKSL 248

Query: 240 XXXXPRLINNKQQSLSEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFS 299
                      +  +    + IYIQNL++FHI+ AK+G+ LLQRGL+ RQVA+TK+ND S
Sbjct: 249 DDMSLNANAGGKTHVPPTQTGIYIQNLKDFHISTAKEGLQLLQRGLQRRQVATTKLNDVS 308

Query: 300 SRSHTIFTIMLYKNHNGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLG 359
           SRSHTIFTI LYK    +++R+SK+NLVDLAGSEN++++GA N RAKE+GSINQSLLTLG
Sbjct: 309 SRSHTIFTITLYKKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLG 368

Query: 360 RVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKA 419
           RVINSLADK+AHIPFRESKLTRLLQDSLGGNTKT LIATISPAKI AEET STLEYA+KA
Sbjct: 369 RVINSLADKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKA 428

Query: 420 KNIKNKPQLGTLVMKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYK 479
           KNIKNKPQLG+ ++KDIL+K++++EL K+++D   TKSK+GIY++Q +YKE+  DL+N+K
Sbjct: 429 KNIKNKPQLGSFIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFK 488

Query: 480 TEVQECKREIEKMNSQNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQ 539
           TE+ E KR  + +  +N LL K+K++  E ++  + ++ +L  ++  + +K+ + +    
Sbjct: 489 TELTELKRTNDSLVQENELLGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNT 548

Query: 540 DLVCTIHTLKDAIYTVQNSLKN-CEDYQLQ---CKSEMEDVLYDHVTSFKQSIHEQLAAM 595
            L   +  +      +Q  LK+  E YQ +    K + + +L D + +    I  Q   +
Sbjct: 549 KLSEQVTDMN----RIQTELKSLIEVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTL 604

Query: 596 KASHSSRHLGIDGNIDIIQEELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLL 655
           K  +S  +  I  +ID I+ E+  +LE+    +  + +SC++ +L+  PK F+ I  ++ 
Sbjct: 605 KNVNSGNY-QIHTHIDSIRGEVMNLLETTKENAETLYKSCIDDLLKETPKIFQLISDNVG 663

Query: 656 DISTVVDSYSNELVKNLGDISEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAG 715
           DI  + + +  E+ +N  D+SEE+N F++YL+   F+NNH E +  H D     ++K + 
Sbjct: 664 DIRGMTEEHYTEMARNFSDLSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSD 723

Query: 716 ELFSKFKEMMDSHLEENKSLMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSL 775
           +L    +  + ++L  N  ++  S+   + +V+ KE+ LFAP K KWE S++ IN+ DSL
Sbjct: 724 DLLQSVQNSIQNYLSTNAQMVTNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSL 783

Query: 776 NNTFDSTVKDALRRLEGNIEGSLEFSKNTAGDVKDSLKKFD-GISEVLKNNTKVVNNINE 834
           +N F + +  ++  +   I  S E    +   +K  + + D    E + +N  + N+   
Sbjct: 784 SNKFRNNMTKSVDDIASVIRNSNESMDRSISTIKKHIIENDINSQEQINSNELLTNSFKA 843

Query: 835 VKEKHTFLRDQVERTSSYIEAANEKFEGI---DQFIRQII 871
           ++EK   +   V  T      A E  +GI   D+ IR +I
Sbjct: 844 IQEKSNNILHLV--TGDLTVTAQESMDGIQNLDRSIRTLI 881

>ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {ON}
           some similarities with uniprot|P27895 Saccharomyces
           cerevisiae YEL061C CIN8 Kinesin motor protein involved
           in mitotic spindle assembly and chromosome segregation
          Length = 974

 Score =  646 bits (1667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/620 (52%), Positives = 449/620 (72%), Gaps = 7/620 (1%)

Query: 259 SAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHNGEV 318
           S +YIQNLQ+FHIT+A+DG+ LLQ+GL++RQVA+TKMNDFSSRSHTIFTI LY+ H GE+
Sbjct: 275 SGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEM 334

Query: 319 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESK 378
           F+VSKMNLVDLAGSENISRSGAQ+QRAKEAGSINQSLLTLGRVINSLADK+AH+PFRESK
Sbjct: 335 FKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESK 394

Query: 379 LTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGTLVMKDILV 438
           LTRLLQDSLGGNTKTALIATISPAKIN+EET STL+YA+KAKNIKN+PQL + +MKDILV
Sbjct: 395 LTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILV 454

Query: 439 KNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQECKREIEKMNSQNVL 498
           KNIT ELAK+KSD LSTK ++G+YM+QD+YKE+T+DLE+YKTE+QE KR IE+++SQN L
Sbjct: 455 KNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSL 514

Query: 499 LLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHTLKDAIYTVQNS 558
           LLKDK+AS+EV+ELQRIK++++ D ++ L +K++ QHK EQ+LV     LK  +   Q+ 
Sbjct: 515 LLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSV 574

Query: 559 LKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSRHL-------GIDGNID 611
           +K     + Q    M+ +L      F+Q +   +  ++ +HS   +       GI  N++
Sbjct: 575 IKEYGQREKQISERMQMILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLN 634

Query: 612 IIQEELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVVDSYSNELVKN 671
           ++++E+ ++L      +  + +  +EKILE  P  F++I   +  +   V++Y   L +N
Sbjct: 635 VLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTEN 694

Query: 672 LGDISEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKFKEMMDSHLEE 731
           L DISE YNN ++Y N+H FKNNHEE L+ H+DKTY  L+ SA  L  KFK+MMD HL++
Sbjct: 695 LSDISEGYNNLKQYFNDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKD 754

Query: 732 NKSLMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFDSTVKDALRRLE 791
           NK+LM+KSL++A+ E + KE++LF P ++KWE S + IN CDS++N F+  ++ AL  ++
Sbjct: 755 NKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALSDIK 814

Query: 792 GNIEGSLEFSKNTAGDVKDSLKKFDGISEVLKNNTKVVNNINEVKEKHTFLRDQVERTSS 851
                S +    +   VKD +K ++  S +L  N  V   I ++  K + LR+ + ++  
Sbjct: 815 STFGSSTDVISRSVSKVKDEVKGYEDASTILDGNEVVKRQIADIINKDSSLRNGLYKSIK 874

Query: 852 YIEAANEKFEGIDQFIRQII 871
             +     F+ + + IR  I
Sbjct: 875 SSQGHISAFDELKERIRNTI 894

 Score =  298 bits (763), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 141/179 (78%), Positives = 167/179 (93%)

Query: 12  ENGQELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTY 71
           E+ +ELNITV+VR RGRNEREI+AKSSVVV+VPDV GS+EV+INTTD++GITAQMNSKTY
Sbjct: 10  EDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTY 69

Query: 72  TVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGEL 131
            VDKVFGPSA+Q LIFK+IAEPLF DF+KGYNCTVLVYGMTSTGKTYTMTGDE+LY+ EL
Sbjct: 70  AVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDEL 129

Query: 132 SDAAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQESGVIKKLRIFD 190
           SD+AGIIPRILFKLF+TL+ +DEDY+VKCSF+ELYNEELKDLL++  E+  ++KLRI+D
Sbjct: 130 SDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRIYD 188

>NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {ON}
           Anc_6.16
          Length = 1069

 Score =  621 bits (1601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/600 (52%), Positives = 433/600 (72%), Gaps = 6/600 (1%)

Query: 256 EQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHN 315
           + ++ IYIQNLQEFHI+NAK+G+ LLQ+GLK+RQVASTKMNDFSSRSHTIFTI LYK H 
Sbjct: 342 DNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQ 401

Query: 316 GEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFR 375
           G +FR+SKMNLVDLAGSENI+RSGA NQRAKE GSINQSLLTLGRVINSLAD+N HIPFR
Sbjct: 402 GTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPFR 461

Query: 376 ESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGTLVMKD 435
           ESKLTRLLQDSLGGNTKTALIATISPAK+ +EET STLEYA+KAKNIKNKPQLG+++ KD
Sbjct: 462 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISKD 521

Query: 436 ILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQECKREIEKMNSQ 495
           IL+KNIT EL+++KSD LSTKSK+GIYM+Q+HY++L ++L+N+KTE  E KR IE+++SQ
Sbjct: 522 ILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSSQ 581

Query: 496 NVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHTLKDAIYTV 555
           N LLLKDKR S+EV+ELQRIK+    D I  L +K++ Q+  EQ LV ++  L+ +  T 
Sbjct: 582 NALLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDTF 641

Query: 556 QNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSRHLGIDGNIDIIQE 615
           +  ++N E  Q+  KS++E +L D + S +  + +    +K  +S     I  N+D+IQ 
Sbjct: 642 KKMIENYECQQIDVKSKIEQILEDDLLSLRNLLQDHQNKIKTLNSGTDFDIGSNLDMIQN 701

Query: 616 ELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVVDSYSNELVKNLGDI 675
           E+ ++L +    +    +  +E  L+  P++F+ I  D+ DI+  + ++   + +NL DI
Sbjct: 702 EVIKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHAAVAQNLSDI 761

Query: 676 SEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKFKEMMDSHLEENKSL 735
           SEEYNN ++YLNE+LF+NNHE+ ++ H++ T   L  SA  LF+ FK+MM+ HLE N++L
Sbjct: 762 SEEYNNLKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMNKHLESNRNL 821

Query: 736 MIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFDSTVKDALRRLEGNIE 795
           M+ S K A+DEV+ KE++LF P K+KWE S++ IN+CDSLNN F   V D L      I 
Sbjct: 822 MLNSFKAATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQKEVTDGLSYTRSKIT 881

Query: 796 GSLEFSKNTAGDVKDSLKKFDG------ISEVLKNNTKVVNNINEVKEKHTFLRDQVERT 849
            S+    + +  +K  +   +G         V+++N  +    NE+  K++  +D VE +
Sbjct: 882 ASINQMYDNSTRLKTEMSADNGGYNSINTKNVVEDNQIIRTQFNELARKNSIFQDNVENS 941

 Score =  303 bits (777), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 159/179 (88%), Gaps = 5/179 (2%)

Query: 17  LNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVDKV 76
           LNITV+VRCRGRNEREIK KSSV+VTVPD+ GSNEVSINTTD++GITAQMNSKTYTVDKV
Sbjct: 52  LNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVDKV 111

Query: 77  FGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSDAAG 136
           FGPSA+Q LIF ++AEPLF DFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GELS++AG
Sbjct: 112 FGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSESAG 171

Query: 137 IIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNE-----PQESGVIKKLRIFD 190
           IIPRILFKLFDTLE   EDY+VKCSFIELYNE+LKDLLN+           I KLRIFD
Sbjct: 172 IIPRILFKLFDTLEMNQEDYVVKCSFIELYNEDLKDLLNDNNNSINNSKSNINKLRIFD 230

>Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON}
           YEL061C (REAL)
          Length = 1002

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/625 (51%), Positives = 428/625 (68%), Gaps = 5/625 (0%)

Query: 248 NNKQQSLS--EQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTI 305
           N ++ SL+  +QS+ IYIQNLQEFHITNA +G+ LLQ+GLKHRQVASTKMNDFSSRSHTI
Sbjct: 303 NGQRNSLAPNDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTI 362

Query: 306 FTIMLYKNHNGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL 365
           FTI LYK H  E+FR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L
Sbjct: 363 FTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL 422

Query: 366 ADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNK 425
            DK+ HIPFRESKLTRLLQDSLGGNTKTALIATISPAK+ +EET STLEYA+KAKNIKNK
Sbjct: 423 VDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 482

Query: 426 PQLGTLVMKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQEC 485
           PQLG  +MKDILVKNIT ELAKIKSD LSTKSK+GIYM QDHYK L SDLE+YK EVQEC
Sbjct: 483 PQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQEC 542

Query: 486 KREIEKMNSQNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTI 545
           KREIE + S+N LL+K+K  S E  + Q  +I+ L   I HL  ++DKQHK E ++    
Sbjct: 543 KREIESLTSKNSLLVKEKLKSKETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISGFN 602

Query: 546 HTLKDAIYTVQNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSRHLG 605
             L+     +Q +L++ +  +L    + E  +   + + K ++  QL+ ++  +  +   
Sbjct: 603 SKLQKLTEVMQMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQETD 662

Query: 606 IDGNIDIIQEELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVVDSYS 665
           I  N+DII+ E+  ++E++   +  + + CV+KIL  +PK F +I   +  I    + + 
Sbjct: 663 IQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFERFY 722

Query: 666 NELVKNLGDISEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKFKEMM 725
             + +NL DISEE NN ++Y   H F+NNH+E LS HVD TY  ++K   +    FK+ +
Sbjct: 723 KNIAENLSDISEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKKAL 782

Query: 726 DSHLEENKSLMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFDSTVKD 785
           + HLEENK L++K+L T +  V+ +E+ LF P + KWE S + IN+CDS+NN F +++  
Sbjct: 783 NDHLEENKKLIMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYNSMAT 842

Query: 786 ALRRLEGNIEGSLEFSKNTAGDVKDSLKKFDGISEVLKNNTKVVNNINEVKEKHTFLRDQ 845
            L +++  ++ S      +   +K  +++ +    +LKNN K  +   ++  KHT L+D 
Sbjct: 843 TLSQIKSTVDTSSNSMNKSISVMKGQVEESENAISLLKNNIKFNDQFKQLINKHTILKDN 902

Query: 846 VERTSSYIEAANEKFEGIDQFIRQI 870
           +E   S I + N     ID     I
Sbjct: 903 IE---SSITSTNSHITNIDDIYNTI 924

 Score =  293 bits (751), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 153/184 (83%), Gaps = 8/184 (4%)

Query: 15  QELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVD 74
           +ELNITV+VRCRGRNEREI  KSSVVV VPD+TGS E+SINTT + GITAQMN+K YTVD
Sbjct: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92

Query: 75  KVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSDA 134
           KVFGP A Q LIF ++A PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GELSD+
Sbjct: 93  KVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDS 152

Query: 135 AGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQ--------ESGVIKKL 186
           AGIIPR+L KLFDTLE Q  DY+VKCSFIELYNEELKDLL+           +   +KKL
Sbjct: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNSSSNNGFDGQFMKKL 212

Query: 187 RIFD 190
           RIFD
Sbjct: 213 RIFD 216

>YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}
           CIN8Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 1000

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/627 (50%), Positives = 431/627 (68%), Gaps = 4/627 (0%)

Query: 255 SEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNH 314
           ++Q++ IYIQNLQEFHITNA +G+NLLQ+GLKHRQVASTKMNDFSSRSHTIFTI LYK H
Sbjct: 310 NDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 369

Query: 315 NGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPF 374
             E+FR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L DK+ HIPF
Sbjct: 370 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPF 429

Query: 375 RESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGTLVMK 434
           RESKLTRLLQDSLGGNTKTALIATISPAK+ +EET STLEYA+KAKNIKNKPQLG+ +MK
Sbjct: 430 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMK 489

Query: 435 DILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQECKREIEKMNS 494
           DILVKNIT ELAKIKSD LSTKSK+GIYM+QDHYK L SDLE+YK EVQECKREIE + S
Sbjct: 490 DILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKREIESLTS 549

Query: 495 QNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHTLKDAIYT 554
           +N LL+KDK  S E  + Q  +I+ L   I HL  ++DKQHK E ++    + L+     
Sbjct: 550 KNALLVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQKLTEV 609

Query: 555 VQNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSRHLGIDGNIDIIQ 614
           +Q +L + +  +L    + E  +   +   K ++  QL  M+     +   I  N+D+I+
Sbjct: 610 MQMALHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQETNIQPNLDMIK 669

Query: 615 EELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVVDSYSNELVKNLGD 674
            E+  ++ ++   +  + + CV+KIL  +PK F  +   +  I      +   + +NL D
Sbjct: 670 NEVLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQKFYKNIAENLSD 729

Query: 675 ISEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKFKEMMDSHLEENKS 734
           ISEE NN ++YL  H FKNNH+E L+ HVD TY  ++K   E    FK++++ HL+ENK 
Sbjct: 730 ISEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKKVLNDHLDENKK 789

Query: 735 LMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFDSTVKDALRRLEGNI 794
           L++++L TA+  V+ +E+ LF P + KWE+S + IN CDS+NN F +++   L +++  +
Sbjct: 790 LIMQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSMAATLSQIKSTV 849

Query: 795 EGSLEFSKNTAGDVKDSLKKFDGISEVLKNNTKVVNNINEVKEKHTFLRDQVER----TS 850
           + S      +   +K  +++ +    +LKNNTK  +   ++  KH  L+D ++     T 
Sbjct: 850 DTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFEQLINKHNMLKDNIKNSITSTH 909

Query: 851 SYIEAANEKFEGIDQFIRQIIDKKLPT 877
           S+I   ++ +  I+  ++   +K+  T
Sbjct: 910 SHITNVDDIYNTIENIMKNYGNKENAT 936

 Score =  295 bits (755), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 154/184 (83%), Gaps = 8/184 (4%)

Query: 15  QELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVD 74
           +ELNITV+VRCRGRNEREI  KSSVVV VPD+TGS E+SINTT + GITAQMN+K YTVD
Sbjct: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92

Query: 75  KVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSDA 134
           KVFGP A Q LIF ++A PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GELSDA
Sbjct: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152

Query: 135 AGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLL----NEPQESG----VIKKL 186
           AGIIPR+L KLFDTLE Q  DY+VKCSFIELYNEELKDLL    N    +G     +KKL
Sbjct: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDSNSNGSSNTGFDGQFMKKL 212

Query: 187 RIFD 190
           RIFD
Sbjct: 213 RIFD 216

>Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON}
           YEL061C (REAL)
          Length = 998

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/617 (50%), Positives = 427/617 (69%), Gaps = 4/617 (0%)

Query: 255 SEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNH 314
           ++QS+ IYIQNLQEFHITNA +G+NLLQRGLKHRQVASTKMNDFSSRSHTIFTI LYK H
Sbjct: 308 NDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 367

Query: 315 NGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPF 374
             E+FR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L D++ HIPF
Sbjct: 368 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPF 427

Query: 375 RESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGTLVMK 434
           RESKLTRLLQDSLGGNTKTALIATISPAK+ +EET STLEYA+KAKNIKNKPQLG  +MK
Sbjct: 428 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMK 487

Query: 435 DILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQECKREIEKMNS 494
           DILVKNIT ELAKIKSD LSTKSK+GIYM+QDHYK L SDLE++K EVQECKREIE + S
Sbjct: 488 DILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLAS 547

Query: 495 QNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHTLKDAIYT 554
           +N LL+KDK  S E  + Q  +++ L   I HL  ++DKQHK E ++    + L+     
Sbjct: 548 KNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEV 607

Query: 555 VQNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSRHLGIDGNIDIIQ 614
           +Q +L++ +  +L    + E  +   + S K ++  QL  M+  +  +   I  N+D+++
Sbjct: 608 MQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVK 667

Query: 615 EELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVVDSYSNELVKNLGD 674
            E+  ++E++   +  + + CV+KIL  +PK F  I   +  I     ++   + +NL D
Sbjct: 668 NEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSD 727

Query: 675 ISEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKFKEMMDSHLEENKS 734
           ISEE NN ++YL  H FKNNH+E L+ H+D TY  ++K   +    FK  ++ HLEENK 
Sbjct: 728 ISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKK 787

Query: 735 LMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFDSTVKDALRRLEGNI 794
           L+++++  A+  V+ +E+ LF P + KWE+S + INKCDS+NN F + +   L +++  +
Sbjct: 788 LIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTV 847

Query: 795 EGSLEFSKNTAGDVKDSLKKFDGISEVLKNNTKVVNNINEVKEKHTFLRDQVE----RTS 850
           + S      +   +K  +++ +    +LKNNTK  +   ++  KH  L+D +E     T 
Sbjct: 848 DTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIESSITSTH 907

Query: 851 SYIEAANEKFEGIDQFI 867
           S+I   ++ +  I+  +
Sbjct: 908 SHITNVDDIYNTIEDIM 924

 Score =  293 bits (751), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 154/184 (83%), Gaps = 8/184 (4%)

Query: 15  QELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVD 74
           +ELNITV+VRCRGRNEREI  KSSVVV VPD+TGS EVSINTT + GITAQMN+K YTVD
Sbjct: 35  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVD 94

Query: 75  KVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSDA 134
           KVFGP A Q LIF+++A PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GEL+DA
Sbjct: 95  KVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDA 154

Query: 135 AGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQ--------ESGVIKKL 186
           AGIIPR+L KLFDTLE Q  DY+VKCSFIELYNEELKDLL+           +   +KKL
Sbjct: 155 AGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEELKDLLDNNSNGSSNNGFDGQFMKKL 214

Query: 187 RIFD 190
           RIFD
Sbjct: 215 RIFD 218

>Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON}
           YEL061C (REAL)
          Length = 999

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/628 (51%), Positives = 438/628 (69%), Gaps = 7/628 (1%)

Query: 248 NNKQQS---LSEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHT 304
           NN Q+S    ++QS+ IYIQNLQEFHITNA +G+NLLQRGLKHRQVASTKMNDFSSRSHT
Sbjct: 299 NNSQRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHT 358

Query: 305 IFTIMLYKNHNGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINS 364
           IFTI LYK H  E+FR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+
Sbjct: 359 IFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINA 418

Query: 365 LADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKN 424
           LADK+ HIPFRESKLTRLLQDSLGGNTKTALIATISPAK+ +EET STLEYA+KAKNIKN
Sbjct: 419 LADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 478

Query: 425 KPQLGTLVMKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQE 484
           KPQLG  +MKDILVKNIT ELAKIKSD LSTKSK+GIYM+QDHYK L SDLE+YK EVQE
Sbjct: 479 KPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQE 538

Query: 485 CKREIEKMNSQNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCT 544
           CKR+IE ++S+N LLLKDK  S +  + Q  +++ L   I  L  ++DKQHK E ++   
Sbjct: 539 CKRDIESLSSKNSLLLKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGF 598

Query: 545 IHTLKDAIYTVQNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSRHL 604
            + L+     +Q +L++ +  +L    + E  +   + S K ++  QL+ M+ ++ S+  
Sbjct: 599 NNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQET 658

Query: 605 GIDGNIDIIQEELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVVDSY 664
            I  N+DII+ E+  ++E++   +  + + CV+KIL  +PK F  I   +  I      +
Sbjct: 659 NIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRF 718

Query: 665 SNELVKNLGDISEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKFKEM 724
            N + +NL DISEE NN ++YL  H FKNNH+E L+ H+D TY  ++K   E    FK  
Sbjct: 719 YNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNT 778

Query: 725 MDSHLEENKSLMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFDSTVK 784
           ++ HLEENK L++++L  A+  V+ +E+ LF P + KWE+S + INKCDS+NN F + + 
Sbjct: 779 LNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMA 838

Query: 785 DALRRLEGNIEGSLEFSKNTAGDVKDSLKKFDGISEVLKNNTKVVNNINEVKEKHTFLRD 844
             L +++  ++ S      +   +K  +++ +    +LKNN K  +   ++  KHT L+D
Sbjct: 839 TTLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSLLKNNKKFNDQFKQLVNKHTILKD 898

Query: 845 QVER----TSSYIEAANEKFEGIDQFIR 868
            +E     T S+I   ++ ++ I+  ++
Sbjct: 899 NIENSITSTHSHITNIDDIYDTIENIMK 926

 Score =  295 bits (756), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 153/184 (83%), Gaps = 8/184 (4%)

Query: 15  QELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVD 74
           +ELNITV+VRCRGRNEREI  KSSVVV VPD+TGS EVSINTT + GITAQMN+K YTVD
Sbjct: 33  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVD 92

Query: 75  KVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSDA 134
           KVFGP A Q LIF ++A PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GELSDA
Sbjct: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152

Query: 135 AGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQ--------ESGVIKKL 186
           AGIIPR+L KLFDTLE Q  DY+VKCSFIELYNEELKDLL+           E   +KKL
Sbjct: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGFEGPFMKKL 212

Query: 187 RIFD 190
           RIFD
Sbjct: 213 RIFD 216

>Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON}
           (9109..12123) [3015 nt, 1005 aa]
          Length = 1004

 Score =  590 bits (1520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/618 (48%), Positives = 443/618 (71%)

Query: 256 EQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHN 315
           ++ + IYIQNL+EFHIT+AK+GI LLQRGL++RQVASTKMNDFSSRSHTIFTI LYK H+
Sbjct: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357

Query: 316 GEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFR 375
           G++FR+SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN HIPFR
Sbjct: 358 GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFR 417

Query: 376 ESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGTLVMKD 435
           ESKLTRLLQDSLGGNTKTALIATISPAK+N+EET STLEYA KAK+IKNKPQLG+++ KD
Sbjct: 418 ESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKD 477

Query: 436 ILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQECKREIEKMNSQ 495
           ILVKNI  ELAK+K+D LSTKS+DG+YM+Q HYKELT+DLE+YKTEVQECKR I+ + +Q
Sbjct: 478 ILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQ 537

Query: 496 NVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHTLKDAIYTV 555
           N LLLKDK+AS+EV  LQ+IK++ + D I+HL+D ++KQH+ EQ LV  I  LK     +
Sbjct: 538 NGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEM 597

Query: 556 QNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSRHLGIDGNIDIIQE 615
           Q ++K   + +   +++M+ +  + +   K  + E L  +       +  +  NI+ I++
Sbjct: 598 QATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIKD 657

Query: 616 ELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVVDSYSNELVKNLGDI 675
           E+  ++++  + +  V + C+E++++ +P    S+  D++ +  + D Y+ +L  ++ ++
Sbjct: 658 EVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQKISDLYNEQLSISISEL 717

Query: 676 SEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKFKEMMDSHLEENKSL 735
           + E+N+ ++YLN   FK++HEE L+ H++KTY  +++++  +  + K  ++ +LEE++++
Sbjct: 718 NIEHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEESRNI 777

Query: 736 MIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFDSTVKDALRRLEGNIE 795
           +I SLK  + ++V  E++LFAP K+KWE S E INKCDSLNN +   +   L  ++ ++ 
Sbjct: 778 IIDSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNMKTSVT 837

Query: 796 GSLEFSKNTAGDVKDSLKKFDGISEVLKNNTKVVNNINEVKEKHTFLRDQVERTSSYIEA 855
            + +   +    ++         +++ +N+ ++     E+ EK++ L   +  + +  E+
Sbjct: 838 STSDLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKLESHLNESITMNES 897

Query: 856 ANEKFEGIDQFIRQIIDK 873
           +   F+ + + I    +K
Sbjct: 898 SINAFDKLSESIHSAFEK 915

 Score =  300 bits (768), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 141/179 (78%), Positives = 165/179 (92%), Gaps = 1/179 (0%)

Query: 13  NGQELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYT 72
           NG ELNI V+VRCRGRNEREIKAKSSVVV+VPDV GS+E++INTT+++GI  QMNSKTYT
Sbjct: 9   NGDELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYT 68

Query: 73  VDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELS 132
           VDKVFGPSA+Q LIF+++AEPLF+DFI+GYNCTVLVYGMTSTGKTYTMTGDERLY+GELS
Sbjct: 69  VDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELS 128

Query: 133 DAAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQE-SGVIKKLRIFD 190
           D+AGIIPR+LFKLFD +E Q++DY++KCSFIELYNEELKDLL+E Q  +   KKLRIFD
Sbjct: 129 DSAGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAINSTAKKLRIFD 187

>KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16
           YEL061C
          Length = 963

 Score =  561 bits (1447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/636 (47%), Positives = 428/636 (67%), Gaps = 18/636 (2%)

Query: 248 NNKQQSLSEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFT 307
           N+K    S+Q++ IYIQNLQEFHIT AK+GI LLQ+GLK+RQVASTKMNDFSSRSHTIFT
Sbjct: 277 NDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFT 336

Query: 308 IMLYKNHNGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD 367
           I L+K   GE+FR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVINSLAD
Sbjct: 337 ITLFKEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLAD 396

Query: 368 KNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQ 427
           KN H+PFRESKLTRLLQDSLGGNTKTALIATISPAK+  EET STLEYA+KAKNIKNKPQ
Sbjct: 397 KNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQ 456

Query: 428 LGTLVMKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQECKR 487
           LG+ +MKDIL+KNIT EL KIKSD LSTKSKDGIYM Q HYKELT+DL+NYKTE+QECKR
Sbjct: 457 LGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKR 516

Query: 488 EIEKMNSQNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHT 547
            IE + SQN LLLKDKR  +E +ELQRIKI+ +N+ +  LY K+++Q   E +L   I  
Sbjct: 517 TIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQ- 575

Query: 548 LKDAIYTVQNS-----LKNCEDYQLQCKSEMEDVLYDHVTSF-KQSIHEQLAAMKASHSS 601
               I+T  NS     +   ++ +    S+ + +L DH  S+  + ++ Q+   K    +
Sbjct: 576 ----IFTKTNSKLTKIIDEMKNREALVNSKFKTLL-DHSLSYVSKKLNYQIENFKDQGIN 630

Query: 602 RHLGIDGNIDIIQEELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVV 661
           ++  +D N+ +I+ E++ +L +         + C+ K L   P  F+ I  ++L++  + 
Sbjct: 631 QNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALT 690

Query: 662 DSYSNELVKNLGDISEEYNNFREYLNEHLF---KNNHEETLSIHVDKTYHMLKKSAGELF 718
            +Y +++ +NL D+SEEYNNF++++ +  +   K +  E L+ +++ T  +++ S+ ++ 
Sbjct: 691 SNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVM 750

Query: 719 SKFKEMMDSHLEENKSLMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNT 778
           S  + +++ HL  NK L+I SL   + E+++ E+    P   KWE S E IN+ D+LNN 
Sbjct: 751 STIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNE 810

Query: 779 FDSTVKDALRRLEGNIEGSLEFSKNTAGDVKDSLKKFDGISE---VLKNNTKVVNNINEV 835
           F+  V+ ++  +   I+ + +   N    + +  K  D       ++ +N  + NN   +
Sbjct: 811 FNDNVESSMTTMTDKIKQTNDSINNNIKKINEHFKTNDIAHSNNLMIDDNNIIKNNFKSI 870

Query: 836 KEKHTFLRDQVERTSSYIEAANEKFEGIDQFIRQII 871
           +EK++ L + V+        + +K   +D  IR ++
Sbjct: 871 EEKNSRLHEFVKEGYLVTNESMKKLNELDTSIRTVL 906

 Score =  299 bits (766), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 161/178 (90%), Gaps = 2/178 (1%)

Query: 15  QELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVD 74
           +ELNITV+VRCRGRN+REI AKSSVVVTVPD+ GS EV+INT++++G TAQMNSKTYTVD
Sbjct: 15  EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 74

Query: 75  KVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSDA 134
           KVFGPSA QSLIF +IAEPLF DFIKGYNCT+LVYGMTSTGKTYTMTGDE+LY+ ELSD+
Sbjct: 75  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 134

Query: 135 AGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEP--QESGVIKKLRIFD 190
           AGIIPRILFKLF+TLE  +ED++VKCSF+ELYNEELKDLL+     ++G  KKLRIFD
Sbjct: 135 AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLRIFD 192

>Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa]
           {ON} complement(169349..172237) [2889 nt, 963 aa]
          Length = 962

 Score =  541 bits (1394), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 313/899 (34%), Positives = 521/899 (57%), Gaps = 28/899 (3%)

Query: 16  ELNITVSVRCRGR--NEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTV 73
           E NI V  R +G+  NE+    +  +++  P +     +     D+         + + +
Sbjct: 12  ECNIKVVARFKGQIDNEKGDDVRDQIIIEEPGL-----IKFKGKDDAV------KREFGM 60

Query: 74  DKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDE-RLYDGELS 132
           D +F     Q  ++    +P+F DFI GYNC+ LVYG T +GKTYT++G+E  L   E S
Sbjct: 61  DHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEAS 120

Query: 133 D-AAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQES---GVIKKLRI 188
             + G+IPR+L +LFD L   + D++VKCS++E+YNEELKDLL +   S     IKKLRI
Sbjct: 121 RLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSASIKKLRI 180

Query: 189 FDXXXXXXXXXXXXXXXXPNLVGTSGTFKRIFKTPVPYKXXXXXXXXXXXXXXXXPRLIN 248
            D                 +   +  T  +   T +  K                    +
Sbjct: 181 VDSGSPNVKNGANSNCNTRD--NSPLTSSKSIPTAIIRKKMGRQSLTALKQANTLSISRS 238

Query: 249 NK------QQSLSEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRS 302
           N       Q+ + E++ A YIQNL+EFHITNAK+GI LL RGLK+RQ+AS+K   +SSR+
Sbjct: 239 NSFNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRA 298

Query: 303 HTIFTIMLYKNHNGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI 362
            TIFTI+LYK   GE+FRVSK N VDLAG+E+  +    NQR K+   INQ +  L +++
Sbjct: 299 STIFTIVLYKEEEGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDINIINQGIQNLNKIV 358

Query: 363 NSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNI 422
           NSL +K + IPF++SKLT L++D+L GN+K+  I T+   K + +E   TLE+  K +++
Sbjct: 359 NSLHEKESVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSL 418

Query: 423 KNKPQLGTLVMKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEV 482
           K  P LG  + K+ L+K+I+ ELAK+KSD LSTKSK+G+YM+ +HY  LT DL+ +K E+
Sbjct: 419 KCYPLLGPSINKETLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKHKVEI 478

Query: 483 QECKREIEKMNSQNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLV 542
            + K+ I+++N Q+  L KDKRA  EV+E+QRIK++ + D ++ +Y  ++KQ + E DL+
Sbjct: 479 MDLKKVIDELNEQSTTLRKDKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQRREHDLI 538

Query: 543 CTIHTLKDAIYTVQNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSR 602
            +   LK+ +  +  ++    D +   +++M+ +  + ++  K  + + L   + +    
Sbjct: 539 NSTDKLKETVNNMNVTIARYTDRESSVQTQMKTLFNEELSKLKSMLLKNLRQFEKNELID 598

Query: 603 HLGIDGNIDIIQEELSQVLESICSTSVD-VCRSCVEKILESNPKHFESIRRDLLDISTVV 661
           +L I+ N++   EE+ Q+L+ I    +D +   C++K+ E +PK F S  +D+  +    
Sbjct: 599 NLEIENNLNKAHEEIKQILQ-ISENEIDSLFLDCIKKMSEESPKLFSSFIQDVSRLENST 657

Query: 662 DSYSNELVKNLGDISEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKF 721
               N L + L D+SEE+NN ++Y+NE  FKNNHEE L  +V+KTYH ++KS+ +   KF
Sbjct: 658 SENYNNLAELLSDVSEEFNNLKQYINEKFFKNNHEELLKTYVNKTYHQVQKSSDDFLLKF 717

Query: 722 KEMMDSHLEENKSLMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFDS 781
            ++++S+LE NKS++++++K+A+ EV+  E+  F P K+KWE S+E I K    +N F +
Sbjct: 718 NDLLESYLEGNKSVLLQNIKSATSEVIENEMNHFIPQKEKWEKSIELIEKSKHSSNEFKT 777

Query: 782 TVKDALRRLEGNIEGSLEFSKNTAGDVKDSLKKFDGISEVLKNNTKVVNNINEVKEKHTF 841
             +  + +L+  ++G+ E   +T  ++K  + +    + +++NN  V      + +K+  
Sbjct: 778 KNRVIVGKLQDTLKGTSESLFDTLSEMKSKINELQKAANIIENNEVVTEEFISIMKKNGI 837

Query: 842 LRDQVERTSSYIEAANEKFEGIDQFIRQIIDKKLPTHLVGNGELVNVMLEQLGKTHLKP 900
           L+D +    +  E +   F+ +D  IR +   ++ T++ G   ++  + +QL +  L P
Sbjct: 838 LKDTLNINMTSTEESIVAFDKLDDSIRNVFKNEIDTNITGYQSILKEIFDQLDQQRLTP 896

>CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} similar
           to uniprot|P27895 Saccharomyces cerevisiae YEL061c CIN8
           Kinesin-like protein
          Length = 988

 Score =  540 bits (1392), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 295/653 (45%), Positives = 430/653 (65%), Gaps = 13/653 (1%)

Query: 256 EQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHN 315
           +QS++IYIQNL+EFHIT+A +G+ LLQ+GLK RQVASTKMNDFSSRSH+IFTI LYK  N
Sbjct: 304 DQSASIYIQNLEEFHITSAMEGLQLLQKGLKQRQVASTKMNDFSSRSHSIFTITLYKEQN 363

Query: 316 GEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFR 375
           GE+FRVSKMNLVDLAGSENISRSGA NQRAKEAGSINQSLLTLGRVINSLADK+ HIPFR
Sbjct: 364 GELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFR 423

Query: 376 ESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGTLVMKD 435
           ESKLTRLLQDSLGGNTKTALIATISPAK+ +EET STLEYA+KAKNIKNKPQLG  +MKD
Sbjct: 424 ESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 483

Query: 436 ILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQECKREIEKMNSQ 495
           ILV++IT ELAKIKSD LSTKSK+G+YM+ +HYK+L  D+E YKTE++E KR IE + +Q
Sbjct: 484 ILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQ 543

Query: 496 NVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHTLKDAIYTV 555
           N +L +++ +  + +   +  I  L D +  L   + +Q   E ++   +  ++ A   +
Sbjct: 544 NAMLQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEM 603

Query: 556 QNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSRHLGIDGNIDIIQE 615
           + ++   E  Q + +  +   + D +++ + ++ + +  ++ +   +   I GN+  +++
Sbjct: 604 KKTIHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKDTEISGNLMRLEK 663

Query: 616 ELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVVDSYSNELVKNLGDI 675
           E+ +V+++    +      CV+ +L+  P+ FES+   L +IS + +   +++ + L D+
Sbjct: 664 EVVKVIKAAEEEASKSYGECVKMMLKETPRLFESVSGRLDNISKLAEENHSKIAETLSDV 723

Query: 676 SEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKFKEMMDSHLEENKSL 735
           SEEYNN ++YL  + FKNNHEE LS HV  TY  L++++ +L   F  M+D H++ENK  
Sbjct: 724 SEEYNNLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENKRH 783

Query: 736 MIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFDSTVKDALRRLEGNIE 795
           M++++   +DEV+  E+++F   + KWE S   IN+CDS+N++F   +   L  +   + 
Sbjct: 784 MLENILGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRDVVS 843

Query: 796 GSLEFSKNTAGDVKDSLKKFDGISEVLKNNTKVVNNINEVKEKHT----FLRDQVERTSS 851
            S +    T   ++   +    I E+++ N  +   I  +K+K+     F     E  ++
Sbjct: 844 SSRDNIGATISSIQSRTRNRQSIEEMIQGNDVIRQQITRIKQKNKSLSLFKEHSTETATT 903

Query: 852 YIEAANEKFEGIDQFIRQIIDKKL--PTHLVGNGELVNVMLEQLGKTHLKPIG 902
            I + N K EG    ++ I+DK L  P    G  E+ +  L +L K    P+G
Sbjct: 904 SIGSVN-KVEG---NLKVIMDKVLNDPQLSRGKAEVPDEELHRLEKI---PLG 949

 Score =  292 bits (748), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 156/178 (87%), Gaps = 2/178 (1%)

Query: 15  QELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVD 74
           +ELNI V+VRCRGRNEREIKAKSSVVV VPD   +NEVSINTTD++GI A+MNSKTYTVD
Sbjct: 30  EELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVD 89

Query: 75  KVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSDA 134
           KVFGPSA Q L++++IAEPLF DFIKGYNCT+LVYGMTSTGKTYTMTGDE+L++GEL DA
Sbjct: 90  KVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDA 149

Query: 135 AGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQES--GVIKKLRIFD 190
           AGIIPR+LF+LFDTLE   +DYLVKCSF+ELYNEELKDLL+    +     KKLRIFD
Sbjct: 150 AGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDNKKLRIFD 207

>TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON}
           Anc_6.16 YEL061C
          Length = 1097

 Score =  540 bits (1390), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 296/601 (49%), Positives = 410/601 (68%), Gaps = 17/601 (2%)

Query: 256 EQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHN 315
           + ++ IYIQNLQEF+I NA DGI LLQ+GL+HR+VASTKMND SSRSHTIFTI LYK HN
Sbjct: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN 388

Query: 316 GEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFR 375
           G ++RVSKMNLVDLAGSENI++SGAQ+QRAKEAGSINQSLLTLGRVINSLADK+ HIPFR
Sbjct: 389 GGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 448

Query: 376 ESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGTLVMKD 435
           ESKLTRLLQDSLGGNTKT LI+TISPAKIN +ETSSTLEYA+KAKNIKNKP LG+ +MKD
Sbjct: 449 ESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIMKD 508

Query: 436 ILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQECKREIEKMNSQ 495
           +L+KNIT EL KIKSD +ST+ KDG+YM+Q HYKEL +DLE+YKTEVQE KR  E++ SQ
Sbjct: 509 VLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRANERLISQ 568

Query: 496 NVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHTLKDAIYTV 555
           N  LLKDK+AS+E++ELQRI+I+  N+KI  LY+ +D+ +K E  LV  I  LK+   ++
Sbjct: 569 NGSLLKDKKASNELNELQRIQIEKKNEKIKELYEILDEHYKREDILVELIRQLKNVGTSM 628

Query: 556 QNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKAS-----------HSSRHL 604
           Q++++N  +  L+ +   + +L +     K  + + L+ +  +           ++S   
Sbjct: 629 QSTIENYRERDLEIEESTKKILENEFKFLKNELSQILSNINGNIIDNLKSSIISNNSSIE 688

Query: 605 GIDG-----NIDIIQEELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDIST 659
            ID      NIDII+    ++L+ +   S  +  SC+E+IL   P      + ++  I  
Sbjct: 689 AIDSSNFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKFKIEINSIDF 748

Query: 660 VVDSYSNELVKNLGDISEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFS 719
             +   N++ +NL D+SEEYNNF+EYLN    +NN+E  L  H++     ++  +  L  
Sbjct: 749 QYNDQFNKITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIESFSNNLLL 808

Query: 720 KFKEMMDSHLEENKSLMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTF 779
              + ++     N  L  + L    +++V KE +   P K+KW  S+E IN  D +NNTF
Sbjct: 809 NINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINSTDKINNTF 868

Query: 780 DSTVKDALRRLEGNIEGSLEFSKNTAGDVK-DSLKKFDGISEVLKNNTKVVNNINEVKEK 838
            + + + + ++   I  S     N+  D+K + +++ + ++E+L +NT+ VNNINE+K K
Sbjct: 869 HNDMNNRILQINNLILQSHNDINNSINDIKVNEIRENEAVNEILSSNTEYVNNINELKIK 928

Query: 839 H 839
           +
Sbjct: 929 N 929

 Score =  307 bits (786), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 163/177 (92%), Gaps = 1/177 (0%)

Query: 14  GQELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTV 73
           G+ELNITV+VRCRGRNERE++AKSSVVV+VPD+ GSNEVSINT+DE+GI A MNSKTYTV
Sbjct: 8   GEELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTV 67

Query: 74  DKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSD 133
           DKVFGPSA Q L+FK+IAEPLF+DFIKGYNCT+LVYGMTSTGKTYTMTGDE+LYDGELSD
Sbjct: 68  DKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSD 127

Query: 134 AAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQESGVIKKLRIFD 190
           +AGIIPR+LFKLF++ E  ++DY++KCSF+ELYNE+LKDLL++  +    KKLRIFD
Sbjct: 128 SAGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVD-NTYKKLRIFD 183

>TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16
           YEL061C
          Length = 939

 Score =  534 bits (1376), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 275/590 (46%), Positives = 405/590 (68%)

Query: 258 SSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHNGE 317
           +++IYIQNL+EFHI NA++GI LLQ+GLK+RQVASTKMND SSRSHTIFTI LYK H GE
Sbjct: 235 NASIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGE 294

Query: 318 VFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRES 377
           +F++SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINS+ADKN HIPFRES
Sbjct: 295 IFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRES 354

Query: 378 KLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGTLVMKDIL 437
           KLTRLLQDSLGGNTKTALIATISPAK+NAEET STLEYATKAK+IKNKPQLG+++MKD+ 
Sbjct: 355 KLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVR 414

Query: 438 VKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQECKREIEKMNSQNV 497
           +K++  ELAKIK D  STK KDG+YMTQ+HYK+LT+DLE+YKTE+QEC R ++ +  QN 
Sbjct: 415 LKDLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNA 474

Query: 498 LLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHTLKDAIYTVQN 557
           LLLKDK+AS+EV++LQ + +  + + ++++   ++ QHK EQ LV  +   ++    ++ 
Sbjct: 475 LLLKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLKMKT 534

Query: 558 SLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSRHLGIDGNIDIIQEEL 617
            +K   + + + +S M+ +  D +   K+ + E L  +   +      +  NI +I++++
Sbjct: 535 VIKEYSEKEERIQSNMKSIFNDELIKLKELLIENLNGIAKENLIVQTNVKDNIKLIKDDV 594

Query: 618 SQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVVDSYSNELVKNLGDISE 677
             ++      S  +     ++I++  P   E    D+     + ++Y   L +NL  I +
Sbjct: 595 ISIVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFANLFENLESIKQ 654

Query: 678 EYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKFKEMMDSHLEENKSLMI 737
           +Y+   EY +   FK+NH   ++ HV+ T  +++KS  ++F +F++ M++  E+N+ L++
Sbjct: 655 QYSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQNEKLIL 714

Query: 738 KSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFDSTVKDALRRLEGNIEGS 797
           ++LKT S +++  E+  F   K +W+ S + IN CD LNN++   +   LR ++G ++ S
Sbjct: 715 ENLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMKGKLQSS 774

Query: 798 LEFSKNTAGDVKDSLKKFDGISEVLKNNTKVVNNINEVKEKHTFLRDQVE 847
            E  K     +K ++   +   ++L  +  + +N N++  K   L D ++
Sbjct: 775 DEIIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHLQ 824

 Score =  294 bits (753), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 166/182 (91%), Gaps = 3/182 (1%)

Query: 11  EENGQELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEL--GITAQMNS 68
           E++  E+NI V+VRCRGRN+REIK+KSSV+V+VPDV GSNE+SINT+D++  G+TAQ+NS
Sbjct: 9   EDDTDEMNIMVAVRCRGRNKREIKSKSSVIVSVPDVMGSNEISINTSDDIVSGLTAQLNS 68

Query: 69  KTYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYD 128
           KTYTVDKVFGPSA+Q LIF++IAEPLF+DF++GYNCTVLVYGMTSTGKTYTMTGDE+LY 
Sbjct: 69  KTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYK 128

Query: 129 GELSDAAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQESGVIKKLRI 188
           G+LSD+AGIIPR+LFKLF+T+E Q ++Y++KCSFIELYNEELKDLL +   +  +KKLRI
Sbjct: 129 GDLSDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNTK-LKKLRI 187

Query: 189 FD 190
           FD
Sbjct: 188 FD 189

>TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16
           YEL061C
          Length = 982

 Score =  387 bits (993), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 276/902 (30%), Positives = 483/902 (53%), Gaps = 67/902 (7%)

Query: 18  NITVSVRCRGRNEREIKAKSSVVVTVPDVTG--SNEVSINTTDELGITAQMNSKTYTVDK 75
           NITV+VRCR   + E  + S  ++++ D     SNEV +   DE    +    K YT+D 
Sbjct: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIV--LDE----STGRKKIYTLDA 62

Query: 76  VFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGD----ERLYDGEL 131
           V+G   DQ  +F +   P +  F  GYN +++ YG   +GK YT+ G+    +   + E 
Sbjct: 63  VYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAE- 121

Query: 132 SDAAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQE-----------S 180
           S+  G++PR+L +LF  LE+   D+++KCSF+E+YN+EL+DLL +               
Sbjct: 122 SENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDTGNNANGNNSNGATG 181

Query: 181 GVIKKLRIFDXXXXXXXXXXXXXXXXPN--------LVGTSGTFKRIFKTPVPYKXXXXX 232
              KKLRI D                 +         + T+   KR+ K  +P       
Sbjct: 182 STGKKLRIVDSASNGLRSAGSSNSSTRDNSPLTNSKKIPTAMMRKRMGKRSLP------P 235

Query: 233 XXXXXXXXXXXPRLINNKQQSLSEQS--------SAIYIQNLQEFHITNAKDGINLLQRG 284
                       RL  ++  S S+ S        ++IYIQNLQE  IT  ++G+ ++++G
Sbjct: 236 NNSISNNTANNNRLSLSRTNSFSDYSLQSSHERLNSIYIQNLQEITITEIEEGMAIIKKG 295

Query: 285 LKHRQVAST----KMNDFSSRSHTIFTIMLYKNHN-GEVFRVSKMNLVDLAGSENISRSG 339
           LK+R++AST      N+FS RSH+IF I LYK     EVFR+SK++ V+ AGSE    + 
Sbjct: 296 LKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNFAGSEYGDNNT 355

Query: 340 AQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATI 399
           ++N      G+ N +L +  ++IN + + + +  F +SKLT+LLQ++  G T+T  IA I
Sbjct: 356 SKN------GAFNSNLQSFNKMINGMVNNSTYASFLDSKLTQLLQNNFDGITRTLFIANI 409

Query: 400 SPAKINAEETSSTLEYATKAKNIKNKPQLGTLVMKDILVKNITRELAKIKSDFLSTKSKD 459
           +P K   + T S L  ATK K IKN+P+ G+++ K+ L+K ++ EL K KSD LS KS D
Sbjct: 410 APLKKQLDATCSVLTMATKIKEIKNEPKKGSVITKESLIKILSNELVKTKSDLLSYKSND 469

Query: 460 -GIYMTQDHYKELTSDLENYKTEVQECKREIEKMNSQNVLLLKDKRASHEVSELQRIKIK 518
            GIYM + HY ELT  LE+YK ++Q  K  I ++  +   +  +KR   E++E QRIK++
Sbjct: 470 NGIYMDEKHYSELTKTLESYKEKIQNSKNSINELTKKGNEIRIEKRTFEEINERQRIKLQ 529

Query: 519 HLNDKIAHLYDKMDKQHKNEQDLVCTIHTLKDAIYTVQNSLKNCEDYQLQCKSEMEDVLY 578
           +L + I++L   ++KQ K E +L      L   +  +Q S++   D ++  +++++ +LY
Sbjct: 530 NLRETISNLNCALEKQSKRESELENIKIKLHSILGNMQKSVEKYSDKEIHLQNKLK-LLY 588

Query: 579 D-HVTSFKQSIHEQLAAMKASHSSRHLGIDGNIDIIQEELSQVLESICSTSVDVCRSCVE 637
           D  +   K S+    A +K      +  ++ NID I+ E+ ++     S   ++  +   
Sbjct: 589 DKELVKLKNSLESNFADIKNRMPDDNDNMNTNIDNIKAEILKIANQSQSKVKELLTNSAN 648

Query: 638 KILESNPKHFESIRRDLLDISTVVDSYSNELVKNLGDISEEYNNFREYLNEHLFKNNHEE 697
           ++L+++PK+FE +  +L ++   V+   N+  + L DISEE+NN   Y+N++  K++HEE
Sbjct: 649 QVLDTSPKYFEQLDTNLKNLEESVEINHNKYSELLSDISEEFNNLNNYINDNFLKSSHEE 708

Query: 698 TLSIHVDKTYHMLKKSAGELFSKFKEMMDSHLEENKSLMIKSLKTASDEVVAKEVKLFAP 757
            +  ++++TYH ++  + E    FK+++D ++E+N   + KS+ + + E+V  E+  F P
Sbjct: 709 LIDTYINRTYHEVQGISVEFTENFKKLLDIYVEKNTKSLSKSITSLTSEIVENELTQFNP 768

Query: 758 VKQKWESS----LENINKCDSLNNTFDSTVKDALRRLEGNIEGSLEFSKNTAGDVKDSLK 813
            K+KWE +    +EN N+  + N   +S +   L +L      + E   N    +K +++
Sbjct: 769 EKKKWELASNEIIENFNESITKNKNKNSEI---LAKLLSESTSTSELFINNMSSIKKNVE 825

Query: 814 KFDGISEVLKNNTKVVNNINEVKEKHTFLRDQVERTSSYIEAANEKFEGIDQFIRQIIDK 873
             +  SE+  +N  + +   E+  K+  L+D +    +  E + + F+ + + ++ +   
Sbjct: 826 IVEEFSEIFNSNDLIKSEFLEIINKNKKLKDLITDNFNSSENSIDSFDNLKEAMQNVFKN 885

Query: 874 KL 875
           ++
Sbjct: 886 EM 887

>Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} similar
           to Ashbya gossypii ACR228C
          Length = 1134

 Score =  370 bits (949), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 225/541 (41%), Positives = 320/541 (59%), Gaps = 83/541 (15%)

Query: 10  SEENGQELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSK 69
           SEE G   NI V VRCR RN REIK KSSVVV+     G   +       L   +  N+K
Sbjct: 50  SEEQG--YNIKVYVRCRSRNVREIKEKSSVVVSTLGSQGREII-------LSNQSTGNNK 100

Query: 70  TYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDG 129
           TYT D+VFG  +DQ  +F ++A     + ++GYNCTV  YG T TGKTYTM+GD  +   
Sbjct: 101 TYTFDQVFGVESDQESLFDKVARAYITEMLEGYNCTVFAYGQTGTGKTYTMSGDISVVGA 160

Query: 130 ELSDA--------AGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQESG 181
            L D         AGIIPR+L +LF  L+ + EDY VK SF+ELYNE+L+DLL E +E  
Sbjct: 161 SLEDPNYVLLSEHAGIIPRVLVELFQQLQRESEDYSVKVSFLELYNEKLRDLLVEDKEP- 219

Query: 182 VIKKLRIFDXXXXXXXXXXXXXXXXPNLVGTSGTFKRIFKTPVPYKXXXXXXXXXXXXXX 241
                                      L+   G    +  +P                  
Sbjct: 220 ---------------------------LIDEGGIGGGVANSP------------------ 234

Query: 242 XXPRLINNKQQSLSEQSS-AIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSS 300
              R+ +N +   S  S  +I ++ ++E +I +A++G+ LL  G   R+VA+T+ ND SS
Sbjct: 235 ETIRIYDNLKLDRSNSSGHSIMVKGMEEMYIRSAQEGLKLLMEGSLKRKVAATRCNDLSS 294

Query: 301 RSHTIFTIM--LYKNH--NGEVF-RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSL 355
           RSHTIFTI   + K H  +GE + ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SL
Sbjct: 295 RSHTIFTITTNVTKIHPISGEQYVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSL 354

Query: 356 LTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEY 415
           LTLGRVIN+L D + HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK + EET+STLEY
Sbjct: 355 LTLGRVINALVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKTSMEETASTLEY 414

Query: 416 ATKAKNIKNKPQLGTLVMKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSD- 474
           AT+AK+IKN PQ+  L+ K+  +    +E+ K++ +  +  +K+GIY+T++ Y+   S+ 
Sbjct: 415 ATRAKSIKNTPQINQLMAKESCILGYIKEIEKLRKNLKANHAKEGIYITEEKYETYESNC 474

Query: 475 --LENYKTEVQECKREIEKMNS---QNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYD 529
             +E  + ++   + +I++      +   L+K+K       + Q   IK +N++I  +Y+
Sbjct: 475 ILVEEQQAKIDNLQEQIKRFKEKYLEQTKLVKEK-------DTQVKMIKSINERIT-MYN 526

Query: 530 K 530
           K
Sbjct: 527 K 527

>ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1138

 Score =  352 bits (903), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 217/516 (42%), Positives = 305/516 (59%), Gaps = 46/516 (8%)

Query: 18  NITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVDKVF 77
           NI V VRCR RN+REI  KSSVVV+     G + +  N +  L        KTY  D+VF
Sbjct: 44  NIKVYVRCRSRNQREIDEKSSVVVSTMGRKGKSVILSNPSSPLS----HPKKTYMFDEVF 99

Query: 78  GPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLY---DGE---- 130
           G  +DQ  IF ++A+    + ++GYNCTV  YG T TGKTYTM+GD  ++   D +    
Sbjct: 100 GADSDQESIFTEVAKNYIQEMLEGYNCTVFAYGQTGTGKTYTMSGDMSIWGDLDSQDKIL 159

Query: 131 LSDAAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLL--NEPQESGVIKKLRI 188
           L + AGIIPR+L  LF  L  +  ++ VK SF+ELYNE LKDLL  N+  E  +    RI
Sbjct: 160 LGEHAGIIPRVLVNLFKQLSKETTEHSVKISFLELYNERLKDLLADNDSDEDNI----RI 215

Query: 189 FDXXXXXXXXXXXXXXXXPNLVGTSGTFKRIFKTPVPYKXXXXXXXXXXXXXXXXPRLIN 248
           FD                 N  G S    ++       K                    +
Sbjct: 216 FDNNNS-------------NAHGASNGMSQV-------KMNKSKVRAPTLSGATVSSSAS 255

Query: 249 NKQQSLSEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTI 308
           N   S S  SS+I ++ ++E +I +A +G+ LL +G   R+VA+TK ND SSRSHTIFTI
Sbjct: 256 NSSTSSSSSSSSITVKGMEERYIKSAYEGLQLLTKGSLKRKVAATKCNDLSSRSHTIFTI 315

Query: 309 MLYKNH----NGEVF-RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVIN 363
           + +       +GE + ++ K+NLVDLAGSENI+RSGA+N RA+EAG IN+SLLTLGRVIN
Sbjct: 316 VTHVARTDPVSGEQYVKIGKLNLVDLAGSENINRSGAENMRAQEAGLINKSLLTLGRVIN 375

Query: 364 SLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIK 423
           +L + ++HIP+R SKLTRLLQDSLGG TKT +IATISPA+I+ +ET STLEYAT+AK+IK
Sbjct: 376 ALVEHSSHIPYRGSKLTRLLQDSLGGKTKTCIIATISPARISMDETVSTLEYATRAKSIK 435

Query: 424 NKPQLGTLVMKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSD---LENYKT 480
           N PQ+   + KD  +     E+ +++ +  +++ ++G+Y+TQ+ Y    S+   +E  K 
Sbjct: 436 NTPQVNQSLSKDSCIMEYIYEIERLRQELKASRQREGMYITQEQYDLYESNSLLVEEQKV 495

Query: 481 EVQECKREIEKMNSQNVLLLK-DKRASHEVSELQRI 515
            +Q    +I++   + V   K  K A  +  E Q++
Sbjct: 496 VIQNMGEQIKRFKEKYVEQTKLSKEAHRQFQESQKV 531

>KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa]
           {ON} Anc_7.387 YBL063W
          Length = 1151

 Score =  348 bits (893), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 215/484 (44%), Positives = 285/484 (58%), Gaps = 80/484 (16%)

Query: 2   HPLSSRELSEENGQELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELG 61
           HP  S +   E G   NI V VRCR RN+REI+ KSSVV++     G   V  + +  L 
Sbjct: 46  HP-DSPDFESELGS--NIQVYVRCRSRNQREIEEKSSVVISTMGAQGKEVVLSDPSSVLS 102

Query: 62  ITAQMNSKTYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMT 121
            T     KTY  D+VFG  +DQ ++F   A+    + ++GYNCT+  YG T TGKTYTM+
Sbjct: 103 HTK----KTYIFDQVFGVESDQEVVFNATAQNYIHEMLQGYNCTIFAYGQTGTGKTYTMS 158

Query: 122 GD-ERLYDGE------LSDAAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLL 174
           GD   L D E      L + AGIIPR+L  LF  L  +  +Y VK SF+ELYNE LKDLL
Sbjct: 159 GDINILGDLESQDKILLGEHAGIIPRVLVNLFQYLTRESTEYSVKISFLELYNERLKDLL 218

Query: 175 N---EPQESGVIKKLRIFDXXXXXXXXXXXXXXXXPNLVGTSGTFKRIFKTPVPYKXXXX 231
           +   E +ES                                     RIF   +P      
Sbjct: 219 SQSKETEES------------------------------------IRIFDNHIPSG---- 238

Query: 232 XXXXXXXXXXXXPRLINNKQQSLSEQS--SAIYIQNLQEFHITNAKDGINLLQRGLKHRQ 289
                           N+K Q  S  +  S+I ++ ++E +I +A +G+ LL  G   R+
Sbjct: 239 ----------------NSKIQKSSRNNTYSSIMVKGMEEIYIKSAHEGLQLLTEGSLKRK 282

Query: 290 VASTKMNDFSSRSHTIFTIMLYKNH----NGEVF-RVSKMNLVDLAGSENISRSGAQNQR 344
           VASTK ND SSRSHTIFTI          +GE + ++ K+NLVDLAGSENISRSGA+N R
Sbjct: 283 VASTKCNDLSSRSHTIFTITTNITKIDPVSGEQYVKIGKLNLVDLAGSENISRSGAENMR 342

Query: 345 AKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKI 404
           A+EAG IN+SLLTLGRVIN+L D + HIP+RESKLTRLLQDSLGG TKT +IAT+SPAKI
Sbjct: 343 AQEAGLINKSLLTLGRVINALVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKI 402

Query: 405 NAEETSSTLEYATKAKNIKNKPQLGTLVMKDILVKNITRELAKIKSDFLSTKSKDGIYMT 464
           + EET STLEYAT+AK+IKN PQ+   + KD+ +    +E+ +++ +  +++ KDG+Y+T
Sbjct: 403 SMEETISTLEYATRAKSIKNTPQINQSMSKDVCINEYVQEIERLRQELKASRQKDGVYIT 462

Query: 465 QDHY 468
           Q+ +
Sbjct: 463 QEQF 466

>Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W
           (REAL)
          Length = 1113

 Score =  253 bits (647), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 191/599 (31%), Positives = 319/599 (53%), Gaps = 58/599 (9%)

Query: 259 SAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIML------YK 312
           S+I ++ +QE  I +A +G+NLL +G   R+VA+TK ND SSRSHT+FTI         K
Sbjct: 239 SSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSK 298

Query: 313 NH--NGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA 370
           +H  N    ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D + 
Sbjct: 299 DHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSN 358

Query: 371 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGT 430
           HIP+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET+STLEYAT+AK+IKN PQ+  
Sbjct: 359 HIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNTPQVNQ 418

Query: 431 LVMKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDH---YKELTSDLENYKTEVQECKR 487
            + KD  +K+  +E+ K+K+D  ++++K GI++TQD    Y+  +  ++    ++   + 
Sbjct: 419 SLSKDTCLKDYIQEIEKLKNDLKNSRNKQGIFITQDQLDLYESNSILIDEQNLKIHNLRE 478

Query: 488 EIEKMNSQNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHT 547
           +I+K   + +  L          E     I+  +   +H Y K+ + H    +L+  +  
Sbjct: 479 QIKKFKEKYLTQLDINNLLQSEKEKLVTVIRDFDIDYSHFYSKIQQIHYTNLELINQVTQ 538

Query: 548 LKDAI-------YTV-QNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIH---EQLAAMK 596
            +D+        YT  QN         LQ  + +++ L ++ + F Q I+   E+L    
Sbjct: 539 QRDSSHENCQKQYTANQNMQLKISQQVLQTLNSLQNSLRNYNSKFSQVINGVTEELTNSV 598

Query: 597 ASHSSRH-------LGIDGNIDIIQEELSQVLESICST----SVDVCRSCVEKILESNPK 645
            SH   H       +    N+ +I+  +++++ SI ++      D    C + + +    
Sbjct: 599 NSHKVNHDSTFKSLMNTTANLLMIK--MNELVLSISNSFKDFQSDFASHCNKDLNDIYQS 656

Query: 646 HFESIRRDLLDISTVVDSYSNELVKNLGDISEEYNNFREYLNEHLFKNNHEETLSIHVDK 705
           H   +R    DI   +DS    ++ ++ +IS+  +     +N  +  N HE  +   ++K
Sbjct: 657 HKLLLRNLQSDIKKCLDSIGRSVLASINEISDSCSTNLNSMN--VLINKHESEVLKVIEK 714

Query: 706 TYHMLKKSAGEL-------------FSKFKEMMDSHLEENKSLMIKSLKTASDEVVAKEV 752
               +KK   +L              ++ K    +H+   ++ +   L    +++  K++
Sbjct: 715 KDSEIKKLKNDLVNERKISNEFSEQLTQLKWYFQNHVSRTRNELHDELDGFINKLKDKQL 774

Query: 753 KLFAPVKQKWESSLENINKCD-SLNNTFDSTVKDALRRLEGNIE----GSLEFSKNTAG 806
           KL   +   W  +    N+ D ++N  +  ++    + +EG +E     +  F+KN  G
Sbjct: 775 KLDQDI---WHKTTSVFNQTDIAVNKIYSESILSLTQDVEGALETVSHNNAAFTKNMTG 830

 Score =  136 bits (342), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 106/188 (56%), Gaps = 21/188 (11%)

Query: 18  NITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVDKVF 77
           NI V VRCR RN+REI  KSSVV++     G   +  N + +   +   + KTY  D+VF
Sbjct: 52  NIHVYVRCRSRNKREIDEKSSVVISTLGPQGKEIILSNGSHQ---SYSSSKKTYQFDQVF 108

Query: 78  GPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGD----------ERLY 127
           G  +DQ  +F   A+    + + GYNCT+  YG T TGKTYTM+GD          ++L 
Sbjct: 109 GAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDKLL 168

Query: 128 DGELSDAAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELK-----DLLNEPQESGV 182
            GE    AGIIPR+L  LF  L T + +Y VK SF+ELYNE LK        ++P  +  
Sbjct: 169 LGE---HAGIIPRVLVDLFKELSTLNREYSVKISFLELYNENLKDLLSDSDDDDPVVNDT 225

Query: 183 IKKLRIFD 190
            +++RIFD
Sbjct: 226 KRQIRIFD 233

>YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}
           KIP1Kinesin-related motor protein required for mitotic
           spindle assembly, chromosome segregation, and 2 micron
           plasmid partitioning; functionally redundant with Cin8p
           for chromosomal but not plasmid functions
          Length = 1111

 Score =  248 bits (633), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 170/460 (36%), Positives = 280/460 (60%), Gaps = 51/460 (11%)

Query: 259 SAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIML------YK 312
           S+I ++ +QE  I +A +G+NLL +G   R+VA+TK ND SSRSHT+FTI         K
Sbjct: 239 SSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSK 298

Query: 313 NH--NGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA 370
           +H  N    ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D + 
Sbjct: 299 DHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSN 358

Query: 371 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGT 430
           HIP+RESKLTRLLQDSLGG TKT +IATISPAKI+ EET+STLEYAT+AK+IKN PQ+  
Sbjct: 359 HIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTPQVNQ 418

Query: 431 LVMKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDH---YKELTSDLENYKTEVQECKR 487
            + KD  +K+  +E+ K+++D  ++++K GI++TQD    Y+  +  ++    ++   + 
Sbjct: 419 SLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQLDLYESNSILIDEQNLKIHNLRE 478

Query: 488 EIEKM--NSQNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTI 545
           +I+K   N  N L + +   S E  +L  I I++ N   ++ Y ++ K H    +L+  +
Sbjct: 479 QIKKFKENYLNQLDINNLLQS-EKEKLIAI-IQNFNVDFSNFYSEIQKIHHTNLELMNEV 536

Query: 546 HTLKDAIYTVQNSLKNCEDYQ----------LQCKSEMEDVLYDH---VTSFKQSIHEQL 592
              +D  ++++NS K     Q          LQ  + ++  L ++    +   + + E+L
Sbjct: 537 IQQRD--FSLENSQKQYNTNQNMQLKISQQVLQTLNTLQGSLNNYNSKCSEVIKGVTEEL 594

Query: 593 AAMKASHSSRH-------LGIDGNIDIIQEELSQVLESICSTSVDVC--------RSCVE 637
                +H ++H       L I  N  ++  ++++++ SI STS+++         R  + 
Sbjct: 595 TRNVNTHKAKHDSTLKSLLNITTN--LLMNQMNELVRSI-STSLEIFQSDSTSHYRKDLN 651

Query: 638 KILESNPKHFESIRRDLLDISTVVDSYSNELVKNLGDISE 677
           +I +S+ +  ++++    DI + +DS  + ++ ++ +IS+
Sbjct: 652 EIYQSHQQFLKNLQN---DIKSCLDSIGSSILTSINEISQ 688

 Score =  136 bits (342), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 109/191 (57%), Gaps = 27/191 (14%)

Query: 18  NITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVDKVF 77
           NI V VRCR RN+REI+ KSSVV++     G   +  N + +   +   + KTY  D+VF
Sbjct: 52  NIHVYVRCRSRNKREIEEKSSVVISTLGPQGKEIILSNGSHQ---SYSSSKKTYQFDQVF 108

Query: 78  GPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE------- 130
           G  +DQ  +F   A+    + + GYNCT+  YG T TGKTYTM+GD  +  G+       
Sbjct: 109 GAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINIL-GDVQSTDNL 167

Query: 131 -LSDAAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELK----------DLLNEPQE 179
            L + AGIIPR+L  LF  L + +++Y VK SF+ELYNE LK            +N+P+ 
Sbjct: 168 LLGEHAGIIPRVLVDLFKELSSLNKEYSVKISFLELYNENLKDLLSDSEDDDPAVNDPK- 226

Query: 180 SGVIKKLRIFD 190
               +++RIFD
Sbjct: 227 ----RQIRIFD 233

>Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  246 bits (629), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 125/217 (57%), Positives = 168/217 (77%), Gaps = 8/217 (3%)

Query: 259 SAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIML------YK 312
           S+I ++ +QE  I +A +G+NLL +G   R+VA+TK ND SSRSHT+FTI         K
Sbjct: 238 SSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSK 297

Query: 313 NH--NGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA 370
           +H  N    ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D + 
Sbjct: 298 DHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSN 357

Query: 371 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGT 430
           HIP+RESKLTRLLQDSLGG TKT +IATISPAKI+ EET+STLEYAT+AK+IKN PQ+  
Sbjct: 358 HIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTPQVNQ 417

Query: 431 LVMKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDH 467
            + KD  +K+  +E+ K+++D  ++++K GI++TQD 
Sbjct: 418 SLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQ 454

 Score =  144 bits (364), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 117/203 (57%), Gaps = 17/203 (8%)

Query: 1   MHPLSSRELSEENGQELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEL 60
           +HP++    +     + NI V VRCR RN+REI  KSSVV++     G   +  N + + 
Sbjct: 34  IHPVTPPIYNSAATSDSNIHVYVRCRSRNKREIDEKSSVVISTLGPQGKEIILSNGSHQ- 92

Query: 61  GITAQMNSKTYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTM 120
             +   + KTY  D+VFG  +DQ  +F   A+    + + GYNCT+  YG T TGKTYTM
Sbjct: 93  --SYSSSKKTYQFDQVFGAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTM 150

Query: 121 TGDERLYDGE--------LSDAAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKD 172
           +GD  +  G+        L + AGIIPR+L  LF  L + +++Y VK +F+ELYNE LKD
Sbjct: 151 SGDINIL-GDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKVTFLELYNENLKD 209

Query: 173 LL-----NEPQESGVIKKLRIFD 190
           LL     ++P  +   +++RIFD
Sbjct: 210 LLSDNEDDDPAVNDSKRQIRIFD 232

>Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  246 bits (628), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 167/217 (76%), Gaps = 8/217 (3%)

Query: 259 SAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIML------YK 312
           S+I ++ +QE  I +A +G+NLL +G   R+VA+TK ND SSRSHT+FTI         K
Sbjct: 239 SSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIIEQDSK 298

Query: 313 NH--NGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA 370
            H  N    ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D + 
Sbjct: 299 EHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSN 358

Query: 371 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGT 430
           HIP+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET+STLEYAT+AK+IKN PQ+  
Sbjct: 359 HIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNSPQVNQ 418

Query: 431 LVMKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDH 467
            + KD  +K+  +E+ K+++D  ++++K GI++TQD 
Sbjct: 419 SLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQ 455

 Score =  148 bits (374), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 84/203 (41%), Positives = 116/203 (57%), Gaps = 18/203 (8%)

Query: 2   HPLSSRELSEENG-QELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEL 60
           HP+     +  N   E NI V VRCR RN REI  KSSVV++     G   +  N + + 
Sbjct: 35  HPVPPPICNNSNATSESNIHVYVRCRSRNRREIDEKSSVVISTLGPQGKEIILSNGSHQ- 93

Query: 61  GITAQMNSKTYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTM 120
             +   + KTY  D+VFG  +DQ ++F   A+    + + GYNCT+  YG T TGKTYTM
Sbjct: 94  --SYSSSKKTYQFDQVFGAESDQEMVFHATAKNYIREMLHGYNCTIFAYGQTGTGKTYTM 151

Query: 121 TGDERLYDGE--------LSDAAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKD 172
           +GD  +  G+        L + AGIIPR+L  LF  L + +++Y VK SF+ELYNE LKD
Sbjct: 152 SGDINIL-GDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKVSFLELYNENLKD 210

Query: 173 LL-----NEPQESGVIKKLRIFD 190
           LL     ++P  +   K++RIFD
Sbjct: 211 LLSDNEDDDPTANDSKKQIRIFD 233

>ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL063W
           (KIP1)
          Length = 1129

 Score =  246 bits (627), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 165/407 (40%), Positives = 257/407 (63%), Gaps = 39/407 (9%)

Query: 260 AIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIM--LYKNH--N 315
           +I+++ ++E +I +A++G+ LL  G   R+VA+TK ND SSRSHTIFTI   + K H  +
Sbjct: 250 SIFVKGMEEMYIRSAQEGLKLLMDGSLKRKVAATKCNDLSSRSHTIFTITTNVTKIHPIS 309

Query: 316 GEVF-RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPF 374
           GE + +V K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D + HIP+
Sbjct: 310 GEQYVKVGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQHIPY 369

Query: 375 RESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGTLVMK 434
           RESKLTRLLQDSLGG TKT +IATISPAKI+ EET STLEYAT+AK+IKN PQ+  L+ K
Sbjct: 370 RESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYATRAKSIKNTPQVNQLMAK 429

Query: 435 DILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSD---LENYKTEV---QECKRE 488
           +  +    +E+ +++ +  ++ SK+GIY+TQ+ ++   S+   +E  + ++   QE  R 
Sbjct: 430 ESCIIEYIQEIERLRKELRASHSKEGIYITQEKFETYESNSILVEEQQAKIDNLQEQLRR 489

Query: 489 IEKMNSQNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHT- 547
           +++   +   L+K+K    ++ EL     K+L            +Q K+    +  IH+ 
Sbjct: 490 LKEKFLEQTKLIKEKDG--QIKELDVANRKYL------------EQSKDLTIYINGIHSK 535

Query: 548 LKDAIYTV----QNSLKNCEDYQLQCKSEMEDVL--YDHVTSFKQSIHEQLAAMKA---- 597
           L+D  +T+     N++K  ED      +  ED+L   DH+ +    I  ++ ++ +    
Sbjct: 536 LEDYEHTMIGIHNNNMKLLEDINDNRGNIHEDLLAKVDHIETCNLIISREITSLISIRNV 595

Query: 598 --SHSSRHLGIDGNI-DIIQEELSQVLESICSTSVDVCRSCVEKILE 641
             ++S R   + G + + +QE+L+QV  +   + +DV  S V++  E
Sbjct: 596 LQAYSDRFKTVLGGVFEELQEKLTQVGRTTEESQLDVDLSFVDEKFE 642

 Score =  154 bits (390), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 82/171 (47%), Positives = 103/171 (60%), Gaps = 15/171 (8%)

Query: 12  ENGQELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTY 71
           E   E NI V VRCR RNEREI+ KSSVV++     G   +  N           ++KTY
Sbjct: 48  EGEPEYNIKVYVRCRSRNEREIREKSSVVISTLGNNGREVILTNP-------GTGSNKTY 100

Query: 72  TVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE- 130
           T D+VFG  +DQ  +F Q+A    ++ I+GYNCTV  YG T TGKTYTM+GD  +     
Sbjct: 101 TFDRVFGVESDQESMFNQVARAYINEMIEGYNCTVFAYGQTGTGKTYTMSGDITMMGSSE 160

Query: 131 -------LSDAAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLL 174
                  LS+ AGIIPR+L +LF  L    EDY VK SF+ELYNE+L+DLL
Sbjct: 161 DDPNFVLLSEHAGIIPRVLVELFRELREVSEDYSVKVSFLELYNEKLRDLL 211

>SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1112

 Score =  244 bits (624), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 126/230 (54%), Positives = 172/230 (74%), Gaps = 6/230 (2%)

Query: 245 RLINN-KQQSLSEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSH 303
           R+ +N K +  ++ S +I ++ ++E +I +A++G+ LL  G   RQVASTK ND SSRSH
Sbjct: 235 RIFDNIKPEKNTQGSHSIMVKGMEEIYIKSAQEGLKLLTEGSIKRQVASTKCNDLSSRSH 294

Query: 304 TIFTIMLYKNH----NGEVF-RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 358
           T+FTI          +GE + +  K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTL
Sbjct: 295 TVFTITTNVTKVDPLSGEEYVKNGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTL 354

Query: 359 GRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATK 418
           GRVIN+L D + HIP+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET STLEYAT+
Sbjct: 355 GRVINALVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETVSTLEYATR 414

Query: 419 AKNIKNKPQLGTLVMKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDHY 468
           AK+IKN PQ+   + KD  +     E+ +++ +  +T++KDGIY+TQ+ Y
Sbjct: 415 AKSIKNTPQINQSMTKDSCITEYIHEIDRLRKELRATRTKDGIYITQEKY 464

 Score =  151 bits (381), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 81/185 (43%), Positives = 109/185 (58%), Gaps = 12/185 (6%)

Query: 18  NITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVDKVF 77
           NI V VRCR RN+REI  KSSVV++     G + +  N +     +     KTYT D+VF
Sbjct: 54  NIKVYVRCRSRNKREIGEKSSVVISTMGAQGRDVILSNPSSSSSGSLTNVKKTYTFDRVF 113

Query: 78  GPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE------- 130
           G  +DQ ++F  +A+    + ++GYNCTV  YG T TGKTYTM+GD  +           
Sbjct: 114 GAESDQEVVFNSVAKNYISEMLQGYNCTVFAYGQTGTGKTYTMSGDINILGSTTHNHDQS 173

Query: 131 ---LSDAAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEP--QESGVIKK 185
              LS+ AGIIPR+L  LF  L+ +  DY VK SF+ELYNE LKDLL +   ++    + 
Sbjct: 174 SILLSEHAGIIPRVLVDLFKDLKNESTDYSVKVSFLELYNERLKDLLADSNKEDDNNAES 233

Query: 186 LRIFD 190
           +RIFD
Sbjct: 234 IRIFD 238

>TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7.387
           YBL063W
          Length = 1232

 Score =  243 bits (619), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 155/377 (41%), Positives = 235/377 (62%), Gaps = 32/377 (8%)

Query: 245 RLINNKQQSLSE-QSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSH 303
           R+++N+ +S S    S+I ++ ++E +I +A +G+ LL  G   R+VASTK+ND SSRSH
Sbjct: 323 RIMSNQNKSASNCNGSSITVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKLNDLSSRSH 382

Query: 304 TIFTIMLYKNH----NGEVF-RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 358
           TIFTI+          G+ F +  K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTL
Sbjct: 383 TIFTIITNVTKVDPVTGKHFVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTL 442

Query: 359 GRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATK 418
           GRVIN+L D++ HIP+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET STLEYAT+
Sbjct: 443 GRVINALVDRSHHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISLEETVSTLEYATR 502

Query: 419 AKNIKNKPQLGTLVMKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDHY---------- 468
           AK+IKN PQ+   + KD  +     E+ +++++    ++K+GIY+TQD            
Sbjct: 503 AKSIKNTPQINQSLSKDTFIHEYINEIDRLRNELKLARTKEGIYITQDQLDLYESNSILI 562

Query: 469 KELTSDLENYKTEVQECK-REIEKMNSQNVLLLK---DKRASHEVSELQRIKIKHLNDKI 524
            E  + ++N + +++  K + +E+  S  +LL K    + A+ ++SE  ++        I
Sbjct: 563 TEQKAKIDNMEDQIKRFKAKYVEETESNRILLNKLEQSEDANQKLSEKTKV--------I 614

Query: 525 AHLYDKMDKQHKNEQDLVCTIHTLKDAIYTVQNSLKNCEDYQLQCKSEMEDVLYDHVTSF 584
             L+ +  +  K     +  IH+    ++   +SL+N +D    C  +    L + +   
Sbjct: 615 ISLFKRYQENFKIFNSNINQIHSSNLEVF---DSLQNHKDKLDLCSKKNIKTLKE-IYIA 670

Query: 585 KQSIHEQLAAMKASHSS 601
           ++   EQL  +KAS SS
Sbjct: 671 EEKYTEQLNTLKASLSS 687

 Score =  119 bits (297), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 83/233 (35%), Positives = 111/233 (47%), Gaps = 65/233 (27%)

Query: 5   SSRELSEENGQELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEV-SINTTDELGIT 63
           SS+ LS  + ++ NI V VRCR R +REI  KSSVV++     G+  + S N + +L  T
Sbjct: 40  SSKSLS--HTKDDNIKVYVRCRSRTQREIDEKSSVVISTLGANGNKVILSPNQSRKLYNT 97

Query: 64  --------------------------AQMNSKTYTVDKVFGPSADQSLIFKQIAEPLFDD 97
                                        N +TYT DKVFG  +DQ  +F+ +A+    +
Sbjct: 98  NANGSTRTKNNTNLNNNIKNATTNSNTGTNGRTYTFDKVFGVESDQETLFESVAKNYIYE 157

Query: 98  FIKGYNCTVLVYGMTSTGKTYTMTGDERL---YDGE----LSDAAGIIPRILFKLFDTLE 150
            ++GYNCTV  YG T TGKTYTM+GD  +    D +    L + AGIIPR+L  LF  L 
Sbjct: 158 MLQGYNCTVFAYGQTGTGKTYTMSGDLNILGNLDSKDKILLGEHAGIIPRVLVYLFKELS 217

Query: 151 TQD-----------------------------EDYLVKCSFIELYNEELKDLL 174
             D                              +Y VK SF+ELYNE+L DLL
Sbjct: 218 KNDTITNTKVNNNKNNNNNSNNKNEEQINLKNTEYSVKVSFLELYNEKLTDLL 270

>NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7.387
          Length = 1102

 Score =  240 bits (613), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 137/300 (45%), Positives = 198/300 (66%), Gaps = 11/300 (3%)

Query: 258 SSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIML----YKN 313
           SS+I ++ ++E +I +A  G+ LL  G   R+VA+TK ND SSRSHT+FTI         
Sbjct: 239 SSSIMVKGMEEIYINSAHQGLQLLMDGSIKRKVAATKCNDLSSRSHTVFTITTNITKLDP 298

Query: 314 HNGEVF-RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHI 372
            +GE + +  K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D   HI
Sbjct: 299 VSGEQYVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHTQHI 358

Query: 373 PFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGTLV 432
           P+RESKLTRLLQDSLGG TKT +IATISPAKI+ +ET STLEYAT+AK+IKN PQ+   +
Sbjct: 359 PYRESKLTRLLQDSLGGKTKTCIIATISPAKISMDETISTLEYATRAKSIKNTPQVNQSM 418

Query: 433 MKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSD---LENYKTEVQECKREI 489
            KD  +     E+ +++ +  +++ KDGI +TQD +    S+   ++  KT++Q  + +I
Sbjct: 419 SKDSCINEYVHEIERLRQELKTSRQKDGISITQDQFDLYESNGILVDEQKTKIQNMEEQI 478

Query: 490 EKMNSQNVL---LLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIH 546
           ++   + V    L K+  +  + +ELQ I++K    ++  L +       +  + V  IH
Sbjct: 479 QRFKDKYVKQTELNKNLESRLKQNELQTIQLKSQRTQLLSLLENFQSNSNHYIERVTKIH 538

 Score =  145 bits (367), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 108/180 (60%), Gaps = 14/180 (7%)

Query: 19  ITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVDKVFG 78
           I V VRCR RNEREI+ KSSVV++      S ++ ++        A+   +TYT D+VFG
Sbjct: 61  IKVYVRCRSRNEREIQEKSSVVISTLGAPQSTQLLLSNPLLPLAYAK---RTYTFDRVFG 117

Query: 79  PSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE-------- 130
             +DQ  +F   A+    + ++GYNCTV  YG T TGKTYTM+GD  +  G+        
Sbjct: 118 AESDQESVFNDAAKNYIHEMLEGYNCTVFAYGQTGTGKTYTMSGDLNILGGDLDSNTMVL 177

Query: 131 LSDAAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQESGVIKKLRIFD 190
           L + AGIIPR+L +LF  L+  +E Y VK SF+ELYNE LKDLL   Q     + +RIFD
Sbjct: 178 LGEHAGIIPRVLVELFRWLDG-NEGYSVKVSFLELYNERLKDLLASEQSEE--ENIRIFD 234

>TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7.387
           YBL063W
          Length = 1105

 Score =  237 bits (604), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 122/245 (49%), Positives = 175/245 (71%), Gaps = 8/245 (3%)

Query: 261 IYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNH-----N 315
           I ++ ++EF+I +A +G+ LL  G   R+VA+TK ND SSRSHT+FTI           N
Sbjct: 248 IMVKGMEEFYIKSAHEGLELLMTGSLKRKVAATKCNDLSSRSHTVFTITTNVARTDPVSN 307

Query: 316 GEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFR 375
            +  ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D + HIP+R
Sbjct: 308 EQYIKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDNSQHIPYR 367

Query: 376 ESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGTLVMKD 435
           ESKLTRLLQDSLGG TKT +IATISPAKI+ +ET STLEYAT+AK+IKN PQ+   + K+
Sbjct: 368 ESKLTRLLQDSLGGKTKTCIIATISPAKISMDETVSTLEYATRAKSIKNTPQVNQSMSKN 427

Query: 436 ILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSD---LENYKTEVQECKREIEKM 492
             +     E+ +++ +  +++ K+G+Y+T+D ++   S+   +E  K  +Q  + +I K 
Sbjct: 428 SCLGEYIHEIERLRQELKASRQKEGMYITEDQFQLYESNSILVEEQKVRIQNMEDQILKF 487

Query: 493 NSQNV 497
            ++ V
Sbjct: 488 KAKYV 492

 Score =  150 bits (379), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 84/197 (42%), Positives = 119/197 (60%), Gaps = 15/197 (7%)

Query: 3   PLS-SRELSEENGQ-ELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEL 60
           PL+  RE  ++ G+   N+ V VRCR RNE+EI+ KSSVV++     G   +  N    L
Sbjct: 24  PLARPRESEQQEGRVSSNMRVYVRCRSRNEQEIEEKSSVVISTLGAKGREVILSNGAGSL 83

Query: 61  GITAQMNSKTYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTM 120
                 + +TYT D+VFG  +DQ  +F ++A+    + ++GYNCTV  YG T TGKTYTM
Sbjct: 84  S----HSKRTYTFDQVFGAESDQETVFDEVAKDYISEMLEGYNCTVFTYGQTGTGKTYTM 139

Query: 121 TGDERL---YDGE----LSDAAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDL 173
           +GD  +    D +    L + +GIIPR+L  LF  L  +  +Y VK SF+ELYNE+LKDL
Sbjct: 140 SGDISILGDLDSQDKILLGEHSGIIPRVLVDLFKQLSQETNEYTVKVSFLELYNEKLKDL 199

Query: 174 LNEPQESGVIKKLRIFD 190
           L E ++    + +RIFD
Sbjct: 200 LAESEQEE--ENIRIFD 214

>NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {ON}
           Anc_7.387
          Length = 1186

 Score =  236 bits (601), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 126/243 (51%), Positives = 173/243 (71%), Gaps = 8/243 (3%)

Query: 258 SSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNH--- 314
           SS+I ++ ++E +I +A +G+ LL  G   R+VASTK ND SSRSHT+FTI         
Sbjct: 286 SSSIMVKGMEEIYIKSAHEGLQLLMDGSLKRKVASTKCNDLSSRSHTVFTIATNITKIDP 345

Query: 315 -NGEVF-RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHI 372
            +GE + +  K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D + HI
Sbjct: 346 ISGEQYIKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQHI 405

Query: 373 PFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGTLV 432
           P+RESKLTRLLQDSLGG TKT +IATISPAKI+ EET STLEYA +AK+IKN PQ+   +
Sbjct: 406 PYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYAIRAKSIKNTPQINQSM 465

Query: 433 MKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSD---LENYKTEVQECKREI 489
            KD  +     E+ +++ +  +++ KDGI +TQD      S+   ++  KT++   + +I
Sbjct: 466 SKDTCINEYVSEIERLRLELKTSRQKDGICITQDQLDLYESNGILVDEQKTKIHNMEEQI 525

Query: 490 EKM 492
           +K 
Sbjct: 526 QKF 528

 Score =  145 bits (367), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 105/182 (57%), Gaps = 18/182 (9%)

Query: 18  NITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVDKVF 77
           NI V VRCR R+EREIK KSSVV++     G+  +  N +  L        K+Y+ D+VF
Sbjct: 108 NIKVYVRCRSRSEREIKEKSSVVISTLGPQGNQVILSNPSSPLSYPK----KSYSFDRVF 163

Query: 78  GPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDG-------E 130
           G  +DQ  +F   A+    + + GYNCTV  YG T TGKTYTM+GD  +           
Sbjct: 164 GAESDQETVFNDAAKNYISEMLSGYNCTVFAYGQTGTGKTYTMSGDLNILGNLESKDMIL 223

Query: 131 LSDAAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLL--NEPQESGVIKKLRI 188
           L + AGIIPR+L  LF  L  ++ DY VK SF+ELYNE LKDL   NE +E  +    RI
Sbjct: 224 LGEHAGIIPRVLVNLFKMLALEN-DYSVKISFLELYNERLKDLFAQNESEEETI----RI 278

Query: 189 FD 190
           FD
Sbjct: 279 FD 280

>TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7.387
           YBL063W
          Length = 1142

 Score =  179 bits (455), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 125/301 (41%), Positives = 180/301 (59%), Gaps = 43/301 (14%)

Query: 259 SAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIM-----LYKN 313
           S+I ++ +QE  I NA +G+NLL +G   R+V STK+ND SSRSHTIFTI      L   
Sbjct: 206 SSIIVKGMQEIFIKNAMEGLNLLMKGSLQRKVKSTKLNDLSSRSHTIFTITTNIIKLDNQ 265

Query: 314 HNGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK--NAH 371
            N E  ++ K+NLVDLAGSENI++SG +  R++E G IN+SLLTLGRVIN+L+DK  N H
Sbjct: 266 TNKEYIKIGKLNLVDLAGSENITKSGLK--RSQETGLINKSLLTLGRVINALSDKTNNTH 323

Query: 372 ----------------------IPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEET 409
                                 IP+RESKLTRLLQDSLGG TKT +IATISPAK   +ET
Sbjct: 324 GSNNDNNNSSSSSSISNSHHSHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKTCLDET 383

Query: 410 SSTLEYATKAKNIKNKPQLGTLVMKDILVKNITRELAKIKSDFLSTKSK-DGIYMT---Q 465
            STLEYAT+A +IKN P++         + +   ++ ++K +  ++  K  GI++     
Sbjct: 384 ISTLEYATRAMSIKNNPKINKSQNPSNFINDYINQIDRLKLELQTSTDKIGGIFIPLEKL 443

Query: 466 DHYK-------ELTSDLENYKTEVQECKRE-IEKMNSQNVLLLKDKRASHEVSELQRIKI 517
           ++YK       E  + + N   ++ + K++ +E++     L    K++  E ++L  IK+
Sbjct: 444 NYYKSNEILIEEQNAKINNMTNQIAKFKKKFVEQIQINKQLNTDMKKSQWEKNQLLTIKL 503

Query: 518 K 518
           K
Sbjct: 504 K 504

 Score =  138 bits (347), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 84/201 (41%), Positives = 107/201 (53%), Gaps = 38/201 (18%)

Query: 18  NITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVDKVF 77
           NI V VRCR RN++EI  KSSVVV+     G         +++ I+   N   Y  D VF
Sbjct: 9   NIKVYVRCRSRNQKEIDEKSSVVVSTLGQNG---------NQIIISNSTNKNKYIFDNVF 59

Query: 78  GPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSDA--- 134
           G  +DQ  IF  +A     + I GYNCT+  YG T TGKTYTM+GD  +  G+L+     
Sbjct: 60  GVESDQESIFNSVAYNYIQEMIDGYNCTLFAYGQTGTGKTYTMSGDLNII-GDLNSTKNI 118

Query: 135 -----AGIIPRILFKLFDTLE--------TQDEDYLVKCSFIELYNEELKDLLNE----P 177
                AGIIPR+L +LF +LE        T  + Y VK SF+ELYNE LKDLL+     P
Sbjct: 119 LLGEHAGIIPRVLVQLFTSLEDSISNQKNTSVKGYTVKISFLELYNERLKDLLSADADLP 178

Query: 178 QESG--------VIKKLRIFD 190
             SG        V   ++IFD
Sbjct: 179 PNSGSSSANDPSVSSNIKIFD 199

>TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.678
           YPL155C
          Length = 696

 Score =  147 bits (370), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 116/414 (28%), Positives = 192/414 (46%), Gaps = 93/414 (22%)

Query: 39  VVVTVPDVTGSNEVSI-NTTDELGITAQMNSKTYTVDKVFGPSADQSLIFKQIAEPLFDD 97
           +V   P    +NE  + N  D   I A  +   + +D++F        I+ ++ +PL D 
Sbjct: 77  IVAIRPKPISNNEKKVWNIVDNKRI-AHDDVGEFRLDRIFDCDVSNLEIYSELCKPLIDK 135

Query: 98  FIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSDAAGIIPRILFKLFDTLETQD---- 153
              GYN T+  YGMT +GKT+TM+G +        +  G+IP  +  LF+T+  ++    
Sbjct: 136 LAMGYNATLFAYGMTGSGKTFTMSGTQ--------EDTGLIPLSISHLFNTINEENLLGK 187

Query: 154 EDYLVKCSFIELYNEELKDLLNEPQESGVIKKLRIFDXXXXXXXXXXXXXXXXPNLVGTS 213
           + Y +  S++E+YNE+L DLL+                                N+ G +
Sbjct: 188 KKYEMLVSYMEIYNEKLYDLLDT-------------------------------NVEGVN 216

Query: 214 GTFKRIFKTPVPYKXXXXXXXXXXXXXXXXPRLIN--NKQQSLSEQSSAIY---IQNLQE 268
             +    +TP                    PR  N  N  Q L  +  A Y   +  L E
Sbjct: 217 FGYSSNLQTP--------------------PRFGNSFNSAQDLRIRDDAQYGIKVVGLSE 256

Query: 269 FHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTI-MLYKNHNGEVFRVSKMNLV 327
              ++  D +  ++ G K+++++ T+ N  SSRSH+I  + ++  +    +   S ++L 
Sbjct: 257 HRCSSKDDLMKWVRIGDKNKKISETEYNSRSSRSHSILLVRLIATDLETGIVTTSTLSLC 316

Query: 328 DLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK------------------- 368
           DLAGSE   ++ +Q +R KE   IN+SLL LG VI  L+ +                   
Sbjct: 317 DLAGSE---KATSQQERRKEGAFINKSLLALGTVIAKLSSESNQHRNADNVNHQETSNPN 373

Query: 369 NAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNI 422
           N+HIP+R+SKLTR+LQ +L GN+    I T+      + ET +TL +A++AKN+
Sbjct: 374 NSHIPYRDSKLTRILQPALSGNSIITTICTVDIRSDASSETLNTLRFASRAKNV 427

>KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W
          Length = 473

 Score =  143 bits (361), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 116/175 (66%), Gaps = 8/175 (4%)

Query: 262 YIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHN---GEV 318
           +++ LQEF + +  + ++ L++G + + V +T +N+ SSRSHTIFTI + +  N   G V
Sbjct: 169 FVEGLQEFEVNSVDEILDYLRQGSERKTVGATLVNEQSSRSHTIFTINVEQKENSPLGHV 228

Query: 319 F-RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAH--IPFR 375
             R S + L+DLAGSE  + SGA  +R KE  +IN+SL TLGRVI  LA K     IP+R
Sbjct: 229 LERRSSIRLIDLAGSERANASGATGERLKEGSNINKSLSTLGRVIAMLAKKKQPRLIPYR 288

Query: 376 ESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGT 430
           ++ LT +L++SLGGN+KT +IA +SP     EET STL YAT A+++K   QL T
Sbjct: 289 DAALTWVLKESLGGNSKTCMIACVSPCDF--EETMSTLRYATLARSVKTFAQLNT 341

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 59/101 (58%), Gaps = 15/101 (14%)

Query: 82  DQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSDAAGIIPRI 141
           DQ+ +++Q+A       + GYN  +  YG T +GK++TMTG   L         GI+PR+
Sbjct: 62  DQAQLYEQLARDYLLHALDGYNTCIFAYGQTGSGKSHTMTGSAEL--------PGIVPRM 113

Query: 142 ---LFKLFDTLETQDE----DYLVKCSFIELYNEELKDLLN 175
              LF++ +  E+ D+     + ++CS++E+YNE ++DLL 
Sbjct: 114 CQELFEVREMYESSDDQASTQFKIRCSYLEIYNETVRDLLG 154

>ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 654

 Score =  143 bits (360), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 123/413 (29%), Positives = 183/413 (44%), Gaps = 104/413 (25%)

Query: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 130
           +  D VF  + +   ++ Q ++P+ D   +G N TV  YGMT +GKT+TM G E      
Sbjct: 122 FKYDHVFKTACNNVEVYAQTSKPMIDRVFEGLNATVFAYGMTGSGKTFTMAGTE------ 175

Query: 131 LSDAAGIIPRILFKLFDTLETQ----DEDYLVKCSFIELYNEELKDLLNEPQESGVIKKL 186
             +  G+IP  +  L+  +  +    D  + +  S++E+YNE++ DLL+   E       
Sbjct: 176 --ETLGLIPLSVAYLYSRVMEESLQGDSRFEIAVSYLEIYNEKIYDLLDCENE------- 226

Query: 187 RIFDXXXXXXXXXXXXXXXXPNLVGTSGTFKRIF--------KTPVPYKXXXXXXXXXXX 238
                                 L  T+ T  R+F        KTPV  K           
Sbjct: 227 ----------------------LKPTAATSSRMFAHMGTRSSKTPVELK----------- 253

Query: 239 XXXXXPRLINNKQQSLSEQSS-AIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMND 297
                          L E S   + I  L E    ++ + +  ++ G K R+   T  N 
Sbjct: 254 ---------------LREDSKYGVKIVGLTERRCESSDELLKWIRIGDKSRKTGETTYNT 298

Query: 298 FSSRSHTIFTIMLYKNHNGEVFRVSK-MNLVDLAGSENISRSGAQNQRAKEAGSINQSLL 356
            SSRSH I  I L K    E   VS  ++L DLAGSE   ++   N+R KE   IN+SLL
Sbjct: 299 RSSRSHAIVMIRLTKTDLKEGTSVSSTLSLCDLAGSE---KAVTHNERRKEGAFINKSLL 355

Query: 357 TLGRVINSLADKN-------------AHIPFRESKLTRLLQDSLGGNTKTALIATISPAK 403
            LG VI+ L+ ++              HIP+R+SKLTR+LQ +L GN     I TI    
Sbjct: 356 ALGTVISKLSAESTSHRNGGSSSPVTGHIPYRDSKLTRILQPALSGNGVVTTICTIDTRP 415

Query: 404 INAEETSSTLEYATKAKNIK----NKPQL-------GTLVMKDILVKNITREL 445
             + ET +TL +A++AKN+      KP L       G +  KD  + ++TR+L
Sbjct: 416 DASSETLNTLRFASRAKNVSLHIFRKPLLPSMSGSNGIVEEKDKTIMSLTRQL 468

>SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 504

 Score =  140 bits (354), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 78/175 (44%), Positives = 117/175 (66%), Gaps = 8/175 (4%)

Query: 262 YIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHN---GEV 318
           +++ L EF +   ++ +  +++G + R V  T MN+ SSRSH IFTI + ++     G++
Sbjct: 198 FVEGLNEFKVCKVEEILEYMKQGDRLRTVGVTNMNNSSSRSHAIFTISIKQSETTLAGDL 257

Query: 319 F-RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAH--IPFR 375
             R S + LVDLAGSE +S +GA+  R KE  +IN+SL TLGRV++ LA KN    IP+R
Sbjct: 258 TERRSSIKLVDLAGSERVSTTGARGDRLKEGSNINKSLTTLGRVVSVLAKKNRPKLIPYR 317

Query: 376 ESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGT 430
           +S LT +L+++LGGN+KT +IA +SP   + EET STL YAT AK +KN  ++ +
Sbjct: 318 DSALTWVLKENLGGNSKTVMIACVSPC--DYEETISTLRYATTAKEVKNTARVNS 370

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 86/183 (46%), Gaps = 28/183 (15%)

Query: 18  NITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVDKVF 77
           NI V+VR R    RE        VT P  +   +  I+T+  L        K +T D  F
Sbjct: 4   NIKVAVRLRSPLPREHGQPIITQVTSP-TSFVIQQHISTSSLLATEEFTQGKIFTFDHCF 62

Query: 78  ----GPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDE--------- 124
                 S DQ +I+  I        + GYN  +L YG T +GK++TM G E         
Sbjct: 63  KYSENASHDQEVIYDTIGREYLLHTLDGYNTCILAYGQTGSGKSFTMMGPEVSKHFHNNQ 122

Query: 125 RLYDGELSDAA-GIIPRILFKLFDT----------LETQDEDYLVKCSFIELYNEELKDL 173
              D  + D+A GIIPR+   LFD           ++TQ E Y   CS++E+YNE+++DL
Sbjct: 123 TALDRAIEDSAIGIIPRVCCDLFDICNMCNSEEDGIKTQFEIY---CSYLEIYNEQVRDL 179

Query: 174 LNE 176
           L+E
Sbjct: 180 LSE 182

>Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {ON}
           YGL216W (KIP3) - kinesin-related protein involved in
           mitosis [contig 192] FULL
          Length = 479

 Score =  138 bits (348), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 116/173 (67%), Gaps = 8/173 (4%)

Query: 262 YIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLY---KNHNGEV 318
           +++ L+EF +++ +D +N +++G + R + ST +N++SSRSHTIFTI +    K+  G V
Sbjct: 169 FVEGLREFDVSSVEDILNYVKQGNEKRMMGSTLVNEYSSRSHTIFTISIKQKEKSALGHV 228

Query: 319 F-RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAH--IPFR 375
             R S + L+DLAGSE    +     R KE  +IN+SL TLGRVI+ LA +     IP+R
Sbjct: 229 IERHSSIKLIDLAGSERAKAAKTSGDRLKEGSNINKSLSTLGRVISMLAKRKQPKLIPYR 288

Query: 376 ESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQL 428
           ++ LT +L++SLGGN+KT +IA +SP   + EET STL YAT A+N+K   QL
Sbjct: 289 DAALTWVLKESLGGNSKTCMIACVSPC--DYEETLSTLRYATLARNVKTCAQL 339

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 89/169 (52%), Gaps = 29/169 (17%)

Query: 18  NITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVDKVF 77
           NI V+VR R   ERE+    S++  V D    N + +   ++     +  ++++  D+ F
Sbjct: 4   NIKVAVRLRRPLEREVD--ESIIARVED---GNVIQVKDRNQ-----KNETRSFHFDQCF 53

Query: 78  GPS----ADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSD 133
             S    ADQ  +++Q++       + GY+  V  YG T +GK++TMTG          +
Sbjct: 54  AYSENIEADQLELYEQLSREYLLHALDGYHTCVFAYGQTGSGKSHTMTGS--------PE 105

Query: 134 AAGIIPRI---LFKLFDTLETQDE----DYLVKCSFIELYNEELKDLLN 175
           + GI+ R+   LF++ +  E+ D+     + ++CS++E+YNE ++DLL 
Sbjct: 106 SPGIVSRMCQELFEVREIYESSDDQVNTQFKIRCSYLEIYNETVRDLLG 154

>SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]
           {ON} weakly similar to uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a
           kinesin, colocalizes with Myo2p; kinesin heavy chain
           homolog
          Length = 649

 Score =  135 bits (340), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 80/174 (45%), Positives = 111/174 (63%), Gaps = 8/174 (4%)

Query: 259 SAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYK-NHNGE 317
           S IY++ L   ++T+ ++ ++ +++G   R V+ST MN  SSRSH+I  I L K N   E
Sbjct: 195 SGIYVKGLNTNYVTSEQELLDYIKQGESQRNVSSTSMNLESSRSHSIVRINLEKRNALEE 254

Query: 318 VFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD-------KNA 370
             + S + LVDLAGSE + ++ A     +EA  IN SL  LG VIN+L          +A
Sbjct: 255 NIQHSFLYLVDLAGSEKVGKTNAAGVTLEEAKKINSSLSALGNVINALTQVESKSKRTSA 314

Query: 371 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKN 424
           HIP+R+SKLTRLLQDSLGGN+KT LI   S ++ N +ET STL + ++AK IKN
Sbjct: 315 HIPYRDSKLTRLLQDSLGGNSKTTLILNCSTSRFNEQETLSTLRFGSRAKKIKN 368

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 73/129 (56%), Gaps = 11/129 (8%)

Query: 63  TAQMNSKTYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTG 122
           + Q N + +T D+VF   + Q  +++ +A  +   F +GYN T+L YG T +GK++TM G
Sbjct: 67  STQNNDRLFTFDRVFDTGSTQESVYEFVAGDMLKSFFQGYNGTILAYGQTGSGKSHTMFG 126

Query: 123 DERLYDGELSDAAGIIPRILFKLFDTLETQD-ED--YLVKCSFIELYNEELKDLLNEPQE 179
            +        +  G+IPRI   +F  +ET D ED  + V  SF+E+Y E++ DLL +  E
Sbjct: 127 PK--------ENRGVIPRICHDIFKQIETPDYEDCIFTVSVSFMEVYLEKIYDLLAQSLE 178

Query: 180 SGVIKKLRI 188
               K++ +
Sbjct: 179 KPADKRISL 187

>KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1 Kinesin-related motor protein
           required for mitotic spindle assembly and chromosome
           segregation; functionally redundant with Cin8p
          Length = 456

 Score =  130 bits (326), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 78/174 (44%), Positives = 111/174 (63%), Gaps = 5/174 (2%)

Query: 262 YIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHNGEVFRV 321
           ++Q++  F +   ++ +  L  G   R VAST+MN  SSRSH IFT+ + +       R 
Sbjct: 149 FVQDITTFKVNRVEEVLEYLSIGDSKRSVASTRMNMESSRSHAIFTLSIKQQEPDGSIRE 208

Query: 322 SKMNLVDLAGSENISRS-GAQN-QRAKEAGSINQSLLTLGRVINSLADKNAH-IPFRESK 378
           S + LVDLAGSE  + + G  N +R KE  +IN+SL TLGR I+ LA  + H IP+R+S 
Sbjct: 209 SDLKLVDLAGSERANATMGIDNGKRMKEGANINKSLSTLGRCISQLAKNSKHLIPYRDSL 268

Query: 379 LTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGTLV 432
           LT +L+++LGGN+KT +IA ISP  I+ EE+ STL YAT AK IK +  +  +V
Sbjct: 269 LTWVLKENLGGNSKTCMIACISP--IDLEESLSTLRYATTAKEIKLRATMNEIV 320

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 55/109 (50%), Gaps = 9/109 (8%)

Query: 69  KTYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYD 128
           +++  D +F  S+ Q+ I  ++        ++GYN  +  YG T +GKTYTM G      
Sbjct: 35  RSFNFDHIFDTSSSQTDIPGELCSKYVLHALEGYNACIFAYGQTGSGKTYTMRGT----- 89

Query: 129 GELSDAAGIIPRILFKLFDTLETQDEDY-LVKCSFIELYNEELKDLLNE 176
              +   GIIP +   LFD LE        V  ++ E+YNE+L DLL +
Sbjct: 90  ---NSNPGIIPLLCRDLFDALELDKTTVSSVSITYFEIYNEKLIDLLGD 135

>KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 678

 Score =  129 bits (323), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 113/422 (26%), Positives = 183/422 (43%), Gaps = 96/422 (22%)

Query: 24  RCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVDKVFGPSADQ 83
           +CRG     I+ K S   T      S++ +I   D LG         +  DKVF P  + 
Sbjct: 102 QCRGTISVSIRLKPSDTNTRSPWYASDDHTIVHND-LG--------EFWFDKVFSPQTNN 152

Query: 84  SLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSDAAGIIPRILF 143
             ++++I +P+ D   +GYN T+  YGMT +GKT+TM+G          D AG+I   + 
Sbjct: 153 YGVYEEIGKPMIDKLFQGYNATIFAYGMTGSGKTFTMSGTR--------DEAGLILLSVE 204

Query: 144 KLFDTL---ETQDEDYLVKCSFIELYNEELKDLLNEPQESGVIKKLRIFDXXXXXXXXXX 200
           ++F  +      ++ Y V+ S++        ++ NE          +I+D          
Sbjct: 205 QIFSQIMKESVNNKSYEVRVSYL--------EIYNE----------KIYDLLNY------ 240

Query: 201 XXXXXXPNLVGTSGTFKRIFKTPVPYKXXXXXXXXXXXXXXXXPRLINNKQQSLSEQSSA 260
                 P+     GT+       VP                              +    
Sbjct: 241 ------PSAKSPGGTYGSFQSKNVPGAGAELPVR--------------------DDARHG 274

Query: 261 IYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHNGEVFR 320
           + +  L E  + +++D +  ++ G  +R+   T  N  SSRSH I TI +      E+  
Sbjct: 275 VRVVGLTEQQVHSSEDVLRKIELGNSNRRTGETDYNTRSSRSHAIVTIKVTCT---ELLS 331

Query: 321 ----VSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD--------- 367
                S ++L DLAGSE   R+  Q++R KE   IN+SLL LG VI+ L+          
Sbjct: 332 GTDTTSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSAVSGASGGGA 388

Query: 368 -------KNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAK 420
                   N+H+P+R+SKLTR+LQ +L G++    I TI        ET +T+ +A++AK
Sbjct: 389 ATPPPTFGNSHVPYRDSKLTRILQPALSGDSIVTTICTIDTKPDAMSETVNTIRFASRAK 448

Query: 421 NI 422
           N+
Sbjct: 449 NV 450

>ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL079W
           (SMY1)
          Length = 635

 Score =  126 bits (316), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 85/214 (39%), Positives = 127/214 (59%), Gaps = 12/214 (5%)

Query: 244 PRLINNKQQSLSEQSS---AIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSS 300
           P+  ++K+ SL+   S    +Y++      +++  + +N +  G   R   ST MN  SS
Sbjct: 169 PKKNSDKRASLTVHESNTFGVYVEGATIVSVSDGDELLNCIHLGEAQRYKGSTDMNLESS 228

Query: 301 RSHTIFTIMLYKNHNGEV-FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLG 359
           RSH I  I L K  N E   + S + LVDLAGSE ++++ A     +EA  IN SL +LG
Sbjct: 229 RSHAIVKINLLKRDNLEGNIQKSDLFLVDLAGSEKVAKTNAVGATLEEAKKINLSLSSLG 288

Query: 360 RVINSLA--DKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYAT 417
            VIN+L   +K  HIP+R+S+LTRLL+DSLGGN+KT LI   +  K N  ET +TL + +
Sbjct: 289 NVINALTQKEKRTHIPYRDSQLTRLLRDSLGGNSKTTLILNCACDKSNESETLTTLRFGS 348

Query: 418 KAKNIKNKPQLGTLVMKD--ILVKNITRELAKIK 449
           +AK+IKNK     +V K    L K + R++A+++
Sbjct: 349 RAKHIKNK----AIVNKSDLFLKKKLERKIAQLE 378

 Score = 87.0 bits (214), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 50/148 (33%), Positives = 75/148 (50%), Gaps = 15/148 (10%)

Query: 36  KSSVVVTVPDVTGSNEVSINTTDELGI---TAQMNSKTYTVDKVFGPSADQSLIFKQIAE 92
           K  VVV +  +      ++   DE  +    A   ++ +  D VFG  A Q  +F  +AE
Sbjct: 22  KMKVVVRLRPLPEGGSAAVVAADEGTVEFAGAADEARAFRFDYVFGTDARQEEVFDYVAE 81

Query: 93  PLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSDAAGIIPRILFKLFDTL--- 149
            + D F  GYN T+L YG T +GK+YTM G             G+IPRI  ++F+ +   
Sbjct: 82  EMLDQFFTGYNSTILAYGQTGSGKSYTMFGP--------PGHRGLIPRICQQIFERIGLL 133

Query: 150 -ETQDEDYLVKCSFIELYNEELKDLLNE 176
               D +Y+V  SF+E+Y E++ DLL E
Sbjct: 134 KNCADIEYVVSVSFLEIYLEKVYDLLGE 161

>KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {ON}
           Anc_3.528 YGL216W
          Length = 672

 Score =  126 bits (316), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 113/178 (63%), Gaps = 8/178 (4%)

Query: 256 EQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTI---MLYK 312
           +Q+S I + NL      N +D I+L+ RG  +R  + T+ N+ SSRSH++  I    + K
Sbjct: 206 DQNSKISVTNLSYHRPENVQDVIDLVIRGNLNRSSSPTEANEVSSRSHSVLQIHVKQVLK 265

Query: 313 NHN--GEVFRV-SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA--D 367
           N +  G   ++ S ++++DLAGSE    +  +  R  E  +IN+SLL LG  IN+L    
Sbjct: 266 NFDDIGSTNQIDSTLSIIDLAGSERAITTKNRGIRLYEGANINKSLLALGNCINALCINK 325

Query: 368 KNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNK 425
           K+ HIP+R+SKLTRLL+ SLGGN KT +I  +SP+ ++ +ET +TL+YA +AK IK K
Sbjct: 326 KSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSLHYDETLNTLKYANRAKEIKTK 383

 Score = 71.2 bits (173), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 57/109 (52%), Gaps = 13/109 (11%)

Query: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 130
           +  DK+F   + Q  IF+    PL D  + G+N TV  YG T  GKTYT+ G        
Sbjct: 92  FIFDKLFDDDSTQEQIFEDTTRPLLDSVLDGFNGTVFAYGATGCGKTYTING-------- 143

Query: 131 LSDAAGIIPRILFKLFDTLETQDED-----YLVKCSFIELYNEELKDLL 174
            S+  GII R + +LF  +E   +D       +  S++E+YNE ++DLL
Sbjct: 144 TSEDPGIIFRTMNELFGKIEILLQDSNRSKIEISLSYLEIYNETIRDLL 192

>Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar to
           Ashbya gossypii ADR145C
          Length = 662

 Score =  125 bits (313), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 79/189 (41%), Positives = 115/189 (60%), Gaps = 7/189 (3%)

Query: 244 PRLINNKQQSLSEQSSA---IYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSS 300
           P+  + K+ SL+   S+   +Y+Q+     +++  + ++ +  G   R  +ST MN  SS
Sbjct: 196 PKKTSEKRTSLTIHESSTFGVYVQSATVISVSDGDELLHCIHLGESQRCKSSTDMNFESS 255

Query: 301 RSHTIFTIMLYKNHNGE-VFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLG 359
           RSH I  I L K  N E   + S + LVDLAGSE +S++ A     +EA  IN SL +LG
Sbjct: 256 RSHAIVKINLLKRDNLEGSIQKSDLFLVDLAGSEKVSKTNAVGATLEEAKKINLSLSSLG 315

Query: 360 RVINSLADKN---AHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYA 416
            VIN+L  K+    HIP+R+S+LTRLL+DSLGGN+KT LI   +  K N  ET +TL + 
Sbjct: 316 NVINALTQKDKKRTHIPYRDSQLTRLLRDSLGGNSKTTLILNCACDKSNEAETLTTLRFG 375

Query: 417 TKAKNIKNK 425
           ++AK I+NK
Sbjct: 376 SRAKQIENK 384

 Score = 90.9 bits (224), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 56/166 (33%), Positives = 92/166 (55%), Gaps = 18/166 (10%)

Query: 18  NITVSVRCRGRNEREIKAKSSVVVTVPDVT---GSNEVSINTTDELGITAQMNSKTYTVD 74
           N+ V VR +  +  E K  +  VV + + T    +N+ S  +T+  G+  +  S+++  D
Sbjct: 34  NVKVMVRLKPIDAPE-KQYNVAVVALDESTVEFPNNDTSPGSTN--GVQGESPSRSFHFD 90

Query: 75  KVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSDA 134
            VFG ++ Q  ++  +AE + D F  GYN T+L YG T +GK+YTM G          D 
Sbjct: 91  YVFGTNSTQDDVYDFVAEEMLDQFFTGYNSTILAYGQTGSGKSYTMFGP--------IDN 142

Query: 135 AGIIPRILFKLFDTL----ETQDEDYLVKCSFIELYNEELKDLLNE 176
            G+IPRI  ++F+ +     + D +Y+V  SF+E+Y E++ DLL E
Sbjct: 143 RGLIPRICHEIFERIGLLKSSADIEYVVSVSFLEIYLEKVYDLLGE 188

>Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON}
           (54983..56503) [1521 nt, 507 aa]
          Length = 506

 Score =  122 bits (306), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 106/191 (55%), Gaps = 22/191 (11%)

Query: 260 AIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYK-----NH 314
           ++YI+N+ E  ++N    I  ++ G ++R   ST MN  SSRSH I +I + +     N 
Sbjct: 188 SMYIENITEIEVSNIDQMIKCVKMGFRNRTTRSTNMNVNSSRSHAIVSITIKRTDIDLNT 247

Query: 315 NGEVFRVSKMNLVDLAGSE-NISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK----- 368
           N  +   S    VDLAGSE + +     N R KE  SIN+SL TL RV+ SL  +     
Sbjct: 248 NSSIISDSICRFVDLAGSERSTATQNCHNDRLKEGNSINKSLSTLRRVLTSLKKREELKY 307

Query: 369 ---------NAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKA 419
                    N  +PFRES LT +L+D+LGGN+KT +IA ISP   N EE++STL YA  A
Sbjct: 308 NSNSNSSAHNIVVPFRESLLTWILKDNLGGNSKTCIIACISPT--NFEESASTLRYADIA 365

Query: 420 KNIKNKPQLGT 430
           + IK    + T
Sbjct: 366 QTIKTNSIINT 376

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 60/117 (51%), Gaps = 18/117 (15%)

Query: 74  DKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSD 133
           D+ FG    QS  +K        D + GYNC +L YG T +GKTYTM G+ +      +D
Sbjct: 64  DEGFGKINSQSEFYKGSINHFVKDALNGYNCCILAYGQTGSGKTYTMMGESK------ND 117

Query: 134 AAGIIPRILFKLFDTLE----------TQDEDYLVKCSFIELYNEELKDLL--NEPQ 178
             G+IPR    LF  +E          +Q  +Y V CS  E+YNE++ DLL  NE Q
Sbjct: 118 TRGVIPRFCEDLFHEIESIKIKDSSDLSQRSEYKVVCSIFEIYNEQIIDLLEMNEVQ 174

>Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar to
           Ashbya gossypii ACR228C - AER441C - ADR145C
          Length = 478

 Score =  120 bits (302), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 71/174 (40%), Positives = 110/174 (63%), Gaps = 7/174 (4%)

Query: 262 YIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYK----NHNGE 317
           YI+ L +  + + ++ +  ++ G   R VA T +N+ SSRSH I TI + +    +    
Sbjct: 173 YIEGLSDRIVNSCEELLKCIEEGSARRSVAGTAVNENSSRSHAICTINIQQTEIDSFGDT 232

Query: 318 VFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-DKNAHIPFRE 376
           V RVS + LVDLAGSE    S  +++R KE  +IN+SL+TL RV+  L+ +K   +P+RE
Sbjct: 233 VERVSSIKLVDLAGSERTKVSKTKDERFKEGTNINKSLMTLRRVVTMLSNNKVTGVPYRE 292

Query: 377 SKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGT 430
           S LTR+L+D+L GN+ T ++A ISP   + EE+ STL YA+ AK+++ +  L T
Sbjct: 293 SLLTRVLRDNLDGNSITCILACISPC--DYEESISTLRYASTAKHVRTEAHLNT 344

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 89/182 (48%), Gaps = 28/182 (15%)

Query: 18  NITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVDKVF 77
           NI V++R R +  RE    S     V     SNE+++   +   +   +   T+  D+VF
Sbjct: 4   NIKVAIRIRDKISRETSRPS-----VIKRKTSNEITLQKDNTANVITTVE-HTFYFDQVF 57

Query: 78  GPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSDAAGI 137
             S++Q  I+ ++A       ++GY+  V+ YG T  GKTYTM G E+          GI
Sbjct: 58  DESSNQKQIYHELAREYILKALEGYHTCVIAYGQTGAGKTYTMMGTEQ--------EPGI 109

Query: 138 IPRI---LFKLFDTL--ETQDEDYL----VKCSFIELYNEELKDLLNEPQESGVIKKLRI 188
           IP +   LFK+ D    E  DED L    V  S+ ++YNE++ D+L     SG    LR+
Sbjct: 110 IPLVSHELFKIIDMCQDEGPDEDALVHFKVTVSYFQIYNEQIYDML-----SGGCNVLRV 164

Query: 189 FD 190
            D
Sbjct: 165 RD 166

>Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]
           {ON} YGL216W (KIP3) - 1:1 [contig 188] FULL
          Length = 819

 Score =  123 bits (308), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 69/174 (39%), Positives = 108/174 (62%), Gaps = 9/174 (5%)

Query: 261 IYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIML-YKNHNGEV- 318
           I + NL    ++  +D ++L+ +G  +R  ++T  N+ SSRSH +  + +  +N   E+ 
Sbjct: 241 ITVANLSHHPLSTVEDVMDLVIKGNTNRTTSATDANETSSRSHAVLQVHITQRNRTAELT 300

Query: 319 --FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----DKNAH 371
              + + ++L+DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L          H
Sbjct: 301 EDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGRKRGGYH 360

Query: 372 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNK 425
           +P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YAT+AK IK K
Sbjct: 361 VPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSNHYDETLNTLKYATRAKEIKTK 414

 Score = 68.2 bits (165), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 61/110 (55%), Gaps = 11/110 (10%)

Query: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 130
           +  D+VF   + Q  +++    PL D  + G+N TV  YG T  GKTYT++G        
Sbjct: 125 FVFDRVFDMDSSQIEVYEATTRPLLDSVLDGFNGTVFAYGATGCGKTYTVSG-------- 176

Query: 131 LSDAAGIIPRILFKLFDTL-ETQD-EDYLVKCSFIELYNEELKDLLNEPQ 178
             +  GII   + +LF  + E QD + + +  S++E+YNE ++DLL EP+
Sbjct: 177 TPENPGIIFLTMQELFAKMEELQDTKRFELSASYLEIYNETIRDLL-EPE 225

>TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {ON}
           Anc_3.479 YPR141C
          Length = 739

 Score =  122 bits (307), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 102/181 (56%), Gaps = 13/181 (7%)

Query: 256 EQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYK-NH 314
           +QS   Y+ N++ F I N  D I L+ +    R  +ST +N  SSRSH IF I L   NH
Sbjct: 557 DQSKITYVTNIKRFKIENISDTIGLINKSKIKRMTSSTGLNSHSSRSHGIFIIYLEGYNH 616

Query: 315 NGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL--------- 365
                 +SK+NLVDLAGSE I+ S  Q  R KE  SIN+SL  LG VI++L         
Sbjct: 617 KTNEKCISKLNLVDLAGSERINFSKVQGDRLKETQSINKSLSCLGDVIHALNRGNKNHLN 676

Query: 366 ---ADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNI 422
                K  HIPFR SKLT LL+ SL G++KT +   +S  + +  ET ++L +ATK  N 
Sbjct: 677 SNDLQKTRHIPFRNSKLTYLLKYSLIGDSKTLMFVNVSSNEAHLNETINSLRFATKVNNT 736

Query: 423 K 423
           K
Sbjct: 737 K 737

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 64/128 (50%), Gaps = 18/128 (14%)

Query: 67  NSKTYTV--DKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDE 124
           N+ TY+   D VF      S +F +I E L    + GYN  +  YG T +GKTYTM    
Sbjct: 438 NNATYSFEFDHVFKQDEGNSEVFNEI-EQLIQSALDGYNVCIFAYGQTGSGKTYTM---- 492

Query: 125 RLYDGELSDAAGIIP---RILFKLFDTLETQDEDYLVKCSFIELYNEELKDLL--NEPQE 179
                 L+   G+IP   + +F   D+L+    +Y V C FIELYNE + DL   N P +
Sbjct: 493 ------LNPNDGVIPMTIKYIFNSMDSLKKNGWEYNVSCEFIELYNENIIDLFRDNGPTK 546

Query: 180 SGVIKKLR 187
             +  ++R
Sbjct: 547 DSISHEIR 554

>Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  122 bits (306), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 69/173 (39%), Positives = 104/173 (60%), Gaps = 8/173 (4%)

Query: 261 IYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHN----G 316
           I + NL   H T  +D +NL+ +G  +R  + T+ N+ SSRSH +  I + + +      
Sbjct: 269 IKVANLSYHHPTTVEDVMNLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLT 328

Query: 317 EVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL----ADKNAHI 372
                + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L      +  HI
Sbjct: 329 SQHTFATLSVIDLAGSERAAATRNRGLRLHEGANINRSLLALGNCINALCLNDGSRTCHI 388

Query: 373 PFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNK 425
           P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 389 PYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 62/106 (58%), Gaps = 10/106 (9%)

Query: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 130
           +  DK+F  ++ Q+ ++K+   PL D  + GYN TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQTQVYKETTSPLLDSVLDGYNSTVFAYGATGCGKTYTVSGT------- 205

Query: 131 LSDAAGIIPRILFKLFDTL-ETQDE-DYLVKCSFIELYNEELKDLL 174
                G+I   + +LF+ + + +DE ++ +  S++E+YNE ++DLL
Sbjct: 206 -PSQPGVIFLAMEELFNKIDDLKDEKNFEISLSYLEIYNERIRDLL 250

>SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 809

 Score =  122 bits (306), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/188 (38%), Positives = 112/188 (59%), Gaps = 9/188 (4%)

Query: 247 INNKQQSLSEQS-SAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTI 305
           I++K+  + E S   I + NL        +D ++L+ RG  +R  + T  N+ SSRSH +
Sbjct: 237 ISSKKLVIREDSIKGISVANLSHHTPQTVQDVMDLVVRGNMNRTTSPTDANETSSRSHAV 296

Query: 306 FTI-MLYKNHNGEVFRV---SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRV 361
             I ++ KN   E+      + ++++DLAGSE  S +  + +R  E  +IN+SLL LG  
Sbjct: 297 LQINVVQKNRTAELSEAHTFATLSIIDLAGSERASATKNRGERLHEGANINRSLLALGNC 356

Query: 362 INSLA----DKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYAT 417
           IN+L         H+P+R+SKLTRLL+ SLGGN KT +I  I+P+  + +ET +TL+YA 
Sbjct: 357 INALCVSGRRSTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCIAPSSAHYDETLNTLKYAN 416

Query: 418 KAKNIKNK 425
           +AK IK K
Sbjct: 417 RAKEIKTK 424

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 58/107 (54%), Gaps = 10/107 (9%)

Query: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 130
           +  DK+F   A Q+ +++    PL D  + G+N TV  YG T  GKT+T++G        
Sbjct: 136 FVFDKLFDEDATQTEVYESTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISG-------- 187

Query: 131 LSDAAGIIPRILFKLFDTLE--TQDEDYLVKCSFIELYNEELKDLLN 175
             +  G+I   + +LF  +E     + + +  S++E+YNE ++DLL+
Sbjct: 188 TPEQPGVIFLTMQELFQRIEDLKDSKHFDLTLSYLEIYNESIRDLLS 234

>KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 819

 Score =  121 bits (304), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 106/174 (60%), Gaps = 9/174 (5%)

Query: 261 IYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIML-YKNHNGEV- 318
           I + NL    +   +D ++L+ +G  +R  ++T  N+ SSRSH +  + +  KN   E+ 
Sbjct: 241 ITVANLSHHPLFTVEDVMDLVVKGNINRTTSATDANETSSRSHAVLQVHITQKNRTAELT 300

Query: 319 --FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA-----H 371
              + + ++L+DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L          H
Sbjct: 301 EDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCAGGKRGGGFH 360

Query: 372 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNK 425
           +P+R+SKLTRLL+ SLGGN KT +I  ISP   + +ET +TL+YAT+AK IK K
Sbjct: 361 VPYRDSKLTRLLKFSLGGNCKTVMIVCISPTSNHYDETLNTLKYATRAKEIKTK 414

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 67/133 (50%), Gaps = 16/133 (12%)

Query: 53  SINTTDELGITAQMNSKT-----YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVL 107
           SI T         MNS+      +  D+VF   A Q  +++    PL D  + G+N TV 
Sbjct: 102 SITTPPPSHGPRSMNSRRSGEQKFVFDRVFDMHASQEEVYEATTRPLLDSVLDGFNSTVF 161

Query: 108 VYGMTSTGKTYTMTGDERLYDGELSDAAGIIPRILFKLFDTLET--QDEDYLVKCSFIEL 165
            YG T  GKTYT++G         ++  GII   + +LF  +E     + + +  S++E+
Sbjct: 162 AYGATGCGKTYTVSGT--------AENPGIIFLTMQELFAKMEQLKDTKKFELTASYLEI 213

Query: 166 YNEELKDLLNEPQ 178
           YNE ++DLL EP+
Sbjct: 214 YNESIRDLL-EPE 225

>ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {ON}
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 778

 Score =  121 bits (304), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 111/181 (61%), Gaps = 9/181 (4%)

Query: 254 LSEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKN 313
           L + + +I + NL  ++    +D ++L+ +G  +R  ++T  N+ SSRSH +  I + ++
Sbjct: 237 LEDSNESIRVSNLSHYNPQKVEDVMDLVIKGNMNRTTSATDANEASSRSHAVLQIHIMQH 296

Query: 314 HNGEVFR----VSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA--- 366
           +     +     + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L    
Sbjct: 297 NRTADLKSDHTFATLSIIDLAGSERAATTKNRGNRLYEGANINRSLLALGNCINALCLND 356

Query: 367 --DKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKN 424
              ++ H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK 
Sbjct: 357 GTRRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLKYANRAKEIKT 416

Query: 425 K 425
           K
Sbjct: 417 K 417

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 66/122 (54%), Gaps = 13/122 (10%)

Query: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 130
           +  D++F   + Q  +++    PL D  + G+N TV  YG T  GKTYT++G        
Sbjct: 128 FVFDRLFDVDSTQKDVYESTMIPLLDSVLDGFNGTVFAYGATGCGKTYTISGS------- 180

Query: 131 LSDAAGIIPRILFKLFDTLET--QDEDYLVKCSFIELYNEELKDLLNEPQESGVIKKLRI 188
             +  GII + + +LF+ +E     + + +  SF+E+YNE ++DLL  P+ S   KKL I
Sbjct: 181 -PENPGIIFQAMQELFNRIENLKDTKHFELSLSFLEIYNESIRDLLC-PETSS--KKLVI 236

Query: 189 FD 190
            +
Sbjct: 237 LE 238

>Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  121 bits (304), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 69/173 (39%), Positives = 105/173 (60%), Gaps = 8/173 (4%)

Query: 261 IYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHN----G 316
           I + NL   H T  +D ++L+ +G  +R  + T+ N+ SSRSH++  I + + +      
Sbjct: 269 IKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHSVLQIHIMQTNKLVDLT 328

Query: 317 EVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL----ADKNAHI 372
                + ++++DLAGSE  S +  +  R  E  +IN+SLL LG  IN+L      +  HI
Sbjct: 329 SQHTFATLSIIDLAGSERASATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRTCHI 388

Query: 373 PFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNK 425
           P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 389 PYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 66/119 (55%), Gaps = 12/119 (10%)

Query: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 130
           +  DK+F  ++ Q  ++K+   PL D  + G+N TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQVRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 131 LSDAAGIIPRILFKLFDTL-ETQDE-DYLVKCSFIELYNEELKDLLNE--PQESGVIKK 185
                GII   + +LF+ + + +DE ++ +  S++E+YNE + DLL    P +  VI++
Sbjct: 206 -PSQPGIIFLAMEELFNKISDLKDEKNFEISLSYLEIYNERISDLLRPETPSKRLVIRE 263

>Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  121 bits (304), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 106/175 (60%), Gaps = 8/175 (4%)

Query: 259 SAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHN--- 315
           S I + NL   H T  +D ++L+ +G  +R  + T+ N+ SSRSH +  I + + +    
Sbjct: 267 SHIKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVD 326

Query: 316 -GEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL----ADKNA 370
                  + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L      ++ 
Sbjct: 327 LTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRSC 386

Query: 371 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNK 425
           HIP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 387 HIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 68/119 (57%), Gaps = 12/119 (10%)

Query: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 130
           +  DK+F  ++ QS ++K+   PL D  + G+N TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQSRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 131 LSDAAGIIPRILFKLFDTL-ETQDE-DYLVKCSFIELYNEELKDLLNE--PQESGVIKK 185
                GII   + +LF+ + + +DE ++ +  S++E+YNE ++DLL    P +  VI++
Sbjct: 206 -PSQPGIIFLAMEELFNKIADLRDEKNFEISLSYLEIYNERIRDLLKPETPSKRLVIRE 263

>KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528
           YGL216W
          Length = 723

 Score =  119 bits (299), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 104/174 (59%), Gaps = 9/174 (5%)

Query: 261 IYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHN----G 316
           I + NL      + +D ++L+ RG  +R  + T+ N  SSRSH +  I + + +      
Sbjct: 259 ISVSNLSYHSPRSVQDVLDLVIRGNDNRTTSPTEANSVSSRSHAVLQIHIMQRNKLVDLK 318

Query: 317 EVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD-----KNAH 371
           E      ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L       +N H
Sbjct: 319 EHQTFGTLSIIDLAGSERAAATKNRGRRLHEGANINRSLLALGNCINALCSNDGSHRNQH 378

Query: 372 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNK 425
           +P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 379 VPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSAHYDETLNTLKYANRAKEIKTK 432

 Score = 67.8 bits (164), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 64/127 (50%), Gaps = 12/127 (9%)

Query: 63  TAQMNSKTYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTG 122
           T   +   +  DK+F     Q  +++     L D  + G+N TV  YG T  GKTYT++G
Sbjct: 135 TGSADETKFVFDKLFDTDVSQEDVYRGTTSTLLDSVLDGFNGTVFAYGATGCGKTYTVSG 194

Query: 123 DERLYDGELSDAAGIIPRILFKLFDTLE--TQDEDYLVKCSFIELYNEELKDLLNE--PQ 178
                     +  GII R + +LF  ++     +D+ +  SF+E+YNE + DLL+   P 
Sbjct: 195 TR--------ENPGIIFRTMEELFVKMDALAGTKDFELTVSFLEIYNETIHDLLSPDTPP 246

Query: 179 ESGVIKK 185
           +  VI++
Sbjct: 247 QKLVIRE 253

>NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {ON}
           Anc_3.528
          Length = 868

 Score =  120 bits (300), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 112/184 (60%), Gaps = 15/184 (8%)

Query: 256 EQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHN 315
           ++ S I + NL   +  + +D I+L+ RG  +R  +ST+ N+ SSRSH +  I + +  N
Sbjct: 302 DKDSKISVSNLSYHYPKSVQDVIDLVIRGNINRSTSSTEANEVSSRSHAVLQIHIMQT-N 360

Query: 316 GEVFRVSK-----MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA---- 366
            ++   S+     ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L     
Sbjct: 361 TKIDLTSEHTFATLSIIDLAGSERAAATKNRGERLYEGANINKSLLALGNCINALCIPTN 420

Query: 367 -----DKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKN 421
                +   HIP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK 
Sbjct: 421 NTRRRNIRYHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKE 480

Query: 422 IKNK 425
           IK K
Sbjct: 481 IKTK 484

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 70/126 (55%), Gaps = 12/126 (9%)

Query: 64  AQMNSKTYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGD 123
           A+ N   +  DK+F  ++ Q  ++      L D  + G+N TV  YG T  GKTYT++G 
Sbjct: 184 AKKNEMKFVFDKIFDENSSQDEVYLGTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSGT 243

Query: 124 ERLYDGELSDAAGIIPRILFKLFDTLE-TQDED-YLVKCSFIELYNEELKDLL--NEPQE 179
           +        +  GII R++ +LF+ +E  +DE  + +  S++E+YNE + DLL  + P +
Sbjct: 244 Q--------ENPGIIFRVMQELFERMEDLKDEKTFQLSISYLEIYNEMIYDLLKPDTPSK 295

Query: 180 SGVIKK 185
             +I++
Sbjct: 296 KLIIRE 301

>TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa]
           {ON} Anc_3.528 YGL216W
          Length = 733

 Score =  119 bits (299), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 66/174 (37%), Positives = 106/174 (60%), Gaps = 9/174 (5%)

Query: 261 IYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTI-MLYKNHNGEV- 318
           I + NL        +D ++L+  G  +R  ++T  N+ SSRSH +  I ++  +   E+ 
Sbjct: 245 ISVANLSHHRPKTVEDVMDLVVLGNTNRTTSATDANETSSRSHAVLQINIVQSSRTAEIT 304

Query: 319 --FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----DKNAH 371
                +K++++DLAGSE  + +  + +R +E  +IN+SLL LG  IN+L       +  H
Sbjct: 305 SDHTFAKLSIIDLAGSERAASTKNRGERLQEGANINRSLLALGNCINALCISDGTRRTCH 364

Query: 372 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNK 425
           +P+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK IK K
Sbjct: 365 VPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIKTK 418

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 64/120 (53%), Gaps = 13/120 (10%)

Query: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 130
           +  DK+F  +A Q  ++      L D  + G+N TV  YG T  GKTYT++G        
Sbjct: 129 FVFDKLFDENATQEEVYSGTTSELLDAVLDGFNGTVFAYGATGCGKTYTVSGT------- 181

Query: 131 LSDAAGIIPRILFKLFDTLETQDED--YLVKCSFIELYNEELKDLLNEPQESGVIKKLRI 188
             +  G+I   + +LF  +E  ++   + +  S++E+YNE ++DLL+ P+ S   KKL I
Sbjct: 182 -PERPGVIFLAMQELFARMEELEDTRKFEISVSYLEIYNETIRDLLS-PEMSP--KKLVI 237

>CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216w KIP3
           kinesin-related protein required for nuclear migration
          Length = 705

 Score =  119 bits (297), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 68/175 (38%), Positives = 105/175 (60%), Gaps = 10/175 (5%)

Query: 261 IYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTI-MLYKNHNGEV- 318
           I + NL +   T  ++ ++L+ RG  +R  + T+ N+ SSRSH +  I ++ KN   ++ 
Sbjct: 272 ITVANLSQHFPTTVQEVMDLVIRGNFNRTTSPTEANEVSSRSHAVLQIHIVQKNRTPDIK 331

Query: 319 --FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA------DKNA 370
                  ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L           
Sbjct: 332 EEHTFGTLSIIDLAGSERAAATKNRGARLHEGANINRSLLALGNCINALCINGNDERPRC 391

Query: 371 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNK 425
           H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 392 HVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 446

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 62/119 (52%), Gaps = 12/119 (10%)

Query: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 130
           +  DK+F   A Q  +++     L D  + G+N TV  YG T  GKTYT++G        
Sbjct: 156 FVFDKLFDTDATQREVYQSTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSG-------- 207

Query: 131 LSDAAGIIPRILFKLFDTLE--TQDEDYLVKCSFIELYNEELKDLLNE--PQESGVIKK 185
             +  GI+ + + +LF  +E     + + +  SF+E+YNE ++DLL    P +  +I++
Sbjct: 208 TPENPGIVFQAMEELFQKMEDLKDTKSFQISLSFLEIYNERIRDLLKPETPSQKLIIRE 266

>ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1
          Length = 478

 Score =  116 bits (291), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 119/203 (58%), Gaps = 13/203 (6%)

Query: 260 AIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHN---- 315
           + +++ L+E  + N ++ I+ + +G ++R V ST MN  SSRSH IF I + +       
Sbjct: 177 STFVEGLEEIAVHNVEELISCIHKGNENRTVRSTNMNQESSRSHAIFHISVNQKETHKKT 236

Query: 316 GEVFRV-SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD----KNA 370
           G V    S   LVDLAGSE +  + A  +  +E  SIN+SL  LGRVI+ LA+    ++ 
Sbjct: 237 GTVVECHSTCKLVDLAGSERLGSAAADGKIRQEGTSINKSLSILGRVISLLAEGDRQRSQ 296

Query: 371 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGT 430
            IP+RES LT +L+++LGGN+ T L+A +SP   N  E+ STL YA+  K +K    + +
Sbjct: 297 MIPYRESALTWILKENLGGNSNTCLVACVSPE--NYYESLSTLRYASLTKKVKTNATINS 354

Query: 431 LVMKDIL--VKNITRELAKIKSD 451
           +   + +  +K   REL K+ +D
Sbjct: 355 MSHIEQMEELKAKLRELQKMIND 377

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 65/121 (53%), Gaps = 21/121 (17%)

Query: 68  SKTYTVDKVFGPS----ADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGD 123
           +K +  D  FG +     DQS+I++ +        ++GYN  +L YG T +GKT+TM G+
Sbjct: 49  AKEFRYDHCFGSTDSVDRDQSIIYESLVRGYVLHTLEGYNSCILAYGQTGSGKTFTMMGE 108

Query: 124 ERLYDGELSDAAGIIPRI---LFKLFDTLETQDE------DYLVKCSFIELYNEELKDLL 174
           +           GI+PR    LF++F      D+      D+ VKCSF E+YNE++ DLL
Sbjct: 109 K--------GNEGIVPRFCRELFEVFHMCHQDDQESDIITDFQVKCSFFEIYNEQVIDLL 160

Query: 175 N 175
           +
Sbjct: 161 S 161

>Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON}
           (11134..13554) [2421 nt, 807 aa]
          Length = 806

 Score =  119 bits (297), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 67/178 (37%), Positives = 108/178 (60%), Gaps = 13/178 (7%)

Query: 259 SAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNH---- 314
           S I + NL        +D ++L+ +G  +R  ++T  N+ SSRSH +  I + + +    
Sbjct: 260 SKISVANLSHHRPKTVQDVMDLIIKGNINRTTSATDANETSSRSHAVLQIHISQTNRTVD 319

Query: 315 --NGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----D 367
             +  VF  + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L       
Sbjct: 320 LTSSHVF--ATLSIIDLAGSERAASTKNRGERLYEGANINKSLLALGNCINALCLNDGTR 377

Query: 368 KNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNK 425
           ++ H+P+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK IK K
Sbjct: 378 RSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIKTK 435

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 63/119 (52%), Gaps = 12/119 (10%)

Query: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 130
           +  DK+F   + Q  +++     L D  + G+N TV  YG T  GKTYT++G        
Sbjct: 146 FIFDKLFNEGSSQLAVYRSTTSLLLDSVLDGFNGTVFAYGATGCGKTYTISGT------- 198

Query: 131 LSDAAGIIPRILFKLFDTLET--QDEDYLVKCSFIELYNEELKDLLNE--PQESGVIKK 185
             +  GII   + +LF  +E     +++ +  S++E+YNE ++DLLN   P +  VI++
Sbjct: 199 -PEQPGIIFLAMEELFQKIENIKDTKNFELTLSYLEIYNESIRDLLNPDTPSKKLVIRE 256

>NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}
           Anc_3.528
          Length = 784

 Score =  118 bits (296), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 108/175 (61%), Gaps = 10/175 (5%)

Query: 261 IYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTI-MLYKNHNGEV- 318
           I + NL   +    ++ I+L+ +G  +R  + T+ N+ SSRSH +  I ++  N   ++ 
Sbjct: 267 ISVSNLSYHNPQTVQEVIDLVIKGNINRTTSPTEANEVSSRSHAVLQIHIMQTNRTADLT 326

Query: 319 --FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA------DKNA 370
                + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L       +++ 
Sbjct: 327 SEHTFATLSIIDLAGSERAAATKNRGERLYEGANINRSLLALGNCINALCLTDGGTNRSC 386

Query: 371 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNK 425
           HIP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 387 HIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 58/106 (54%), Gaps = 10/106 (9%)

Query: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 130
           +  DK+F   A Q  +++     L D  + G+N TV  YG T  GKTYT++G        
Sbjct: 151 FVFDKLFDQDASQETVYQSTTSGLLDSVLDGFNGTVFAYGATGCGKTYTVSGT------- 203

Query: 131 LSDAAGIIPRILFKLFDTLE--TQDEDYLVKCSFIELYNEELKDLL 174
             +  GII R++ +LF+ +E     + + +  S++E+YNE ++DLL
Sbjct: 204 -PEQPGIIFRVMQELFERMEDLKDTKRFELSLSYLEIYNETIRDLL 248

>YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}
           KIP3Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 805

 Score =  118 bits (296), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 67/173 (38%), Positives = 104/173 (60%), Gaps = 8/173 (4%)

Query: 261 IYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHN----G 316
           I + NL   H    +D ++L+ +G  +R  + T+ N+ SSRSH +  I + + +      
Sbjct: 269 IKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLT 328

Query: 317 EVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL----ADKNAHI 372
                + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L      ++ HI
Sbjct: 329 SQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRSCHI 388

Query: 373 PFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNK 425
           P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 389 PYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 68/119 (57%), Gaps = 12/119 (10%)

Query: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 130
           +  DK+F  ++ Q+ ++K+   PL D  + G+N TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 131 LSDAAGIIPRILFKLFDTL-ETQDE-DYLVKCSFIELYNEELKDLLNE--PQESGVIKK 185
                GII   + +LF+ + + +DE D+ +  S++E+YNE ++DLL    P +  VI++
Sbjct: 206 -PSQPGIIFLAMEELFNKITDLKDEKDFEISLSYLEIYNERIRDLLKPETPSKRLVIRE 263

>KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa]
           {ON} Anc_3.479 YPR141C
          Length = 764

 Score =  116 bits (291), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 90/143 (62%), Gaps = 3/143 (2%)

Query: 280 LLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYK-NHNGEVFRVSKMNLVDLAGSENISRS 338
           +L+R  K R  AST  N+ SSRSH+IF I L+  NH  +      +NLVDLAGSE +  S
Sbjct: 612 VLKRATKLRSTASTLSNEHSSRSHSIFIIELHGVNHKTKEESCGVLNLVDLAGSERVHSS 671

Query: 339 GAQNQRAKEAGSINQSLLTLGRVINSLADKNA--HIPFRESKLTRLLQDSLGGNTKTALI 396
               +R +E  +IN+SL  LG VI +L DKN   HIPFR SKLT LLQ SL GN+KT + 
Sbjct: 672 QVTGERLRETQNINRSLSCLGDVIYALNDKNTKRHIPFRNSKLTYLLQYSLVGNSKTLMF 731

Query: 397 ATISPAKINAEETSSTLEYATKA 419
             ISP+  +  ET ++L +A+K 
Sbjct: 732 VNISPSSSHINETINSLRFASKV 754

 Score = 71.6 bits (174), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 55/108 (50%), Gaps = 14/108 (12%)

Query: 70  TYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDG 129
           ++  DK+F        +FK++ + L    + GYN  +  YG T +GKTYTM         
Sbjct: 471 SFKFDKIFDTGESNDEVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM--------- 520

Query: 130 ELSDAAGIIPRILFKLFDTLETQDE---DYLVKCSFIELYNEELKDLL 174
            L    G+IP  +  +FD +E   E   +Y + C F+E+YNE + DLL
Sbjct: 521 -LHPNDGVIPATISHIFDWVENLKERGWEYKISCQFVEIYNENIVDLL 567

>AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL216W
           (KIP3)
          Length = 818

 Score =  116 bits (290), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 103/175 (58%), Gaps = 8/175 (4%)

Query: 259 SAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHNGEV 318
           S   + NL        +D ++L+ RG  +R  + T  N+ SSRSH +  + + ++     
Sbjct: 242 STTTVANLSYHTPETVEDVMDLVIRGNVNRTTSPTDANETSSRSHAVLQVHVVQSSRTVD 301

Query: 319 FRVSKM----NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN----A 370
            +  KM    +++DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L         
Sbjct: 302 LKEDKMYATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCINALCMTGRRAVC 361

Query: 371 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNK 425
           H+P+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK+IK K
Sbjct: 362 HVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKDIKTK 416

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 63/119 (52%), Gaps = 12/119 (10%)

Query: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 130
           +  DK+F   A Q  +F+    PL D  + G+N TV  YG T  GKT+T++G        
Sbjct: 128 FMFDKLFDVDASQQDVFQCTTMPLLDSILDGFNGTVFAYGATGCGKTFTISG-------- 179

Query: 131 LSDAAGIIPRILFKLFDTLET--QDEDYLVKCSFIELYNEELKDLL--NEPQESGVIKK 185
             D+ GII   + +LF  +      + + +  S++E+YNE ++DLL  + P +  +I++
Sbjct: 180 TPDSPGIIFLTMQELFQRINNLKDTKTFELTVSYLEIYNETIRDLLEPDTPSQKLIIRE 238

>Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar to
           Ashbya gossypii AER441C
          Length = 833

 Score =  114 bits (285), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 103/171 (60%), Gaps = 8/171 (4%)

Query: 263 IQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHNGEVFRVS 322
           + NL      + +D ++L+ +G  +R  + T  N+ SSRSH +  I + ++      +  
Sbjct: 248 VANLSYHTPRSVQDVMDLVIKGNINRTTSPTDANETSSRSHAVLQIHVVQSSRSVDLKED 307

Query: 323 K----MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN----AHIPF 374
           K    ++++DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L         H+P+
Sbjct: 308 KTYATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCINALCMTGRRTYCHVPY 367

Query: 375 RESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNK 425
           R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK+IK K
Sbjct: 368 RDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKDIKTK 418

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 62/119 (52%), Gaps = 12/119 (10%)

Query: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 130
           +  DK+F   A Q  +F     PL D  I G+N TV  YG T  GKT+T++G        
Sbjct: 130 FMFDKLFDVEATQQDVFLGTTRPLLDSIIDGFNGTVFAYGATGCGKTFTISG-------- 181

Query: 131 LSDAAGIIPRILFKLFDTLET--QDEDYLVKCSFIELYNEELKDLL--NEPQESGVIKK 185
             +  GII   + +LF  +E     + + +  S++E+YNE ++DLL  + P +  +I++
Sbjct: 182 TPENPGIIFLTMQELFQRIENLKDTKTFQLTVSYLEIYNEMIRDLLEPDTPSQKLIIRE 240

>KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 769

 Score =  114 bits (284), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 64/174 (36%), Positives = 107/174 (61%), Gaps = 10/174 (5%)

Query: 262 YIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYK-NHNGEVFR 320
           ++ NL +    N ++ ++L+ +G  +R  + T  N+ SSRSH +  I + + N   ++ +
Sbjct: 241 FVSNLSKHSPENVEEVMDLVIKGNMNRTTSPTDANETSSRSHAVLQIHVAQMNRTADIKQ 300

Query: 321 ---VSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN------AH 371
               + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L   +       H
Sbjct: 301 DQTFATLSIIDLAGSERAAVTKNRGERLLEGANINRSLLALGNCINALCVSSTRTGFSCH 360

Query: 372 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNK 425
           +P+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK IK K
Sbjct: 361 VPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSGHYDETLNTLKYANRAKEIKTK 414

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 58/107 (54%), Gaps = 10/107 (9%)

Query: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 130
           +  D++F     Q  +++    PL D  + G+N TV  YG T  GKT+T++G        
Sbjct: 124 FIFDRIFDMDVTQQEVYENTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISGT------- 176

Query: 131 LSDAAGIIPRILFKLFDTLET--QDEDYLVKCSFIELYNEELKDLLN 175
            S+  GII   + +LF  +E     + + ++ SF+E+YNE++ DLL+
Sbjct: 177 -SEQPGIIFLTMQELFIRMEQLKDTKKFQLQLSFLEIYNEQIHDLLD 222

>Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}
           complement(87351..89429) [2079 nt, 693 aa]
          Length = 692

 Score =  113 bits (283), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 99/159 (62%), Gaps = 7/159 (4%)

Query: 271 ITNAKDGIN-LLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHN--GEVFRVSKMNLV 327
           I  +KD ++ L+++  K R  A+T  N+ SSRSH+IF I L  ++N  GE      +NLV
Sbjct: 529 ILKSKDSVDFLIKKATKLRATATTAANERSSRSHSIFIIHLRGSNNITGES-SYGILNLV 587

Query: 328 DLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPFRESKLTRLLQ 384
           DLAGSE ++ S  +  R +E  +IN+SL  LG VI++L   +A   HIPFR SKLT LLQ
Sbjct: 588 DLAGSERLNSSQVEGARLRETQNINKSLSCLGDVIHALGSSDASKRHIPFRNSKLTYLLQ 647

Query: 385 DSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIK 423
            SL GN+KT +   ISP +   +ET ++L +A+K    K
Sbjct: 648 YSLTGNSKTLMFVNISPTQQQIQETLNSLRFASKVNTTK 686

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 56/109 (51%), Gaps = 14/109 (12%)

Query: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 130
           +  D++F        +F +I + L    + GYN  +  YG T +GKT+TM          
Sbjct: 397 FQFDRIFDQHEVNKDVFDEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM---------- 445

Query: 131 LSDAAGIIPRILFKLFD---TLETQDEDYLVKCSFIELYNEELKDLLNE 176
           L+   G+IP  +  +FD   +L+ +  +Y V C F+E+YNE + DLL E
Sbjct: 446 LNPNDGMIPATIDHIFDWTDSLKERGWEYEVSCQFVEIYNENIIDLLRE 494

>CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {ON}
           similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141c KAR3 kinesin-related protein
          Length = 692

 Score =  113 bits (282), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 104/172 (60%), Gaps = 12/172 (6%)

Query: 264 QNLQEFHITN-------AKDGIN-LLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHN 315
           Q L+  +ITN       ++D ++ +L+R  K R  AST  N+ SSRSH+IF I L   + 
Sbjct: 516 QELKTTYITNITTCVLDSRDTVDKVLKRANKLRSTASTAANEHSSRSHSIFIIHLEGKNE 575

Query: 316 GEVFRVSK-MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA---H 371
           G   +    +NLVDLAGSE ++ S    +R +E  SIN+SL  LG VI++L   +    H
Sbjct: 576 GTGEKSQGILNLVDLAGSERLNSSMVVGERLRETQSINKSLSCLGDVIHALNSPDGQKRH 635

Query: 372 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIK 423
           IPFR SKLT LLQ SL G++KT +   ISPA ++  ET ++L +A+K  N K
Sbjct: 636 IPFRNSKLTYLLQYSLIGSSKTLMFVNISPAALHLNETINSLRFASKVNNTK 687

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 72/171 (42%), Gaps = 34/171 (19%)

Query: 15  QELNITVSVRCRGR--------NEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQM 66
           QEL   + V CR R        N   IK     V    D  G   ++IN  +   I    
Sbjct: 345 QELRGNIRVYCRIRPPLPHEDDNIEHIK-----VQPFDDDNGDQGMTINRGNSQVIP--- 396

Query: 67  NSKTYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERL 126
               +  DK+F        IFK++ + L    + GYN  +  YG T +GKTYTM      
Sbjct: 397 ----FKFDKIFDQQETNDEIFKEVGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM------ 445

Query: 127 YDGELSDAAGIIPRIL---FKLFDTLETQDEDYLVKCSFIELYNEELKDLL 174
               L+   GI+P  +   F   D L  +   Y V C FIE+YNE + DLL
Sbjct: 446 ----LNPGDGIVPATINHIFSWIDKLAARGWSYKVSCEFIEIYNENIVDLL 492

>TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {ON}
           Anc_3.528 YGL216W
          Length = 847

 Score =  113 bits (283), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 64/174 (36%), Positives = 100/174 (57%), Gaps = 9/174 (5%)

Query: 261 IYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHNGEVF- 319
           I + NL        ++ ++ + RG  +R  + T  N+ SSRSH +  I + +        
Sbjct: 244 ITVSNLSHHKPQTVQEVMDFVIRGNMNRTTSPTDANETSSRSHAVLQIHIAQTDRTPDLI 303

Query: 320 ---RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----DKNAH 371
                + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L       +  H
Sbjct: 304 SNSTFATLSIIDLAGSERAASTKNRGERLIEGANINKSLLALGNCINALCISDGTRRTCH 363

Query: 372 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNK 425
           +P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL YA +AK+IK K
Sbjct: 364 VPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLTYANRAKDIKTK 417

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 59/107 (55%), Gaps = 10/107 (9%)

Query: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 130
           +  DK+F  +A+Q+ ++      L D  + G+N TV  YG T  GKT+T++G        
Sbjct: 128 FVFDKLFDETANQTNVYNSTTSSLLDSVLDGFNGTVFAYGATGCGKTFTISG-------- 179

Query: 131 LSDAAGIIPRILFKLFDTLET--QDEDYLVKCSFIELYNEELKDLLN 175
             +  GII   + +LF  +E+    ++  +  S++E+YNE ++DLLN
Sbjct: 180 TPEQPGIIFLTMDELFKRIESLKDTKNIELTLSYLEIYNETIRDLLN 226

>TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa]
           {ON} Anc_3.528 YGL216W
          Length = 801

 Score =  113 bits (282), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 68/180 (37%), Positives = 107/180 (59%), Gaps = 17/180 (9%)

Query: 261 IYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYK-------- 312
           I + NL  +     ++ ++L+ +G  +R  +ST  N+ SSRSH +  I L +        
Sbjct: 226 ISVSNLSTYSPATIEEVMDLIIQGNLNRTTSSTHANETSSRSHAVLQIHLTQQNKLNNDI 285

Query: 313 NHNGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL------- 365
           N   ++F  S ++++DLAGSE  + +  + +   E  +IN+SLL LG  IN+L       
Sbjct: 286 NSTEQLF--STLSIIDLAGSERAASTKNRGETLLEGANINKSLLALGNCINALCINTSSH 343

Query: 366 ADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNK 425
           + +  HIP+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK IK K
Sbjct: 344 SQQQIHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSKHYDETLNTLKYANRAKEIKTK 403

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 58/107 (54%), Gaps = 10/107 (9%)

Query: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 130
           +  DK+   ++ Q  +F+   EPL D  + GYN TV  YG T  GKTYT++G        
Sbjct: 110 FIFDKLLDQNSTQQHVFQSTTEPLLDSILDGYNGTVFAYGATGCGKTYTISGT------- 162

Query: 131 LSDAAGIIPRILFKLFDTLET--QDEDYLVKCSFIELYNEELKDLLN 175
             +  GII   L  LF+ +E     ++  +  S++E+YNE +KDLL+
Sbjct: 163 -PENPGIIFLTLQSLFNKIENLKDTKEISISLSYLEIYNESIKDLLD 208

>SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 706

 Score =  112 bits (281), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 78/194 (40%), Positives = 115/194 (59%), Gaps = 16/194 (8%)

Query: 245 RLINNKQQSLSE--QSSAIYIQNLQEFHITNA-------KDGIN-LLQRGLKHRQVASTK 294
           R +NN  + ++E  +    + Q  Q  H+TN        +D ++ LL+R  K R  A+T 
Sbjct: 509 RGLNNDTEDITESLKHEIRHDQESQTTHVTNVTTCKLTDRDMVDTLLKRAAKLRSTAATG 568

Query: 295 MNDFSSRSHTIFTIML--YKNHNGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSIN 352
            N+ SSRSH++F I L  Y ++ GE  + + +NLVDLAGSE I+ S     R +E  +IN
Sbjct: 569 SNERSSRSHSVFIIKLRGYNSNTGEECQGT-LNLVDLAGSERINASQVTGDRLRETQNIN 627

Query: 353 QSLLTLGRVINSLADKNA---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEET 409
           +SL  LG VI++LA  +A   HIPFR SKLT LLQ SL G++KT +   ISP   +  ET
Sbjct: 628 KSLSCLGDVIHALASPDASKRHIPFRNSKLTYLLQYSLLGDSKTLMFVNISPCLDHFNET 687

Query: 410 SSTLEYATKAKNIK 423
            ++L +A+K  + +
Sbjct: 688 LNSLRFASKVNSTR 701

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 50/163 (30%), Positives = 74/163 (45%), Gaps = 19/163 (11%)

Query: 15  QELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVD 74
           QEL   + V CR R   + +   S  V + ++   +E     T  + IT       +  D
Sbjct: 362 QELRGNIRVFCRIRPLLQGEGSESCHVHI-NLFNDDE----GTQSMNITRDSKKHEFKFD 416

Query: 75  KVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSDA 134
           K+F P      IF++I + L    + GYN  +  YG T +GKTYTM          L   
Sbjct: 417 KIFDPENSNDDIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM----------LHPQ 465

Query: 135 AGIIPRIL---FKLFDTLETQDEDYLVKCSFIELYNEELKDLL 174
            G+IP  L   F+    L+ +  +Y +   FIE+YNE + DLL
Sbjct: 466 NGMIPSTLDHIFQWIHLLKERGWEYEISSQFIEIYNETIIDLL 508

>TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON}
           Anc_3.479 YPR141C
          Length = 676

 Score =  111 bits (278), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 103/172 (59%), Gaps = 4/172 (2%)

Query: 256 EQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHN 315
           + S    ++NL+   +T+ +    +L+  +K R  AST  N+ SSRSH+IF I ++  + 
Sbjct: 499 DASKTTVVENLETITLTSKESVDAVLKNAMKLRATASTSSNERSSRSHSIFIIKIHGINE 558

Query: 316 G-EVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA---H 371
           G    R   +NL+DLAGSE +S S  Q++R KE   IN+SL  LG V+NSL   +A   H
Sbjct: 559 GLGEERNGLLNLIDLAGSERLSVSKVQSERIKETQHINKSLSFLGNVMNSLGSPDATTRH 618

Query: 372 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIK 423
           I FR+SKLT LLQ SL GN+KT ++  IS +  +  ET  +L +A K  + K
Sbjct: 619 ISFRDSKLTYLLQYSLTGNSKTLMVVNISSSSDHINETIKSLNFAKKVNSTK 670

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 58/107 (54%), Gaps = 14/107 (13%)

Query: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 130
           Y+ DKVF  +     IFK+++E L    + G+N  +  YG T +GKT+TM          
Sbjct: 383 YSFDKVFSQTDTNQEIFKEVSE-LIQSSLDGFNVCIFAYGQTGSGKTFTM---------- 431

Query: 131 LSDAAGIIPRILFKLFDTLETQDED---YLVKCSFIELYNEELKDLL 174
           L+   GIIP     +FD ++   ++   Y V C F+E+YN+E+ DLL
Sbjct: 432 LNPKDGIIPSTAKHIFDWIDNSAKNGWKYNVTCEFLEIYNDEIYDLL 478

>Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON}
           (11880..13742) [1863 nt, 621 aa]
          Length = 620

 Score =  109 bits (272), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 97/156 (62%), Gaps = 15/156 (9%)

Query: 278 INLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKN--HNGEVFRVSKMNLVDLAGSENI 335
           +N ++ G KHR+ +ST  N  SSRSH I  I L  +   +GEV   S ++L DLAGSE +
Sbjct: 248 LNWIKLGDKHRKTSSTDFNTRSSRSHAIILIRLISSDLSSGEVV-TSTLSLCDLAGSERV 306

Query: 336 SRSGAQNQRAKEAGSINQSLLTLGRVINSLADK---------NAHIPFRESKLTRLLQDS 386
           +   AQ++R +E   IN+SLL LG VI+ L+ +         N+HIP+R+SKLTR+LQ +
Sbjct: 307 T---AQHERRQEGSFINKSLLALGTVISKLSAEVNNSTESVNNSHIPYRDSKLTRILQPA 363

Query: 387 LGGNTKTALIATISPAKINAEETSSTLEYATKAKNI 422
           L GN+    I TI  +     E+ +TL +A++AKN+
Sbjct: 364 LSGNSIVTTICTIDTSVDATNESVNTLRFASRAKNV 399

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 48/130 (36%), Positives = 71/130 (54%), Gaps = 18/130 (13%)

Query: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 130
           YT D VF P A    ++    +PL D    G+N TV  YGMT +GKTYTM+G     DG 
Sbjct: 104 YTYDNVFHPDASNFDVYAATCKPLIDKLFDGFNSTVFAYGMTGSGKTYTMSG----VDGN 159

Query: 131 LSDAAGIIP----RILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLN-----EPQESG 181
               AG+IP     +  K+FD+   +++ Y    S++E+YNE++ DLL      +P  S 
Sbjct: 160 ----AGLIPLSVAYMYSKIFDSTIHENKKYDTLVSYLEIYNEKIYDLLETDFDPKPLRSS 215

Query: 182 V-IKKLRIFD 190
           + + +L+I D
Sbjct: 216 IAVPELKIRD 225

>KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]
           {ON} similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141C KAR3 Minus-end-directed microtubule motor that
           functions in mitosis and meiosis localizes to the
           spindle pole body and localization is dependent on
           functional Cik1p required for nuclear fusion during
           mating potential Cdc28p substrate
          Length = 702

 Score =  109 bits (273), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 99/167 (59%), Gaps = 14/167 (8%)

Query: 270 HITN-------AKDGIN-LLQRGLKHRQVASTKMNDFSSRSHTIFTIML--YKNHNGEVF 319
           HITN       +++ +N +L+R LK R  A+T  N  SSRSH++F I L  Y   +GE  
Sbjct: 532 HITNITVCKLTSREMVNRMLRRALKMRSTAATVANSRSSRSHSVFIIKLDGYNTISGEK- 590

Query: 320 RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPFRE 376
               +NLVDLAGSE I     Q +R +E  +IN+SL  LG VI++L   +A   HIPFR 
Sbjct: 591 STGTLNLVDLAGSERIHSLQPQAERLRETQNINKSLSCLGDVIHALGSADASKRHIPFRN 650

Query: 377 SKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIK 423
           SKLT LLQ SL G++KT +   +SP   +  ET ++L +A K  + K
Sbjct: 651 SKLTYLLQYSLMGDSKTLMFVNVSPCANSMLETLNSLRFAAKVNSTK 697

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 76/170 (44%), Gaps = 29/170 (17%)

Query: 15  QELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELG---ITAQMNSKT- 70
           QEL   + V CR R   E +  SS  + +   +          DE G   IT + +SK  
Sbjct: 358 QELRGNIRVFCRLRPALENENYSSSSIEIEKFS----------DETGMQSITIKRDSKQH 407

Query: 71  -YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDG 129
            +T D+ F        +F +I + L    + GYN  +  YG T +GKT+TM         
Sbjct: 408 KFTFDRCFSAQETNGDVFSEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTFTM--------- 457

Query: 130 ELSDAAGIIPRILFKLFDTLETQDE---DYLVKCSFIELYNEELKDLLNE 176
            L+   GIIP  L  +F  +E   E    Y +   F+E+YNE +KDL  E
Sbjct: 458 -LNPNDGIIPSTLNHIFLWVEKLKELGWVYEITSQFVEIYNENIKDLFKE 506

>KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa]
           {ON} Anc_3.479 YPR141C
          Length = 706

 Score =  109 bits (272), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 69/148 (46%), Positives = 88/148 (59%), Gaps = 4/148 (2%)

Query: 280 LLQRGLKHRQVASTKMNDFSSRSHTIFTIMLY-KNHNGEVFRVSKMNLVDLAGSENISRS 338
           +L R  K R  ASTK N+ SSRSH+IF I L+ KN          +NLVDLAGSE I+ S
Sbjct: 555 VLHRATKLRSTASTKSNEHSSRSHSIFIIHLHGKNSKTNEDSYGILNLVDLAGSERINSS 614

Query: 339 GAQNQRAKEAGSINQSLLTLGRVI---NSLADKNAHIPFRESKLTRLLQDSLGGNTKTAL 395
               +R +E   IN+SL  LG VI   NS   K  HIPFR SKLT LL+ SL GN+KT +
Sbjct: 615 QVSGERLRETQHINKSLSCLGDVIHALNSSEHKERHIPFRNSKLTHLLKYSLSGNSKTLM 674

Query: 396 IATISPAKINAEETSSTLEYATKAKNIK 423
              IS +  +  ET ++L +A+K  + K
Sbjct: 675 FVNISASLNHVNETINSLRFASKVNSTK 702

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 83/170 (48%), Gaps = 20/170 (11%)

Query: 15  QELNITVSVRCRGRNE-REIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTV 73
           QEL   + V CR R   + I+  ++  + V  +   +      T  + IT   N+  Y  
Sbjct: 369 QELRGNIRVYCRLRPPLKSIEDPNTSHIKVYSLDNDH-----GTQTMEITKNNNTNKYKF 423

Query: 74  DKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSD 133
           DK+F      S IFK++ + L    + GYN  +  YG T +GKT+TM          L+ 
Sbjct: 424 DKIFDQFESNSEIFKEVGQ-LVQSALDGYNVCIFAYGQTGSGKTFTM----------LNP 472

Query: 134 AAGIIP---RILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQES 180
           + GIIP   R +F   D L+ +  +Y + C F+E+YNE + DLL E Q S
Sbjct: 473 SDGIIPSTVRHIFTWIDNLKERGWEYQINCQFVEIYNENIIDLLREKQTS 522

>AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR141C (KAR3)
          Length = 709

 Score =  109 bits (272), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 67/169 (39%), Positives = 99/169 (58%), Gaps = 6/169 (3%)

Query: 260 AIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKN--HNGE 317
             YI N+    +T+      +L++  K R  A+T+ N+ SSRSH++F + +     H GE
Sbjct: 538 GTYITNVTRMKMTSTSQVDTILKKASKMRSTAATRSNERSSRSHSVFMVHINGRNLHTGE 597

Query: 318 VFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPF 374
             +  K+NLVDLAGSE I+ S    +R +E  +IN+SL  LG VI +L   +A   +IPF
Sbjct: 598 TSQ-GKLNLVDLAGSERINSSAVTGERLRETQNINKSLSCLGDVIYALNTPDAGKRYIPF 656

Query: 375 RESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIK 423
           R SKLT LLQ SL G++KT +   I P   +  ET ++L +A+K  + K
Sbjct: 657 RNSKLTYLLQYSLVGDSKTLMFVNIPPDPNHISETLNSLRFASKVNSTK 705

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 82/168 (48%), Gaps = 22/168 (13%)

Query: 15  QELNITVSVRCRGRNE--REIKAKSSVVV-TVPDVTGSNEVSINTTDELGITAQMNSKTY 71
           QEL   + V CR R     E +  S +++    +  G+  ++IN  +      ++ S  +
Sbjct: 361 QELRGNIRVYCRVRPPLLNEPQDMSHILIEKFNEAKGAQSLTINRNE-----GRILSYNF 415

Query: 72  TVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGEL 131
             D +F PS     IF++I + L    + GYN  +  YG T +GKTYTM          L
Sbjct: 416 QFDMIFEPSHTNKEIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM----------L 464

Query: 132 SDAAGIIPRIL---FKLFDTLETQDEDYLVKCSFIELYNEELKDLLNE 176
           +   G+IP  L   FK    L+ +  +Y ++C +IE+YNE + DLL +
Sbjct: 465 NAGDGMIPMTLSHIFKWTANLKERGWNYEMECEYIEIYNETILDLLRD 512

>NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {ON}
           Anc_3.479 YPR141C
          Length = 698

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 94/151 (62%), Gaps = 8/151 (5%)

Query: 279 NLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHN---GEVFRVSKMNLVDLAGSENI 335
           N+L+R  K R  AST  N+ SSRSH+IF I L  +++    E + +  +NLVDLAGSE I
Sbjct: 547 NILKRANKLRSTASTGSNEHSSRSHSIFIIHLRGSNSLTGEESYGI--LNLVDLAGSERI 604

Query: 336 SRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPFRESKLTRLLQDSLGGNTK 392
           + S     R +E  +IN+SL  LG VI++L   +    HIPFR SKLT LLQ SL GN+K
Sbjct: 605 NSSQVTGDRLRETQNINRSLSCLGDVIHALGGPDQGKRHIPFRNSKLTYLLQYSLTGNSK 664

Query: 393 TALIATISPAKINAEETSSTLEYATKAKNIK 423
           T +   ISP+  +  ET ++L +A+K  + K
Sbjct: 665 TLMFVNISPSANHINETINSLRFASKVNSTK 695

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 52/170 (30%), Positives = 81/170 (47%), Gaps = 23/170 (13%)

Query: 15  QELNITVSVRCRGRNE-REIKAKSSVVVTVPDVTGSNEVSINTTDEL-GITAQMNSKT-- 70
           QEL   + V CR R     I++K +  + V D    N   I + + + GI    N+ T  
Sbjct: 343 QELRGKIRVYCRIRPPLPNIESKDTAHIKVEDFDDDN--GIQSMEVMKGIEVNNNNATQI 400

Query: 71  ---YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLY 127
              +  DK+F  +   + +FK++ + L    + GYN  +  YG T +GKTYTM       
Sbjct: 401 PQRFKFDKIFNQTDTNADVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM------- 452

Query: 128 DGELSDAAGIIPRILFKLFD---TLETQDEDYLVKCSFIELYNEELKDLL 174
              L    GIIP  +  +F+    L+ +   Y + C F+E+YNE + DLL
Sbjct: 453 ---LRPKDGIIPSTIKHIFNWTKNLKERGWHYEIDCQFVEIYNENIIDLL 499

>NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {ON}
           Anc_8.678
          Length = 655

 Score =  108 bits (269), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 101/178 (56%), Gaps = 18/178 (10%)

Query: 260 AIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHNGEVF 319
            + +  L+E    ++++ +  ++RG  HR+ A T  N  SSRSH I  I L   +  +  
Sbjct: 278 GVRVMGLREQRCESSEELMKWIRRGDSHRKTAETDYNARSSRSHAIVLIRLTNTNVIDGT 337

Query: 320 RVSK-MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL------------- 365
            +S  ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L             
Sbjct: 338 SISSTLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSAESTAASHGNSP 394

Query: 366 -ADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNI 422
            A+ N HIP+R+SKLTR+LQ +L G++    I TI   K +A ET +TL +A++AKN+
Sbjct: 395 NANGNGHIPYRDSKLTRILQPALSGDSIVTTICTIDTQKESAAETLNTLRFASRAKNV 452

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 53/105 (50%)

Query: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 130
           +  D V+ P      I++ I +P+ D   +G+N TV  YGMT +GKTYTM G       +
Sbjct: 135 FKFDHVYSPHVSNLEIYESINKPMIDKLFQGFNATVFAYGMTGSGKTYTMMGSGGDGGDD 194

Query: 131 LSDAAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLN 175
                  +  +  K+ +     +  + V  S++E+YNE + DLL+
Sbjct: 195 DGLIPLSVSYLFSKVIEVGLVGERKFDVLLSYLEIYNERIYDLLD 239

>Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar to
           Ashbya gossypii AGR253W
          Length = 711

 Score =  107 bits (266), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 67/169 (39%), Positives = 101/169 (59%), Gaps = 6/169 (3%)

Query: 260 AIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHNGEVF 319
           A  I N+ +  +T+ +   ++L+R  + R  A T+ N+ SSRSH++F + +   HN +  
Sbjct: 540 ATSITNVTKMKMTSQEQVDSMLKRASRMRSTACTRSNERSSRSHSVFMVHI-NGHNDQTG 598

Query: 320 RVS--KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPF 374
            VS  K+NL+DLAGSE I+ S     R +E  +IN+SL  LG VI +L   +A   HIPF
Sbjct: 599 EVSHGKLNLIDLAGSERINSSLVTGDRLRETQNINKSLSCLGDVIYALNSPDAAKRHIPF 658

Query: 375 RESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIK 423
           R SKLT LLQ SL G++KT +   I   + +  ET ++L +A+K  + K
Sbjct: 659 RNSKLTYLLQYSLIGDSKTLMFVNIPSDQKHTNETLNSLRFASKVNSTK 707

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 39/112 (34%), Positives = 56/112 (50%), Gaps = 14/112 (12%)

Query: 68  SKTYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLY 127
           S  +  DK+F P    + +F++I + L    + GYN  +  YG T +GKTYTM       
Sbjct: 414 SYNFHFDKIFEPHNTNADVFQEICQ-LVQCSLDGYNVCIFAYGQTGSGKTYTM------- 465

Query: 128 DGELSDAAGIIPRILFKLFDTLETQDED---YLVKCSFIELYNEELKDLLNE 176
              L+   G+IP  L  +F   E   E    Y + C +IE+YNE + DLL E
Sbjct: 466 ---LNPGDGMIPMTLSHIFQWTEDLMEHGWRYEMDCEYIEIYNETILDLLRE 514

>TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {ON}
           Anc_3.479 YPR141C
          Length = 724

 Score =  107 bits (266), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 96/158 (60%), Gaps = 12/158 (7%)

Query: 279 NLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHNGEVFRVSK---MNLVDLAGSENI 335
           N+L++  K R  A+T  N+ SSRSH++F  M+Y     E+   S    +NLVDLAGSE +
Sbjct: 570 NVLKKATKLRATAATNSNERSSRSHSVF--MIYLKGKNEITGDSSEGILNLVDLAGSERL 627

Query: 336 SRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN---AHIPFRESKLTRLLQDSLGGNTK 392
           + S A   R +E  +IN+SL  LG VI++L   +    HIPFR SKLT LLQ SL G++K
Sbjct: 628 NSSQAVGARLRETQNINKSLSCLGDVIHALGQNDNTKRHIPFRNSKLTYLLQYSLTGSSK 687

Query: 393 TALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGT 430
           T +   ISP K +  ET ++L +A+K     N  ++GT
Sbjct: 688 TLMFVNISPTKSHLNETINSLRFASKV----NSTKIGT 721

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 61/117 (52%), Gaps = 14/117 (11%)

Query: 68  SKTYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLY 127
           S+ Y  D++F  +   + +FK+I + L    + G+N  +  YG T +GKTYTM       
Sbjct: 427 SQIYKFDRIFDQADSNTEVFKEIGQ-LVQSSLDGHNVCIFAYGQTGSGKTYTM------- 478

Query: 128 DGELSDAAGIIPRILFKLFDTLETQDED---YLVKCSFIELYNEELKDLLNEPQESG 181
              L+D  G+IP  +  +FD  E+  E    Y + C FIE+YNE + DLL +    G
Sbjct: 479 ---LNDNDGMIPATISHIFDWTESMKEKGWIYDISCQFIEIYNEGIIDLLRDNSTDG 532

>Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]
           {ON} complement(235625..237718) [2094 nt, 698 aa]
          Length = 697

 Score =  106 bits (264), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 98/152 (64%), Gaps = 4/152 (2%)

Query: 272 TNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYK-NHNGEVFRVSKMNLVDLA 330
           +N ++   L+QR  K R+ A T MN+ SSRSH++F + +   N + E      +NLVDLA
Sbjct: 543 SNRRELQELVQRLNKVRRTAKTAMNNRSSRSHSVFIVEVEGFNKDSEERCKGVLNLVDLA 602

Query: 331 GSENISRSG-AQNQRAKEAGSINQSLLTLGRVINSLADKNA--HIPFRESKLTRLLQDSL 387
           GSE ++RSG    +R +E   IN+SL ++G VI++L   +   HIPFR +KLT LL+ SL
Sbjct: 603 GSERMNRSGLVDKERIEETKQINKSLSSVGDVIHALRQGSGSLHIPFRNTKLTYLLKHSL 662

Query: 388 GGNTKTALIATISPAKINAEETSSTLEYATKA 419
            G++KT ++ T+SP+  +  ET ++L +ATK 
Sbjct: 663 QGSSKTLMLVTVSPSNSSRNETMNSLRFATKV 694

 Score = 61.6 bits (148), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 56/112 (50%), Gaps = 14/112 (12%)

Query: 68  SKTYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLY 127
           S  +  DK+F        +F ++ E L    + G+N  +  YG T +GKTYTM       
Sbjct: 405 SVNFQFDKIFNYDESNRQVFGEVKE-LVQSALDGHNVCIFTYGQTGSGKTYTM------- 456

Query: 128 DGELSDAAGIIPRILFKLFD---TLETQDEDYLVKCSFIELYNEELKDLLNE 176
              L++  GIIP  L  + D   +++     Y +K  F+E+YN+ + DLLN+
Sbjct: 457 ---LNEEDGIIPSTLDHIIDWTSSMKKLGWQYGLKIKFVEIYNDRIFDLLND 505

>TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {ON}
           Anc_3.479 YPR141C
          Length = 704

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 91/152 (59%), Gaps = 12/152 (7%)

Query: 280 LLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHNGEVFRVSK-----MNLVDLAGSEN 334
           LL+R  K R  AST  N+ SSRSH+IF + L    +GE     +     +NLVDLAGSE 
Sbjct: 549 LLKRANKLRSTASTACNERSSRSHSIFIVHL----SGENVLTGERSHGILNLVDLAGSER 604

Query: 335 ISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPFRESKLTRLLQDSLGGNT 391
           I+ S    +R +E  SIN+SL  LG VI++L   +A   HIPFR SKLT LLQ SL GN+
Sbjct: 605 INTSQVIGERLRETQSINKSLSCLGDVIHALGSADASKRHIPFRNSKLTYLLQYSLTGNS 664

Query: 392 KTALIATISPAKINAEETSSTLEYATKAKNIK 423
           KT +   IS    +  ET ++L +A+K  + K
Sbjct: 665 KTLMFVNISGNPNHTNETLNSLRFASKVNSTK 696

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 75/165 (45%), Gaps = 20/165 (12%)

Query: 15  QELNITVSVRCRGRNE--REIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYT 72
           QEL   + V CR R    RE    + + V   +    N+V     +  G   Q+    + 
Sbjct: 349 QELRGNIRVFCRVRPPLPRENATSNHLKVREFNDDAGNQVIEVAKNGYGSGPQI----FK 404

Query: 73  VDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELS 132
            D++F        +F++I + L    + GYN  +  YG T +GKTYTM          L+
Sbjct: 405 FDRIFNEKETNYDVFQEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM----------LN 453

Query: 133 DAAGIIPRILFKLFD---TLETQDEDYLVKCSFIELYNEELKDLL 174
              GIIP  +  +F+    L+ +   Y V C F+E+YNE + DLL
Sbjct: 454 PTDGIIPATITHIFNWTKNLKERGWRYDVSCQFVEIYNETIADLL 498

>YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON}
           KAR3Minus-end-directed microtubule motor that functions
           in mitosis and meiosis, localizes to the spindle pole
           body and localization is dependent on functional Cik1p,
           required for nuclear fusion during mating; potential
           Cdc28p substrate
          Length = 729

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 87/144 (60%), Gaps = 4/144 (2%)

Query: 280 LLQRGLKHRQVASTKMNDFSSRSHTIFTIMLY-KNHNGEVFRVSKMNLVDLAGSENISRS 338
           +L++  K R  AST  N+ SSRSH+IF I L   N          +NLVDLAGSE I+ S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNAKTGAHSYGTLNLVDLAGSERINVS 636

Query: 339 GAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPFRESKLTRLLQDSLGGNTKTAL 395
                R +E  +IN+SL  LG VI++L   ++   HIPFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 396 IATISPAKINAEETSSTLEYATKA 419
              ISP+  +  ET ++L +A+K 
Sbjct: 697 FVNISPSSSHINETLNSLRFASKV 720

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 81/164 (49%), Gaps = 17/164 (10%)

Query: 15  QELNITVSVRCRGRNE-REIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTV 73
           QEL   + V CR R   + ++   + ++ V +   ++ V      ++  TAQ++   +  
Sbjct: 381 QELRGNIRVYCRIRPALKNLENSDTSLINVNEFDDNSGVQSMEVTKIQNTAQVHE--FKF 438

Query: 74  DKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSD 133
           DK+F        +FK++ + L    + GYN  +  YG T +GKT+TM          L+ 
Sbjct: 439 DKIFDQQDTNVDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM----------LNP 487

Query: 134 AAGIIPRIL---FKLFDTLETQDEDYLVKCSFIELYNEELKDLL 174
             GIIP  +   F   + L+T+  DY V C FIE+YNE + DLL
Sbjct: 488 GDGIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNENIVDLL 531

>Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {ON}
           YPR141C (REAL)
          Length = 731

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 87/144 (60%), Gaps = 4/144 (2%)

Query: 280 LLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYK-NHNGEVFRVSKMNLVDLAGSENISRS 338
           +L+R  K R  AST  N+ SSRSH+IF I L   N          +NLVDLAGSE I+ S
Sbjct: 576 VLKRANKLRSTASTASNEHSSRSHSIFIIHLSGLNAKTGAQSYGTLNLVDLAGSERINIS 635

Query: 339 GAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPFRESKLTRLLQDSLGGNTKTAL 395
                R +E  +IN+SL  LG VI++L   ++   HIPFR SKLT LLQ SL G++KT +
Sbjct: 636 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSAKRHIPFRNSKLTYLLQYSLTGDSKTLM 695

Query: 396 IATISPAKINAEETSSTLEYATKA 419
              ISP+  +  ET ++L +A+K 
Sbjct: 696 FVNISPSSSHINETLNSLRFASKV 719

 Score = 74.7 bits (182), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 79/164 (48%), Gaps = 17/164 (10%)

Query: 15  QELNITVSVRCRGRNERE-IKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTV 73
           QEL   + V CR R   E ++   + ++ V +   +  V      ++  T Q++   +  
Sbjct: 381 QELRGNIRVYCRIRPPLESLENLDTSLINVNEFDDNRGVQSMEVTKIQNTPQVHE--FKF 438

Query: 74  DKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSD 133
           DK+F        +FK++ + L    + GYN  +  YG T +GKT+TM          L+ 
Sbjct: 439 DKIFDQRNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM----------LNP 487

Query: 134 AAGIIPRIL---FKLFDTLETQDEDYLVKCSFIELYNEELKDLL 174
             GIIP  +   F   + L+T+  DY V C FIE+YNE + DLL
Sbjct: 488 GDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLL 531

>NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa]
           {ON} Anc_3.479
          Length = 763

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 91/155 (58%), Gaps = 11/155 (7%)

Query: 279 NLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNH--NGEVFRVSKMNLVDLAGSENIS 336
           N+L+R  K R  AST  N+ SSRSH+IF I L   +   GE      +NLVDLAGSE I+
Sbjct: 602 NILRRANKLRSTASTLSNEHSSRSHSIFIIHLKGTNEITGEK-SYGILNLVDLAGSERIN 660

Query: 337 RSGAQNQRAKEAGSINQSLLTLGRVINSLAD--------KNAHIPFRESKLTRLLQDSLG 388
            S    +R +E  +IN+SL  LG VI++L          K  HIPFR SKLT LLQ SL 
Sbjct: 661 SSQVTGERLRETQNINRSLSCLGDVIHALTGSEKDKENAKKRHIPFRNSKLTYLLQYSLI 720

Query: 389 GNTKTALIATISPAKINAEETSSTLEYATKAKNIK 423
           GN+KT +   ISP+     ET ++L +A+K  + K
Sbjct: 721 GNSKTLMFVNISPSINYVNETLNSLRFASKVNSAK 755

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 82/180 (45%), Gaps = 19/180 (10%)

Query: 15  QELNITVSVRCRGRNE---REIKAKSSVVVT-VPDVTGSNEVSINTTDELGITAQMNSKT 70
           QEL   + V CR R     +E    S + V+   D  G+  + I        +    +  
Sbjct: 393 QELRGNIRVYCRIRPPILPQESNNTSHLKVSEFDDNNGTQTLEIQKALNNNSSNNSTTLK 452

Query: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 130
           +  DK+F  +     +FK++ + L    + GYN  +  YG T +GKTYTM          
Sbjct: 453 FKFDKIFNQNETNDDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 501

Query: 131 LSDAAGIIPRILFKLF---DTLETQDEDYLVKCSFIELYNEELKDLL-NEPQESGVIKKL 186
           L    GIIP  +  +F   + L+ +   Y ++C F+E+YNE + DLL NE   +G +  L
Sbjct: 502 LHPKDGIIPATISHIFNWTNNLKERGWKYEIECEFVEIYNENIVDLLRNEHDNNGKVNDL 561

>ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 731

 Score =  104 bits (259), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 92/152 (60%), Gaps = 6/152 (3%)

Query: 276 DGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLY-KNHNGEVFRVSKMNLVDLAGSEN 334
           DG  LL++  + R  AST  N+ SSRSH++F I L   NH         +NLVDLAGSE 
Sbjct: 564 DG--LLRKANRLRSTASTSANERSSRSHSVFIIFLKGSNHLTGEQSDGILNLVDLAGSER 621

Query: 335 ISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPFRESKLTRLLQDSLGGNT 391
           I+ S    +R +E  +IN+SL  LG V+++L   +A   HIPFR SKLT LLQ SL GN+
Sbjct: 622 INSSQVLGERLRETQNINKSLSCLGDVVHALGSNDAAKRHIPFRNSKLTYLLQYSLTGNS 681

Query: 392 KTALIATISPAKINAEETSSTLEYATKAKNIK 423
           KT +   IS  + +  ET ++L +A+K  + K
Sbjct: 682 KTLMFVNISACESHLNETLNSLRFASKVNSTK 713

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/171 (29%), Positives = 81/171 (47%), Gaps = 20/171 (11%)

Query: 15  QELNITVSVRCRGRNEREIKAKSSVVVTV---PDVTGSNEVSINTTDELGITAQMNSKTY 71
           QEL   + V CR R   + +  ++  +TV    D  G   + I  ++  G +   N   +
Sbjct: 372 QELRGNIRVFCRIRPPLKYENPNTAHLTVNKFDDENGCQTMEIVKSNNTGNSIPQN---F 428

Query: 72  TVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGEL 131
             D++F  +     +F++I + L    + GYN  +  YG T +GKTYTM          L
Sbjct: 429 KFDRIFDQNETNENVFEEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM----------L 477

Query: 132 SDAAGIIPRILFKLFDTLETQDE---DYLVKCSFIELYNEELKDLLNEPQE 179
           +   GIIP  +  +F  +E   E   +Y + C FIE+YNE + DLL   Q+
Sbjct: 478 NPRNGIIPATISHIFSWIENLKERGWNYEINCQFIEIYNENIADLLRSDQD 528

>Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score =  103 bits (258), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 87/144 (60%), Gaps = 4/144 (2%)

Query: 280 LLQRGLKHRQVASTKMNDFSSRSHTIFTIMLY-KNHNGEVFRVSKMNLVDLAGSENISRS 338
           +L++  K R  AST  N+ SSRSH+IF I L   N          +NLVDLAGSE I+ S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFMIHLSGSNAKTGAQSYGTLNLVDLAGSERINIS 636

Query: 339 GAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPFRESKLTRLLQDSLGGNTKTAL 395
                R +E  +IN+SL  LG VI++L   ++   HIPFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 396 IATISPAKINAEETSSTLEYATKA 419
              ISP+  +  ET ++L +A+K 
Sbjct: 697 FVNISPSSSHINETLNSLRFASKV 720

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 80/166 (48%), Gaps = 21/166 (12%)

Query: 15  QELNITVSVRCRGRNERE-IKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTV 73
           QEL   + V CR R   E ++   + ++ V +   +  V      ++  T Q++   +  
Sbjct: 381 QELRGNIRVYCRIRPPLETLENLDTSLIRVNEFDDNRGVQSMEVTKIQSTTQVHE--FKF 438

Query: 74  DKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTM--TGDERLYDGEL 131
           DK+F        +FK++ + L    + GYN  +  YG T +GKT+TM  TGD        
Sbjct: 439 DKIFDQQNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTMLNTGD-------- 489

Query: 132 SDAAGIIPRIL---FKLFDTLETQDEDYLVKCSFIELYNEELKDLL 174
               GIIP  +   F   + L+T+  DY V C FIE+YNE + DLL
Sbjct: 490 ----GIIPSTISHIFSWINKLKTKGWDYKVNCEFIEIYNENIVDLL 531

>KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 690

 Score =  103 bits (257), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 63/147 (42%), Positives = 93/147 (63%), Gaps = 4/147 (2%)

Query: 280 LLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHN--GEVFRVSKMNLVDLAGSENISR 337
           +L+   K + +A+T  N+ SSRSH++FTI ++  ++  GE      +NLVDLAGSE I  
Sbjct: 541 VLRTANKTKSIAATNSNERSSRSHSVFTIRIHGTNSITGEA-SDGVLNLVDLAGSERIDT 599

Query: 338 SGAQNQRAKEAGSINQSLLTLGRVINSLADKNA-HIPFRESKLTRLLQDSLGGNTKTALI 396
           S     R +E  +IN+SL  LG VI +L  K+  HIPFR SKLT LLQ SL G++KT + 
Sbjct: 600 SNVTGDRLRETQNINKSLSCLGDVIYALNGKDMKHIPFRNSKLTYLLQYSLIGDSKTLMF 659

Query: 397 ATISPAKINAEETSSTLEYATKAKNIK 423
             +SP+  + +ET ++L +A+K  + K
Sbjct: 660 VNVSPSSNHVKETLNSLRFASKVNSTK 686

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 56/166 (33%), Positives = 84/166 (50%), Gaps = 25/166 (15%)

Query: 15  QELNITVSVRCRGRN--EREIKAKSSVVVTVPD-VTGSNEVSINTTDELGITAQMNSKTY 71
           QEL   + V CR R   E E++  S + V+  D   GS  + I+  D        NS+ +
Sbjct: 353 QELRGNIRVYCRIRPPLENEVQDISHIHVSNFDNRNGSQAIEISNEDR-------NSR-F 404

Query: 72  TVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGEL 131
             DKVF  +A    +F+++ + L    + GYN  +  YG T +GKTYTM          +
Sbjct: 405 LFDKVFSSNASNRDVFEEVGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM----------M 453

Query: 132 SDAAGIIPRILFKLFDT---LETQDEDYLVKCSFIELYNEELKDLL 174
           +D  G+IP  L  +FD    L+ +  DY  +  FIE+YNE++ DLL
Sbjct: 454 NDPDGVIPMTLDHIFDWTHLLKERGWDYSFEAQFIEIYNEQIVDLL 499

>Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score =  103 bits (257), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 87/144 (60%), Gaps = 4/144 (2%)

Query: 280 LLQRGLKHRQVASTKMNDFSSRSHTIFTIMLY-KNHNGEVFRVSKMNLVDLAGSENISRS 338
           +L++  K R  AST  N+ SSRSH+IF I L   N          +NLVDLAGSE I+ S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNTKTGAQSYGTLNLVDLAGSERINIS 636

Query: 339 GAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPFRESKLTRLLQDSLGGNTKTAL 395
                R +E  +IN+SL  LG VI++L   ++   HIPFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 396 IATISPAKINAEETSSTLEYATKA 419
              ISP+  +  ET ++L +A+K 
Sbjct: 697 FVNISPSSSHINETLNSLRFASKV 720

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 81/164 (49%), Gaps = 17/164 (10%)

Query: 15  QELNITVSVRCRGRNERE-IKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTV 73
           QEL   + V CR R   E ++   + ++ V +   +  +      ++  TAQ++   +  
Sbjct: 381 QELRGNIRVYCRIRPALETLEDSDTSLINVNEFDDNCGIQSMEVTKIHNTAQVHE--FKF 438

Query: 74  DKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSD 133
           DK+F      + +FK++ + L    + GYN  +  YG T +GKT+TM          L+ 
Sbjct: 439 DKIFDQKDTNADVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM----------LNP 487

Query: 134 AAGIIPRIL---FKLFDTLETQDEDYLVKCSFIELYNEELKDLL 174
             GIIP  +   F   + L+T+  DY V C FIE+YNE + DLL
Sbjct: 488 GDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLL 531

>Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C
           (KIP2) - kinesin-related protein [contig 68] FULL
          Length = 715

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 81/250 (32%), Positives = 130/250 (52%), Gaps = 26/250 (10%)

Query: 260 AIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKN---HNG 316
            + +  L E  + +++D +  +  G  +R+   T  N  SSRSH I T+ L         
Sbjct: 277 GVRVMGLTEQRVYSSEDVLKWISLGDTNRRTGETDYNTRSSRSHAIVTLNLACTDLVSGA 336

Query: 317 EVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK-------- 368
           E    S ++L DLAGSE   R+  Q++R KE   IN+SLL LG VI+ L+          
Sbjct: 337 ET--TSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSASSMHTTPSF 391

Query: 369 -NAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNI----- 422
            N+HIP+R+SKLTR+LQ +L G +    I TI        ET +T+ +A++AKN+     
Sbjct: 392 GNSHIPYRDSKLTRILQPALSGESIVTTICTIDTRLDAMSETVNTIRFASRAKNVSMTVK 451

Query: 423 KNKPQLGTLVMKDILVKNITRELAKIKSDFLSTK-SKDGIYMTQDHYKELTSDLENYKTE 481
           +N+ +L     KD L+ N+ R+L + +      K +++    T D Y  L  + +  K +
Sbjct: 452 RNEAELAH--EKDALIHNLRRQLDEQQELIWELKRNQEKCEQTPDLYL-LRKESDALKRK 508

Query: 482 VQECKREIEK 491
           +Q C+R ++K
Sbjct: 509 LQLCERLLDK 518

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 81/153 (52%), Gaps = 12/153 (7%)

Query: 27  GRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVDKVFGPSADQSLI 86
           G N ++ +   SV + +     + +     +DE  I A  +   +  D VF P ++   +
Sbjct: 96  GENSQQYRGAISVSIRLKPTDANAKNPWFVSDEQTI-AHNDVGEFKFDNVFRPQSNNYEV 154

Query: 87  FKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSDAAGIIPRILFKLF 146
           ++QI +P+ D   +GYN  +  YGMT +GKT+TM+G          + AG+I   +  +F
Sbjct: 155 YQQIGKPMIDRLFQGYNAIIFAYGMTGSGKTFTMSGT--------PEEAGLISLSVEHIF 206

Query: 147 DTLETQ---DEDYLVKCSFIELYNEELKDLLNE 176
             + ++   ++ + V  S++E+YNE++ DLLN+
Sbjct: 207 AQIMSESLANKSFQVTVSYLEIYNEKIYDLLNQ 239

>SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {ON}
           similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155C KIP2 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 657

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 80/262 (30%), Positives = 134/262 (51%), Gaps = 25/262 (9%)

Query: 260 AIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLY-KNHNGEV 318
            + +  L E  +  ++D +  +  G  +R+   T  N  SSRSH I  I L   +    +
Sbjct: 272 GVKVIGLTEQEVDTSEDVMKWIALGNSNRKTGETDFNSRSSRSHAIVLIRLTCTDLKSGL 331

Query: 319 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA-------- 370
              S ++L DLAGSE   R+ AQ +R KE   IN+SLL LG VI+ L+ ++         
Sbjct: 332 ETTSTLSLCDLAGSE---RATAQRERRKEGAFINKSLLALGTVISKLSAESTQNMGVGGG 388

Query: 371 -HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIK---NKP 426
            HIP+R+SKLTR+LQ +L G+     I T+     ++ ET +T+ +A++AKNI     + 
Sbjct: 389 HHIPYRDSKLTRILQPALSGDGIVTTICTVDAHAESSAETINTIRFASRAKNISLVVKRN 448

Query: 427 QLGTLVMKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYK-----ELTSDLENYKTE 481
           ++     KD +++N+ R+L +        KS +G   T D         L S+ +  K  
Sbjct: 449 EMDISNEKDHIIENLRRQLEQQNETIAVLKSNNGTCRTTDAGASEDALSLQSENKVLKLR 508

Query: 482 VQECKREIEKMNSQNVLLLKDK 503
           ++ C    EK+  ++ ++L+D+
Sbjct: 509 LEHC----EKLLDKDSMILQDQ 526

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 66/108 (61%), Gaps = 11/108 (10%)

Query: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 130
           ++ D VF P+ D   ++++ A P+ +   +G+N T+  YGMT +GKT+TM+G        
Sbjct: 147 FSFDHVFHPTNDNFAVYEETARPMIEKLFQGFNSTIFAYGMTGSGKTFTMSGT------- 199

Query: 131 LSDAAGIIPRILFKLFDTLETQ---DEDYLVKCSFIELYNEELKDLLN 175
            S+  G+IP  +  +F  + ++   ++ + VK S++E+YNE++ DLLN
Sbjct: 200 -SNEPGLIPLSVNDIFSNIMSKSLNNQRFDVKVSYLEIYNEKIYDLLN 246

>KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {ON}
           Anc_8.678 YPL155C
          Length = 658

 Score = 99.0 bits (245), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 79/226 (34%), Positives = 112/226 (49%), Gaps = 42/226 (18%)

Query: 260 AIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHNGEVF 319
            + I  L E     +++ +  ++ G  +R+ + T+ N  SSRSH +  + L   HN  V 
Sbjct: 266 GVKITGLNEERCDTSQELMKWIKYGDSNRKTSETEYNLRSSRSHAVILVRLV-THN--VI 322

Query: 320 RVSK----MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA--------- 366
             SK    + L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+         
Sbjct: 323 DGSKTSSTLTLCDLAGSE---RAAGQQERRKEGAFINKSLLALGTVISKLSAESLSNSKH 379

Query: 367 ---------------DKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSS 411
                          + N HIP+R+SKLTRLLQ +L GN+    I TI P      ET +
Sbjct: 380 VSNPMGPPASPSLNSNGNNHIPYRDSKLTRLLQPALSGNSAVTTICTIDPRMETYAETIN 439

Query: 412 TLEYATKAKNIK----NKPQLGTL----VMKDILVKNITRELAKIK 449
           TL +A++AKN+      K  L T+    V KD ++K +T  L K K
Sbjct: 440 TLRFASRAKNVSLRFNIKKNLSTISKSEVEKDKIIKELTFRLEKQK 485

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/116 (39%), Positives = 63/116 (54%), Gaps = 9/116 (7%)

Query: 63  TAQMNSKTYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTG 122
           T   N+  Y  D VF P  D   I+K  A PL D    G+N T+  YGMT +GKTYTM G
Sbjct: 125 TINTNNDEYKFDHVFSPHVDNFEIYKTTAIPLIDKLFTGFNATLFCYGMTGSGKTYTMMG 184

Query: 123 DERLYDGELSDAAGIIPRILFKLFDTL--ETQDEDYLVKCSFIELYNEELKDLLNE 176
           D    D       GI+P  +  LF+ +     D+ Y V  S++E+YNE++ DLL++
Sbjct: 185 DNENPD-------GIVPLSVSLLFNQVLNSRNDKKYDVILSYLEIYNEKIYDLLDD 233

>TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON}
           Anc_8.678 YPL155C
          Length = 637

 Score = 97.8 bits (242), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 108/406 (26%), Positives = 171/406 (42%), Gaps = 87/406 (21%)

Query: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 130
           +T D+VF  +     I++  + P+ D  ++G+N TV           Y MTG        
Sbjct: 112 FTFDRVFPANCTNLDIYEASSRPMIDKLLQGFNATVFA---------YGMTGSG------ 156

Query: 131 LSDAAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELK-DLLNEPQESGVIKKLRIF 189
                        K F    T+DE  L+  S   L+++ L+  +    +   V+  L I+
Sbjct: 157 -------------KTFTMTGTEDEAGLIPLSVTYLFSKILEHSMRGTSKYEVVVSYLEIY 203

Query: 190 DXXXXXXX--XXXXXXXXXPNLVGTSGTFKRIFKTPVPYKXXXXXXXXXXXXXXXXPRLI 247
           +                  P+ +  SGT  R    PV  +                    
Sbjct: 204 NEKIYDLLDCESENKFNSTPSRMFLSGT-PRSSGGPVELRIR------------------ 244

Query: 248 NNKQQSLSEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFT 307
                   +    + I  L E    ++++    +Q G K+R+ + T  N  SSRSH I  
Sbjct: 245 -------DDLKYGVRITGLTEKRCESSEELSRWIQIGDKNRKTSETIYNTRSSRSHAIVL 297

Query: 308 IMLYKN--HNGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI--- 362
           + L      +GE    S ++L DLAGSE   ++ +Q +R KE   IN+SLL LG VI   
Sbjct: 298 VRLNNTDLRSGETVS-STLSLCDLAGSE---KAVSQYERRKEGAFINKSLLALGTVISKL 353

Query: 363 ---------------NSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAE 407
                           +  + N HIP+R+SKLTR+LQ +L GN+    I TI      A 
Sbjct: 354 SSESLSKNGPPTFTSTNPTEPNTHIPYRDSKLTRILQPALSGNSIITTICTIDTRNEAAS 413

Query: 408 ETSSTLEYATKAKN----IKNKPQLGTLVM--KDILVKNITRELAK 447
           ET +T+ +A++AKN    +  +P +GT     KD  ++N+T++L K
Sbjct: 414 ETVNTIRFASRAKNVTLQVAKRPAVGTGSYNEKDQTIENLTQQLEK 459

>KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 668

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 113/432 (26%), Positives = 189/432 (43%), Gaps = 101/432 (23%)

Query: 260 AIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNH--NGE 317
            + +  L E ++++ K+ +  +  G  +R+   T  N  SSRSH +  I ++      GE
Sbjct: 235 GVKVVGLVERNVSSNKELMKCISIGDHNRKTGETDFNTRSSRSHAVVLIRVFCTDEITGE 294

Query: 318 VFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA------- 370
              +S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+ +++       
Sbjct: 295 QV-MSTLSLCDLAGSE---RATGQQERRKEGAYINKSLLALGTVISKLSMESSGLSTNVG 350

Query: 371 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIK------- 423
           HIP+R+SKLTR+LQ +L G++  A I T+      + E+ +T+ +A++AKNI        
Sbjct: 351 HIPYRDSKLTRILQPALSGDSLVATICTVDTRPETSTESINTIRFASRAKNISLAVKRNE 410

Query: 424 -----NKPQLGTLVMK-----DILVKNITRELAKIKSDFLSTKS----KDGIYMTQDHYK 469
                +K QL   + K      I + N+TR    I S   S  S     + + M  +HY+
Sbjct: 411 ADSNVSKSQLIQTLRKQVREQQITIDNLTRGKGFIGSGISSDTSLLRENELLKMKVEHYE 470

Query: 470 E----------------------------LTSDLENYKTEVQECKREIEKMNSQNVLLLK 501
                                        L + L N  +++QE KR I ++ S      +
Sbjct: 471 RLETLEPSILKDTELVEIIDMLPQDIGVMLETKLVNMDSQLQESKRYISQLESART---R 527

Query: 502 DKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHTLKDAIYTVQNSLKN 561
           D  A+   +EL    + +++D      D     H+ EQ+L+                   
Sbjct: 528 DASATAATAEL----LSNVSD-----IDLTQVLHEQEQELM------------------- 559

Query: 562 CEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSRHLGIDGNIDIIQEELSQVL 621
               QL    E +D + + + S K+ + +QLA       S     D +I+I     + VL
Sbjct: 560 ----QLHQSLERKDKMIEALKSAKR-LRQQLAEYTGEAVS---ATDSDIEIGTATAANVL 611

Query: 622 ESICSTSVDVCR 633
           + I   + D+ R
Sbjct: 612 KPISPNASDLNR 623

 Score = 90.9 bits (224), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 63/110 (57%), Gaps = 10/110 (9%)

Query: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 130
           +  D VF P  +   +++ +A P+ D   +G+NCT+  YGMT +GKTYTM+G +      
Sbjct: 106 FNFDHVFSPEMNNDRVYETMALPMIDKLFEGFNCTIFAYGMTGSGKTYTMSGSK------ 159

Query: 131 LSDAAGIIPRILFKLFDTLET--QDEDYLVKCSFIELYNEELKDLLNEPQ 178
                GIIP  +  +FD +      + + V+ S++E+YNE + DLLN PQ
Sbjct: 160 --SGPGIIPMCVDTIFDRINVGLPRKKFTVRVSYLEIYNERIFDLLNLPQ 207

>NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {ON} 
          Length = 685

 Score = 94.4 bits (233), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 68/191 (35%), Positives = 100/191 (52%), Gaps = 31/191 (16%)

Query: 260 AIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHNGEVF 319
            + +  L E    ++++ +N + +G K R+ A T  N  SSRSH I  I L  +   +  
Sbjct: 280 GVRVIGLTEKRCESSEELMNWIIKGDKIRKTAETDFNARSSRSHAIVLIRLTTSDMKDGT 339

Query: 320 RVSK-MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA---DKN------ 369
            +S  ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+   +KN      
Sbjct: 340 SISSTLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSTESNKNRSPTLP 396

Query: 370 ------------------AHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSS 411
                              HIP+R+SKLTRLLQ +L G++    I TI     ++ ET +
Sbjct: 397 SPPLSSSSSSTSINSSVPGHIPYRDSKLTRLLQPALSGDSIVTTICTIDTKNESSAETLN 456

Query: 412 TLEYATKAKNI 422
           TL +A++AKNI
Sbjct: 457 TLRFASRAKNI 467

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 73/148 (49%), Gaps = 15/148 (10%)

Query: 38  SVVVTVPDVTGSNEVSINT-----TDELGITAQMNSKTYTVDKVFGPSADQSLIFKQIAE 92
           ++ V +     SN   ++T     TDE  I A  +   +  D VF        I++ I  
Sbjct: 100 TITVAIRPKPTSNPSDVSTSSWLVTDEKTI-AHDDVGEFKFDHVFNSFVSNLEIYQVINR 158

Query: 93  PLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSDAAGIIPRILFKLFDTL--E 150
           P+ D   +G+N T+  YGMT +GKTYTM G       E     G+IP  +  LF  +  E
Sbjct: 159 PMIDKLFQGFNSTIFAYGMTGSGKTYTMMGCP-----EREQKDGLIPLSVSYLFTKIMEE 213

Query: 151 TQDED--YLVKCSFIELYNEELKDLLNE 176
           T D D  + +  S++E+YNE++ DLL +
Sbjct: 214 TLDGDKKFEIVLSYLEIYNEKIYDLLGD 241

>CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa]
           {ON} similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155c KIP2 kinesin-related protein
          Length = 672

 Score = 94.0 bits (232), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 66/190 (34%), Positives = 100/190 (52%), Gaps = 31/190 (16%)

Query: 260 AIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKN--HNGE 317
            + +  L +     +++ ++ + +G K+R+ + T+ N  SSRSH I  I L       GE
Sbjct: 268 GVRVVGLTQKRCDTSEEVLDWINKGNKNRKTSETEFNTRSSRSHAIVMIRLISKDIRTGE 327

Query: 318 VFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVIN-------------- 363
              +  ++L DLAGSE   R   QN+R KE   IN+SLL LG VI+              
Sbjct: 328 Q-NIRTLSLCDLAGSE---RGVGQNERRKEGAFINRSLLALGTVISRLSAENNGSHHTGR 383

Query: 364 ------SLADKNA-----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSST 412
                 SLA  N      HIP+R+SKLTRLLQ +L G++    + TI  A  ++ ET +T
Sbjct: 384 AANSQQSLASPNGSSSGNHIPYRDSKLTRLLQPALSGDSVVVALCTIDLAHESSSETLNT 443

Query: 413 LEYATKAKNI 422
           L +A+++KN+
Sbjct: 444 LRFASRSKNV 453

 Score = 82.0 bits (201), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 64/116 (55%), Gaps = 12/116 (10%)

Query: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 130
           +T D VF        I+ +  +PL D  I+GYN T+  YGMT +GKT+TM+G E      
Sbjct: 133 FTFDHVFSTGCSNFDIYGKTTQPLIDRLIEGYNATIFAYGMTGSGKTFTMSGTE------ 186

Query: 131 LSDAAGIIPRILFKLFDTL----ETQDEDYLVKCSFIELYNEELKDLLNEPQESGV 182
             +  G+IP  +  LF +L     T++E   V  S++E+YNE++ DLL+    S V
Sbjct: 187 --EEKGLIPLSVSYLFSSLLEKTNTENEKSEVWVSYLEIYNEKINDLLDVASGSNV 240

>ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL155C (KIP2)
          Length = 685

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 68/203 (33%), Positives = 109/203 (53%), Gaps = 21/203 (10%)

Query: 260 AIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIML--YKNHNGE 317
            + + +L E  +++ +D +  +  G ++R+   T  N  SSRSH I  + L  Y    G 
Sbjct: 274 GVKVVDLTEQLVSSHEDVMKWIATGDRNRKTGETDFNTRSSRSHAIVLLRLTRYDLKTGS 333

Query: 318 VFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----------- 366
               S ++L DLAGSE   R+  Q  R KE   IN+SLL LG VI  L+           
Sbjct: 334 EA-TSTLSLCDLAGSE---RAVTQIVRRKEGAFINKSLLALGTVIAKLSMLGSQANGLQP 389

Query: 367 -DKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIK-- 423
                HIP+R+SKLTR+LQ +L G++    I TI     ++ ET++T+ +A++AKNI   
Sbjct: 390 SPAAGHIPYRDSKLTRILQPALTGDSIITTICTIDSKAESSTETTNTVRFASRAKNIALN 449

Query: 424 -NKPQLGTLVMKDILVKNITREL 445
             K ++ +   KD +++N+ ++L
Sbjct: 450 VRKNEMDSHAEKDTIIQNLRKQL 472

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 62/109 (56%), Gaps = 12/109 (11%)

Query: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 130
           +  D VF        +++ +  P+ D   +GYN T+  YGMT +GKT+TM+G+++     
Sbjct: 146 FQFDHVFTKGVCNQEVYQALGVPIIDKLFEGYNATIFAYGMTGSGKTFTMSGNKQ----- 200

Query: 131 LSDAAGIIPRILFKLFDTLETQDED----YLVKCSFIELYNEELKDLLN 175
                G+IP+ +  +FD + ++       Y VK S++E+YNE++ DLLN
Sbjct: 201 ---EPGLIPQCVGNIFDRISSEHHGASLAYEVKVSYLEIYNEKIYDLLN 246

>Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {ON}
           YPL155C (REAL)
          Length = 706

 Score = 93.6 bits (231), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 68/195 (34%), Positives = 94/195 (48%), Gaps = 35/195 (17%)

Query: 260 AIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNH-NGEV 318
            + +  L E    + ++ +  +  G K R++  T  N  SSRSH I  I L     N   
Sbjct: 302 GVKVIGLTERRCESTEELLRWIGIGDKSRKIGETDYNTRSSRSHAIVLIRLTSTDVNNGT 361

Query: 319 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-ADKNA------- 370
            R S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L ADK         
Sbjct: 362 SRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTTSVDSNIS 418

Query: 371 -----------------------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAE 407
                                  HIP+R+SKLTRLLQ +L G++    I T+      A 
Sbjct: 419 TTPTGSSGSSSGSITGNSGIPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAA 478

Query: 408 ETSSTLEYATKAKNI 422
           ET +TL +A++AKN+
Sbjct: 479 ETMNTLRFASRAKNV 493

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 65/116 (56%), Gaps = 16/116 (13%)

Query: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 130
           +  D VF        ++++  +P+ D  + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYERTGKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 131 LSDAAGIIPRILFKLFDTLETQ----DEDYLVKCSFIELYNEELKDLLNEPQESGV 182
           L    G+IP  +  LF  +  Q    D+ + V  S++E+YNE + DLL    ESG+
Sbjct: 219 L----GLIPLSVSYLFSNIMEQSMDGDKKFDVIISYLEIYNERIYDLL----ESGL 266

>YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON}
           KIP2Kinesin-related motor protein involved in mitotic
           spindle positioning, stabilizes microtubules by
           targeting Bik1p to the plus end; Kip2p levels are
           controlled during the cell cycle
          Length = 706

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 99/196 (50%), Gaps = 37/196 (18%)

Query: 260 AIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNH--NGE 317
            + +  L E    ++++ +  +  G K R++  T  N  SSRSH I  I L   +  NG 
Sbjct: 302 GVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTNVKNG- 360

Query: 318 VFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-ADK-------- 368
             R S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L ADK        
Sbjct: 361 TSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKMNSVGSNI 417

Query: 369 -------------NA---------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINA 406
                        NA         HIP+R+SKLTRLLQ +L G++    I T+      A
Sbjct: 418 PSPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAA 477

Query: 407 EETSSTLEYATKAKNI 422
            ET +TL +A++AKN+
Sbjct: 478 AETMNTLRFASRAKNV 493

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 66/116 (56%), Gaps = 16/116 (13%)

Query: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 130
           +  D VF        ++++ ++P+ D  + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 131 LSDAAGIIPRILFKLFDTLETQ----DEDYLVKCSFIELYNEELKDLLNEPQESGV 182
           L    G+IP  +  LF  +  Q    D+ + V  S++E+YNE + DLL    ESG+
Sbjct: 219 L----GLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIYNERIYDLL----ESGL 266

>Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}
           similar to Ashbya gossypii ACR145W
          Length = 687

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 70/208 (33%), Positives = 107/208 (51%), Gaps = 27/208 (12%)

Query: 260 AIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYK---NHNG 316
            + + +L E  + +  + I  +  G K+R+   T  N  SSRSH I  + L +       
Sbjct: 275 GVKVVDLTEQQVESHGEVIKWIAAGDKNRKTGETDFNSRSSRSHAIVLLRLTRCELKTGT 334

Query: 317 EVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL----------- 365
           EV   S ++L DLAGSE   R+  Q  R KE   IN+SLL LG VI  L           
Sbjct: 335 EV--TSTLSLCDLAGSE---RAVTQLVRRKEGAFINKSLLALGTVIAKLSANSAGSGSGS 389

Query: 366 -----ADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAK 420
                +    HIP+R+SKLTR+LQ +L G++    I TI     +  ET++T+ +A++AK
Sbjct: 390 NGQPPSAMGGHIPYRDSKLTRILQPALTGDSIITTICTIDSKSESNSETTNTVRFASRAK 449

Query: 421 NIK---NKPQLGTLVMKDILVKNITREL 445
           NI     K ++ T   KD +++N+ ++L
Sbjct: 450 NISLNVRKNEMDTSNEKDSIIQNLRKQL 477

 Score = 80.5 bits (197), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 66/118 (55%), Gaps = 13/118 (11%)

Query: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 130
           +  D VF      S ++  + +P+ D   +GYN T+  YGMT +GKT+TM+G ++     
Sbjct: 145 FQFDHVFTKEVTNSEVYMALGQPIVDKLFQGYNATIFAYGMTGSGKTFTMSGTKQ----- 199

Query: 131 LSDAAGIIPRILFKLFD-----TLETQDEDYLVKCSFIELYNEELKDLLNEPQESGVI 183
                G+IP  +  +FD     T ++ +  Y VK S++E+YNE++ DLL+  + +G +
Sbjct: 200 ---DPGLIPLCVGNMFDRVMEETSKSTEHKYEVKVSYLEIYNEKIYDLLSITEANGAV 254

>TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.678
           YPL155C
          Length = 468

 Score = 90.9 bits (224), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 56/148 (37%), Positives = 89/148 (60%), Gaps = 8/148 (5%)

Query: 278 INLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHNGEVFRVSKMNLVDLAGSENISR 337
           + L+ +G ++R+V ST+ N  SSRSH +  + +  +  G   RV  + L DLAGSE  S 
Sbjct: 241 LELVAQGNRNRRVRSTQHNTGSSRSHAVLRLRI-TDSMGSKARV--LTLCDLAGSERASV 297

Query: 338 SGAQNQRAKEAGSINQSLLTLG---RVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTA 394
              +  RA E G+IN+SL+ LG   R++N     + H+P+R+SKLTRLL+ SL GN    
Sbjct: 298 HD-RGLRA-EGGAINKSLMALGTVVRLLNETGPSSTHVPYRDSKLTRLLKPSLSGNGLVT 355

Query: 395 LIATISPAKINAEETSSTLEYATKAKNI 422
           ++ T+S +  + E++  TL +A +A  +
Sbjct: 356 MVCTVSLSGTDYEQSLGTLRFARRASGV 383

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 53/109 (48%), Gaps = 23/109 (21%)

Query: 86  IFKQIAEPLF----DDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSDAAGIIPRI 141
           IF +  +PL      D I G   T++ YG T +GKTYTM G         + A G I  +
Sbjct: 122 IFVRDCKPLVHRVATDCISG---TIIAYGATGSGKTYTMHG---------TKAEGGI--V 167

Query: 142 LFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQESGVIKKLRIFD 190
              + D L    ++  +  S++E+YNE L DLL +       K+LRI D
Sbjct: 168 QLSIRDLLTQLSKNCQITISYLEIYNERLHDLLCDG-----TKELRILD 211

>Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C
           (REAL)
          Length = 715

 Score = 90.9 bits (224), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 97/202 (48%), Gaps = 43/202 (21%)

Query: 260 AIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKN--HNGE 317
            + +  L E    +++D +  +  G K R++  T  N  SSRSH I  I L      +G 
Sbjct: 302 GVKVIGLTERRCESSEDLLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTDVRDG- 360

Query: 318 VFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-ADK-------- 368
             R S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L ADK        
Sbjct: 361 TSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTNSVGSII 417

Query: 369 ----------------------------NAHIPFRESKLTRLLQDSLGGNTKTALIATIS 400
                                       + HIP+R+SKLTRLLQ +L G++    I T+ 
Sbjct: 418 PTTPTSSGNSSSSSSSSSGSIVSNSNTSSNHIPYRDSKLTRLLQPALSGDSIVTTICTVD 477

Query: 401 PAKINAEETSSTLEYATKAKNI 422
                A ET +TL +A++AKN+
Sbjct: 478 TRNDAAAETMNTLRFASRAKNV 499

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 66/116 (56%), Gaps = 16/116 (13%)

Query: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 130
           +  D VF        ++++ ++P+ D  + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYEKTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 131 LSDAAGIIPRILFKLFDTLETQ----DEDYLVKCSFIELYNEELKDLLNEPQESGV 182
           L    G+IP  +  LF  +  Q    D+ + V  S++E+YNE + DLL    ESG+
Sbjct: 219 L----GLIPLSVSYLFTNIMEQSMNGDKKFDVVISYLEIYNERIYDLL----ESGL 266

>KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8.678
           YPL155C
          Length = 625

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 64/180 (35%), Positives = 93/180 (51%), Gaps = 21/180 (11%)

Query: 260 AIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNH--NGE 317
            + +  + E     A++ +  +  G   R+   T  N  SSRSH I  + L   +  NG 
Sbjct: 242 GVKVHGVLEQKCDTAEELMKWVSVGEAVRKTGKTDYNMRSSRSHAIIQVKLITTNLLNGT 301

Query: 318 VFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK--------- 368
               + ++L DLAGSE  S    Q +R KE   IN+SLL LG VI+ L+ +         
Sbjct: 302 TH-FNTLSLCDLAGSEKASE---QLERRKEGSFINKSLLALGTVISKLSAESNAHDSSRP 357

Query: 369 ------NAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNI 422
                 N+HIP+R+SKLTRLLQ +L  ++    I TI P K    ET +TL +A++AKN+
Sbjct: 358 SSGSLNNSHIPYRDSKLTRLLQPALCNDSVVTAICTIDPTKEAMTETVNTLRFASRAKNV 417

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 56/112 (50%), Gaps = 6/112 (5%)

Query: 64  AQMNSKTYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGD 123
           A  +   +  D VFGP+A    +F ++   L +    G N T+L YG T +GKTYTM G 
Sbjct: 120 AHWDQGDFQFDHVFGPTATNEDLFAELGGGLVEKLFDGCNATLLAYGTTGSGKTYTMVGH 179

Query: 124 ERLYDGELSDAAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLN 175
               DG +         +  ++ +  + +     V  S++E+YNE++ DLLN
Sbjct: 180 N---DGIVKMCGDC---VFTRMLNAADERQVKRSVTVSYLEIYNEKICDLLN 225

>TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {ON} 
          Length = 672

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 82/144 (56%), Gaps = 5/144 (3%)

Query: 280 LLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHN--GEVFRVSKMNLVDLAGSENISR 337
           L++ G   R   ST MN+ SSRSH++F +M    HN   +     ++NLVDLAGSE + +
Sbjct: 527 LIRNGNNTRNTKSTHMNNASSRSHSVF-MMKITGHNRITQEHSTGRLNLVDLAGSERLQQ 585

Query: 338 SG--AQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTAL 395
                  +  KE  SIN+SL  L  VI+S+  +  +IPFR SKLT LL++SL   +KT +
Sbjct: 586 QEQITSQETLKETTSINKSLTCLADVIHSMKHRQPYIPFRNSKLTYLLKNSLINKSKTLM 645

Query: 396 IATISPAKINAEETSSTLEYATKA 419
              ISP   +  ET ++L  A K 
Sbjct: 646 YVNISPNINSIRETINSLRLARKV 669

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 55/190 (28%), Positives = 85/190 (44%), Gaps = 29/190 (15%)

Query: 5   SSRELSEENGQELNITVSVRCRGRNEREIKAKSS-----VVVTVPDV-TGSNEVSINTTD 58
           S R ++    QEL   + V CR R   + +A +S     + +   D   G   + +N   
Sbjct: 320 SLRRINHNKIQELRGNIRVYCRLRPYIKDEAATSNSDGYIFIKPFDANAGQQRIIVNDLK 379

Query: 59  ELGITAQMNSKTYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTY 118
           +L          +T DK+FG   D   +F  I + L    + GYN  +  YG T +GKTY
Sbjct: 380 QL--------HAFTFDKIFGMQDDNYEVFDDI-KNLVQSSLDGYNVCIFTYGQTGSGKTY 430

Query: 119 TMTGDERLYDGELSDAAGIIPRI---LFKLFDTLETQDEDYLVKCSFIELYNEELKDLLN 175
           TM          L++  GII +    +      L     +Y ++  FIE+YNE ++DLLN
Sbjct: 431 TM----------LNEKDGIIMQTIEYIVHFAGNLHKLGWEYELEVEFIEIYNETIRDLLN 480

Query: 176 -EPQESGVIK 184
            E +   VI+
Sbjct: 481 PEAKHQHVIR 490

>TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa]
           {ON} Anc_2.633 YKL079W
          Length = 644

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 105/206 (50%), Gaps = 28/206 (13%)

Query: 254 LSEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKN 313
           L  + S+I I+NL+  ++T+  + ++  ++G   R +AS       SRS  I  I + + 
Sbjct: 182 LDSKKSSISIKNLRCVYVTSLLEALSYCEKG---RSLAS-------SRSSVIIRITVEQR 231

Query: 314 HN-GEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA------ 366
            N  EVF+     LVDL  S+ I +        +    INQS++TL  V  SLA      
Sbjct: 232 DNVKEVFKTGSFQLVDLGSSDKIDKQNNLGISPENTKKINQSMVTLENVARSLAGTEQSV 291

Query: 367 ------DKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAK 420
                   N +IP++ES LT+LLQ+++GGN KT L+   S AK + EET +TL +    K
Sbjct: 292 KNGRPRSGNYYIPYKESCLTQLLQETIGGNCKTTLVLMCSTAKQDEEETLNTLNFGANMK 351

Query: 421 NIK-----NKPQLGTLVMKDILVKNI 441
            +K     NK    +  M D+L+K+ 
Sbjct: 352 LVKNLFQQNKAGTNSKAMLDLLMKDF 377

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 67/133 (50%), Gaps = 22/133 (16%)

Query: 64  AQMNSKTYTVDKVFGPSAD-----QSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTY 118
           A  N K + VD++F P A       S+I   +A+ LF+    GYN  ++ YG T +GKT 
Sbjct: 64  AGQNLKLFRVDQIFNPGAQTKDTTSSIIGDSVAQ-LFN----GYNVAIMAYGQTDSGKTS 118

Query: 119 TMTGDERLYDGELSDAAGIIPRILFKLFDTLETQDE---DYLVKCSFIELYNEELKDLLN 175
           TM G  +          G+I  +  ++F T+ET  E   DY +  S IE+  E ++DLL 
Sbjct: 119 TMFGYNK--------GDGVINGVCKQIFTTVETGSENNIDYSISLSIIEVNCESIRDLLA 170

Query: 176 EPQESGVIKKLRI 188
              E   + KLR+
Sbjct: 171 PLSEQKPL-KLRL 182

>Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {ON}
           YPL155C (REAL)
          Length = 704

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 66/195 (33%), Positives = 93/195 (47%), Gaps = 35/195 (17%)

Query: 260 AIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNH-NGEV 318
            + +  L E    ++++ +  +  G K R++  T  N  SSRSH I  I L         
Sbjct: 302 GVKVIGLTERRCESSEELLKWIAIGDKSRKIGETDYNARSSRSHAIVLIRLTSTDLESGT 361

Query: 319 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-ADK------NAH 371
            R S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L ADK      N H
Sbjct: 362 SRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKINPTGSNIH 418

Query: 372 IP------------------------FRESKLTRLLQDSLGGNTKTALIATISPAKINAE 407
                                     +R+SKLTRLLQ +L G++    I T+      A 
Sbjct: 419 TTPTNTGSSSSGTVTSNNNIPNNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAA 478

Query: 408 ETSSTLEYATKAKNI 422
           ET +TL +A++AKN+
Sbjct: 479 ETINTLRFASRAKNV 493

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 67/120 (55%), Gaps = 16/120 (13%)

Query: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 130
           +  D VF        ++++ ++P+ D  + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FEFDHVFASHCTNLEVYERTSKPMIDKLLVGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 131 LSDAAGIIPRILFKLFDTL----ETQDEDYLVKCSFIELYNEELKDLLNEPQESGVIKKL 186
           L    G+IP  +  LF  +       D+ + V  S++E+YNE + DLL    ESG+ + L
Sbjct: 219 L----GLIPLSVSYLFSNVMELSMNGDKKFDVIISYLEIYNERIYDLL----ESGLEESL 270

>YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Protein
           that interacts with Myo2p, proposed to be involved in
           exocytosis; N-terminal domain is related to the motor
           domain of kinesins
          Length = 656

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 68/129 (52%), Gaps = 12/129 (9%)

Query: 50  NEVSINTTDELGITAQMNSKTYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVY 109
           N V   T + L  T +    T+  DKVF  +A Q  + K +  P+ +D + GYN TV+ Y
Sbjct: 54  NTVLFRTNNPLHETTKETHSTFQFDKVFDANATQEDVQKFLVHPIINDVLNGYNGTVITY 113

Query: 110 GMTSTGKTYTMTGDERLYDGELSDAAGIIPRILFKLFDTL----ETQDEDYLVKCSFIEL 165
           G + +GK+Y++ G +        ++ GI+P I   LFDTL    ET+ + + V     E+
Sbjct: 114 GPSFSGKSYSLIGSK--------ESEGILPNICKTLFDTLEKNEETKGDSFSVSVLAFEI 165

Query: 166 YNEELKDLL 174
           Y E+  DLL
Sbjct: 166 YMEKTYDLL 174

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 98/205 (47%), Gaps = 28/205 (13%)

Query: 300 SRSHTIFTIML-YKNHNGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 358
           SRSH +F + +  +N   ++ + S + LVDL G+E   +             +NQS+  L
Sbjct: 233 SRSHLVFQLHVEQRNRKDDILKNSSLYLVDLHGAEKFDKRTESTLSQDALKKLNQSIEAL 292

Query: 359 GRVINSLA---------DKNAHI-PFRESKLTRLLQDSLGGNTKTALIATISPAKINAEE 408
              + SL+          K +H   +RES+LT +L+DSLGGN KT +I T   +  N   
Sbjct: 293 KNTVRSLSMKERDSAYSAKGSHSSAYRESQLTEVLKDSLGGNRKTKVILTCFLS--NVPT 350

Query: 409 TSSTLEYATKAKNIKNKPQLGT----------LVMKDILVK--NITRELAKIKSDFLSTK 456
           T STLE+    + I NK    T          L ++D+ +K  N   ++  +K++  S K
Sbjct: 351 TLSTLEFGDSIRQINNKVTDNTTGLNLKKKMDLFIQDMKIKDDNYVAQINILKAEIDSLK 410

Query: 457 SKDGIYMTQDHYKELTSDLENYKTE 481
           S     + +D  K++   LEN K E
Sbjct: 411 SLHNKSLPEDDEKKM---LENTKKE 432

>Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa]
           {OFF} YPR141C (KAR3) - kinesin-like nuclear fusion
           protein [contig 452] PARTIAL
          Length = 588

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/163 (30%), Positives = 73/163 (44%), Gaps = 19/163 (11%)

Query: 15  QELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVD 74
           QEL   + V CR R   + + + S  +++   +  N      T  + I  +     +T D
Sbjct: 357 QELRGNIRVFCRLRPHLDNEKEDSSSISIDGFSDEN-----GTQCITIKREAKYHKFTFD 411

Query: 75  KVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSDA 134
           + FG       IF +I + L    + GYN  +  YG T +GKTYTM          L+  
Sbjct: 412 RCFGAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM----------LNPE 460

Query: 135 AGIIPRILFKLFDTLETQDE---DYLVKCSFIELYNEELKDLL 174
            GIIP  L  +F  +E   E    Y +   FIE+YNE +KDL 
Sbjct: 461 DGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLF 503

 Score = 36.6 bits (83), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%)

Query: 258 SSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIML 310
           S   +I N+    +TN +   ++L R +K R  A+T  N  SSRSH++F I L
Sbjct: 527 SQTTHITNITVCKLTNREMVNSILVRAMKMRSTAATSANARSSRSHSVFIIKL 579

>Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)
           [1974 bp, 657 aa] {ON} ANNOTATED BY YGOB -
          Length = 657

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/163 (30%), Positives = 73/163 (44%), Gaps = 19/163 (11%)

Query: 15  QELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVD 74
           QEL   + V CR R   + + + S  +++   +  N      T  + I  +     +T D
Sbjct: 357 QELRGNIRVFCRLRPHLDNEKEDSSSISIDGFSDEN-----GTQCITIKREAKYHKFTFD 411

Query: 75  KVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSDA 134
           + FG       IF +I + L    + GYN  +  YG T +GKTYTM          L+  
Sbjct: 412 RCFGAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM----------LNPE 460

Query: 135 AGIIPRILFKLFDTLETQDE---DYLVKCSFIELYNEELKDLL 174
            GIIP  L  +F  +E   E    Y +   FIE+YNE +KDL 
Sbjct: 461 DGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLF 503

 Score = 36.6 bits (83), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%)

Query: 258 SSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIML 310
           S   +I N+    +TN +   ++L R +K R  A+T  N  SSRSH++F I L
Sbjct: 527 SQTTHITNITVCKLTNREMVNSILVRAMKMRSTAATSANARSSRSHSVFIIKL 579

>Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {ON}
           complement(20458..22401) [1944 nt, 648 aa]
          Length = 647

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 55/174 (31%), Positives = 84/174 (48%), Gaps = 15/174 (8%)

Query: 296 NDFSSRSHTIFTIMLYK-NHNGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQS 354
           N+   RSHTI  + + K N   E   +S + +VDLAGS+ I ++ +     ++A  IN  
Sbjct: 225 NNLIQRSHTIMEVSIEKRNKLDESITMSSLYIVDLAGSDPIGKNSSSGITTEDAKKINHQ 284

Query: 355 LLTLGRVINSLADKNAH-------------IPFRESKLTRLLQDSLGGNTKTALIATISP 401
           + ++  VIN L   N               +P++ S LTRLL D LGGN KT  + T S 
Sbjct: 285 IKSVNDVINGLVVMNREGGIMTDISTLMHKVPYKSSILTRLLLDPLGGNCKTTFLLTSSL 344

Query: 402 AKINAEETSSTLEYATKAKNIKNKPQLGTLVMKDILVKNITRELAKIKSD-FLS 454
            K +  ET STL++    K+    P++    +      +I     K+K D F+S
Sbjct: 345 KKNDWNETLSTLKFGYNCKSANTNPRINRFGLNSKATMDIFLTDMKLKEDNFIS 398

 Score = 64.3 bits (155), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 80/147 (54%), Gaps = 22/147 (14%)

Query: 53  SINTTDE--LGITA-QMNSKTYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVY 109
           SIN TD    G +  Q+ +  Y  DKVF  S D  +  ++  E   +  ++GYN +++ Y
Sbjct: 52  SINFTDTQLTGFSKDQVVNTQYKFDKVFA-SNDTGVEHQEFIESNLESLLQGYNTSIVTY 110

Query: 110 GMTSTGKTYTMTGDERLYDGELSDAAGIIPRILFKLFDTLE------TQDEDYLVKCSFI 163
           G + TGK++ + G+++          G+I ++L KLF+ ++       ++  Y VK SF+
Sbjct: 111 GQSGTGKSFELYGEQQ---------DGLIFQLLTKLFNRIDEEMGNNNKNIHYTVKFSFL 161

Query: 164 ELYNEELKDLLNEPQESGVIKKLRIFD 190
           E+Y E++ DL++ P    V K L+I D
Sbjct: 162 EVYQEKMFDLMDSP---SVKKHLKIND 185

>Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079W
           (REAL)
          Length = 657

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 59/109 (54%), Gaps = 12/109 (11%)

Query: 70  TYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDG 129
           T+  DKVF  +A Q  +   + +P  +D + GYN T+L YG + +GK+Y++ G +     
Sbjct: 75  TFQFDKVFDANATQKDVQDFLLDPTINDVLSGYNSTILTYGPSFSGKSYSLIGPQ----- 129

Query: 130 ELSDAAGIIPRILFKLFDTLETQDE----DYLVKCSFIELYNEELKDLL 174
              D  GI+P I   LF TLE +++    ++ V     E+Y E+  DLL
Sbjct: 130 ---DGGGILPNICKALFSTLEDREKNKGNNFSVSVLAFEIYMEKTYDLL 175

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 80/316 (25%), Positives = 138/316 (43%), Gaps = 60/316 (18%)

Query: 300 SRSHTIFTIML-YKNHNGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 358
           SRSH +F + +  +N   ++ + S + L+DL G+E   +             +NQS+  L
Sbjct: 234 SRSHVVFQLHVEQRNRRHDILKNSSLYLIDLHGAEKFDKRIENTLSQDSLKKLNQSIEAL 293

Query: 359 GRVINSL---------ADKNAHIP-FRESKLTRLLQDSLGGNTKTALIATISPAKINAEE 408
              + SL         + K +H   +RES+LT +L+DSLGGN KT +I T   +  N   
Sbjct: 294 KNTVQSLEIKSMDSVYSAKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLS--NVPT 351

Query: 409 TSSTLEYATKAKNIKNKPQLGTLVMKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDHY 468
           T STL++    + I N+      VM +    N+ +++     D    K KD  Y++Q   
Sbjct: 352 TLSTLKFGDSIRQINNR------VMDNTSGLNLRKKMDLFVQDM---KIKDDNYISQ--- 399

Query: 469 KELTSDLENYKTEVQECKREIEKMNSQNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLY 528
                 +   K EV+  K +  + +S+     +D     + S+ +  K+K   D IA L 
Sbjct: 400 ------INILKAEVEILKGQSSESDSK-----EDMATKFDDSKKENTKLKLQLDSIAQLL 448

Query: 529 DKMDKQHKNEQDLVCTIHTLKDAIYTVQNSLKNCE---------DYQLQCKSEMEDVLYD 579
            K+  +  N        +++ D +  +   +  CE         D Q+   S++E  L  
Sbjct: 449 GKLTNEEPN--------NSINDEVSVIL--MNRCEQIAQLELSFDRQVNANSKLEKEL-- 496

Query: 580 HVTSFKQSIHEQLAAM 595
               +K+S  E L +M
Sbjct: 497 ---EYKKSKEEALESM 509

>Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 60/109 (55%), Gaps = 12/109 (11%)

Query: 70  TYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDG 129
           T+  DKVF  +A Q  +   +  P  DD + GYN T++ YG + +GK+Y++ G +   +G
Sbjct: 74  TFKFDKVFDTNATQEDVQDFLVRPSIDDVLSGYNGTIITYGPSFSGKSYSLLGSQ---EG 130

Query: 130 ELSDAAGIIPRILFKLFDTL----ETQDEDYLVKCSFIELYNEELKDLL 174
           E     GI+P I   LF+TL    ET+  ++ V     E++ E+  DLL
Sbjct: 131 E-----GILPNICKVLFETLEKNKETKGNNFSVSVLAFEIFMEKTYDLL 174

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 57/193 (29%), Positives = 91/193 (47%), Gaps = 15/193 (7%)

Query: 246 LINNKQQSLSEQSSA--IYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSH 303
           L N K   L   SS   + I+++   HI + KD  + +Q             N   S+SH
Sbjct: 177 LTNRKPLKLHRSSSKMDLEIKDICPAHIRSYKDLKSYIQSVQNTDNRMGYSGNTERSKSH 236

Query: 304 TIFTIML-YKNHNGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI 362
            +F + +  +N N ++ R S + L+DL G+E   +             +NQS+  L  ++
Sbjct: 237 LVFQLHVEQRNRNADILRKSSLYLIDLHGAERFDKRTEVTLSQDALKKLNQSIEALKNIV 296

Query: 363 N--SLADKNAHIP--------FRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSST 412
              S+ D+++           +RES+LT +L+DSLGGN KT +I T   +  N   T ST
Sbjct: 297 RLLSVKDRDSAYSVKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLS--NVSTTLST 354

Query: 413 LEYATKAKNIKNK 425
           LE+    + I NK
Sbjct: 355 LEFGECIRQITNK 367

>KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2.633
           YKL079W
          Length = 522

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 39/115 (33%), Positives = 65/115 (56%), Gaps = 10/115 (8%)

Query: 69  KTYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYD 128
           +T+++DKVF PSA Q+ +   +  P+ D+   G N  +   G + TGKT+TM G + +  
Sbjct: 42  RTFSLDKVFPPSASQADVTAVLLGPIVDNLAHGVNVQMASLGDSQTGKTHTMLGQQGV-- 99

Query: 129 GELSDAAGIIPRILFKLFDTLETQDEDYLVKCSF--IELYNEELKDLLNEPQESG 181
                + G++ RIL K+F  L  ++E   V+ S   +EL N+++ DLLN+    G
Sbjct: 100 -----SQGLLQRILTKVFQ-LMNENEGVTVQYSLSAVELVNDKVYDLLNKRSPLG 148

>Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 58/109 (53%), Gaps = 12/109 (11%)

Query: 70  TYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDG 129
           T+  DKVF  +A Q  +   +  P   D + GYN T+L YG + +GK+Y++ G +  Y+ 
Sbjct: 74  TFQFDKVFDANATQKDVQDFLVNPTIKDILSGYNSTILTYGPSFSGKSYSLLGSQ--YN- 130

Query: 130 ELSDAAGIIPRILFKLFDTLETQDE----DYLVKCSFIELYNEELKDLL 174
                 G++P I   LF+TLE  +E    ++ V     E+Y E+  DLL
Sbjct: 131 -----EGVLPNICQVLFETLEENEETKGTNFCVSVLAFEIYMEKSYDLL 174

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 64/215 (29%), Positives = 100/215 (46%), Gaps = 26/215 (12%)

Query: 300 SRSHTIFTIML-YKNHNGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 358
           S+SH +F + +  +N   ++ + S + L+DL G+E   +             +NQS+  L
Sbjct: 233 SKSHLVFQLHVEQRNRREDILKNSSLYLIDLHGAEKFEKRTENTLSQDALKKLNQSIEAL 292

Query: 359 GRVINSLADKNAHIPF----------RESKLTRLLQDSLGGNTKTALIATISPAKINAEE 408
             ++  LA KN    +          RES+LT +L+DSLGGN K  +I T   +  N   
Sbjct: 293 KNIVQLLAVKNPDSAYSTKASHSSTYRESQLTEVLRDSLGGNRKMKVILTCFLS--NVPT 350

Query: 409 TSSTLEYATKAKNIKNKPQLGTLVMKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDHY 468
           T STLE+    + I NK      VM      N+ +++     D    K KD  Y++Q + 
Sbjct: 351 TISTLEFGDNIRQIINK------VMSSTTGLNMKKKMDLFVQDM---KIKDDNYVSQINI 401

Query: 469 --KELTS--DLENYKTEVQECKREIEKMNSQNVLL 499
              EL S  DL N  +  ++ K E+E    +NV L
Sbjct: 402 LKSELDSLKDLSNESSSREDMKTELENYEKENVKL 436

>TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {ON}
           Anc_2.633 YKL079W
          Length = 682

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 100/203 (49%), Gaps = 16/203 (7%)

Query: 260 AIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYK-NHNGEV 318
            + + NL++ H+ + K+ +    + +    V ++K ++   R++TIF I + K +   E 
Sbjct: 208 GLPVDNLRQVHVASFKETLYYFNQAM---SVLNSKHDNSFPRTNTIFNINIEKLDKLDES 264

Query: 319 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD------KNAH- 371
              S + LVDLAGS+ I R  +    +++   IN S+ ++  +I SL+       KN   
Sbjct: 265 TTSSSIYLVDLAGSDLIDRKNSSGVNSEDVKRINSSIKSVQNIITSLSKLSYSDYKNYEF 324

Query: 372 -----IPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKP 426
                +P+  SKL +LL++ LGGN KT  + TIS      ++    L+  T  ++ K  P
Sbjct: 325 SLENSVPYDSSKLGKLLKEPLGGNCKTNFLFTISMNPEQYDDIIEALQLGTILQDSKTVP 384

Query: 427 QLGTLVMKDILVKNITRELAKIK 449
           Q+    + +    +I  E  K+K
Sbjct: 385 QINKFGLNENKTLSIALENFKLK 407

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 75/147 (51%), Gaps = 16/147 (10%)

Query: 50  NEVSINTTDELGITAQMNSK-TYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLV 108
           N + +N   ++   +  NS  ++    +F   ++  LI   I   + D+ ++GYN  ++ 
Sbjct: 62  NTIPVNNNHKMNGDSLPNSNNSFEFTHIFDRDSNIDLIGNTIVTGMIDEAMEGYNTALVT 121

Query: 109 YGMTSTGKTYTMTGDERLYDGELSDAAGIIPRILFK-LFDTLETQDED------YLVKCS 161
           YG   +GKTY+      LY  ++ D+ G + +I+FK LF  +     D      ++VK S
Sbjct: 122 YGPKYSGKTYS------LYGNDVDDSFG-LGQIIFKDLFSRINKSVTDSNAKYTFIVKIS 174

Query: 162 FIELYNEELKDLLNEPQESGVIKKLRI 188
           F+E++ +++ DLL  PQ    +  L+I
Sbjct: 175 FLEVWLDKVVDLL-APQNLTKLPHLKI 200

>NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633
          Length = 660

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 58/106 (54%), Gaps = 10/106 (9%)

Query: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGD-ERLYDG 129
           Y  D +F   + ++  +  I + L DD  KGYN T++ YG TS+GK++ + GD +   DG
Sbjct: 86  YQFDSIFDVDSKETEFYDSITDNLIDDISKGYNTTIMTYGPTSSGKSHALFGDPDSTNDG 145

Query: 130 ELSDAAGIIPRILF-KLFDTLETQDEDYLVKCSFIELYNEELKDLL 174
            ++  A    R+LF +  D L+T     L   S  ELY +++ DLL
Sbjct: 146 LINHIAD---RLLFPQCEDNLKT-----LCSISMWELYIDKVYDLL 183

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 98/200 (49%), Gaps = 23/200 (11%)

Query: 262 YIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHNGEVFRV 321
           +I++L + H+T+  +  + L+ G K+     + ++   S+    F +    +   +V R 
Sbjct: 198 HIRDLHQIHVTSPIEIKDTLKNGYKN----ISPLHHSKSQIFVRFEVQCI-DRKDDVTRC 252

Query: 322 SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK----NAHIPFRES 377
           S +  +DL GS+ +++  A    + +    NQ +  L  +I +L ++    ++H  F++S
Sbjct: 253 SSITFIDLCGSDLLTKQNASKLSSDDIKKFNQMIYLLQNLIKTLPEEQSTNSSH--FKDS 310

Query: 378 KLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGTLVMK--- 434
            L ++L D LGG+TK  L+  I     N       ++   KAK IKN P +  + +    
Sbjct: 311 SLNKILMDYLGGDTKMTLVVAIDG---NTGGYEDAVKLGAKAKLIKNYPTMNKIGLNAKR 367

Query: 435 --DILVKNITRE----LAKI 448
             D+LV+++  +    LAKI
Sbjct: 368 KMDLLVQDMNVKEQNYLAKI 387

>ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar to
           uniprot|Q759X8 Ashbya gossypii ADR145C ADR145Cp and
           weakly similar to YKL079W uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a kinesin
           colocalizes with Myo2p kinesin heavy chain homolog
          Length = 668

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 58/118 (49%), Gaps = 12/118 (10%)

Query: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 130
           +  +KV+     Q  + + I      + + G+N +++ +G   +GKTYTM G++      
Sbjct: 68  FRFNKVYDVGVRQQEVCEDIIGDNVMELLAGFNVSIMAFGSEGSGKTYTMFGNDH----- 122

Query: 131 LSDAAGIIPRILFKLFDTLETQDED----YLVKCSFIELYNEELKDLLNEPQESGVIK 184
                GI+ R+   +FD L+   ED      +  +F EL+ E + DLL+  + S V+K
Sbjct: 123 ---EEGIVQRMCQSIFDQLDKLHEDSGNESTISINFFELFAENVYDLLSLQKNSKVLK 177

 Score = 51.6 bits (122), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 49/171 (28%), Positives = 83/171 (48%), Gaps = 24/171 (14%)

Query: 300 SRSHTIFTIML-YKNHNGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 358
           SRS     I +  +N   E  + S + L+DLA S+ + ++   +    E  S N S+  L
Sbjct: 224 SRSSAFLNITVEQRNKKEETLKHSVLQLIDLASSDKLDKNLKYDISTDEMKSTNSSMQNL 283

Query: 359 GRVINSLAD-----------KNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAE 407
            +V+  L++           K+ H   R S+L + LQ ++GG++KT  +   S  K + E
Sbjct: 284 HQVVYGLSELESPSSKNHSSKHTH---RTSRLAKFLQQAIGGDSKTTAVMLSSTDKADRE 340

Query: 408 ETSSTLEYATKAKNIKNKP-----QLGTLVMKDILVKNI-TRE---LAKIK 449
            T  TL   ++ ++I N P      L +  + D+ +KN+ TRE   L +IK
Sbjct: 341 NTVITLSLGSRLRSIHNFPVQNKMGLNSKALLDLRLKNMSTREDSYLTRIK 391

>NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}
           Anc_2.633
          Length = 598

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 89/176 (50%), Gaps = 19/176 (10%)

Query: 262 YIQNLQEFHITNAKDGINLLQRGLK-HRQVASTKMNDFSSRSHTIFTIMLYKNH------ 314
           +++NL    I +  D    LQ+  K   Q +S  +N  +++     +I++ K H      
Sbjct: 205 HVKNLSHIQIASLDD----LQKWFKIGCQRSSAIINAGTAKEKRSNSIIISKIHLEQVNP 260

Query: 315 NGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPF 374
             +++++S ++ +DL G +  ++   Q     E   +N  + +   +I +L+D  + +P+
Sbjct: 261 KDQLYKLSTLSFIDLYGIDKFTKKDIQ-LTNDEMKKLNTLMSSFQNLITTLSDPKS-LPY 318

Query: 375 -----RESKLTRLLQDSLGGNTKTALIATI-SPAKINAEETSSTLEYATKAKNIKN 424
                ++S L ++LQD +GGN+KT  I    SP+ I  EE    L++A   K+IKN
Sbjct: 319 TSSLYKDSALNKILQDYIGGNSKTTFIIPFPSPSIIQHEELIEMLKFAMGLKSIKN 374

 Score = 32.3 bits (72), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 49/94 (52%), Gaps = 15/94 (15%)

Query: 63  TAQMNSKTYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTG 122
           T +++S+ +  D +F  +++Q+   + +      D   GYN + + YG +++GK+ T+  
Sbjct: 61  TLKLDSQDFKFDNIFPTNSEQN---EMLTVSTIKDLFDGYNQSFITYGKSNSGKSDTL-- 115

Query: 123 DERLYDGELSDAAGIIPRILF-KLFDTLETQDED 155
                    ++  G+I R+LF +LF  +++   D
Sbjct: 116 --------FNEKDGLI-RLLFEQLFKKVQSLTAD 140

>TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {ON}
           Anc_2.633 YKL079W
          Length = 693

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 68/131 (51%), Gaps = 7/131 (5%)

Query: 301 RSHTIFTIMLYKNHNGEVFRV-SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLG 359
           RS TI  I L +    E     S +  VDLAGS+  S+   +    + A   N+ + +L 
Sbjct: 265 RSSTILRIKLLQLDEDEDLETQSTICFVDLAGSDRASKDIEKGITREAASKYNRVMDSLN 324

Query: 360 RVINSLADK-----NAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLE 414
            ++ +LA+      N  I +R S LTR+L D L GN KT LI + S  K +  ET STL 
Sbjct: 325 SMVYTLANSESISINKSI-YRNSHLTRILYDLLAGNHKTNLIFSCSLNKDDEYETFSTLG 383

Query: 415 YATKAKNIKNK 425
           +++ A ++ N+
Sbjct: 384 FSSYASSMSNQ 394

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 60/153 (39%), Gaps = 48/153 (31%)

Query: 68  SKTYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLY 127
           S  Y  DK+F P      I   ++    +D  KGYN T + YG T TGKTYT+ G    +
Sbjct: 55  SNQYRFDKIFEPEKPDDEINSTLSFACINDLFKGYNSTYISYGQTGTGKTYTLYG--TAF 112

Query: 128 DGELSDA-----------------------------------------AGIIPRI---LF 143
           +   +D                                           G+I ++   LF
Sbjct: 113 NDTPTDLDSKNINTNKNVKNDSNISSNSNIQTSASSNKSANSILQKKNYGLISKVGNDLF 172

Query: 144 KLFDTLET--QDEDYLVKCSFIELYNEELKDLL 174
           ++ D +    +   +LV  SF+E+Y EE+ DLL
Sbjct: 173 EMIDQIRAIRKGITFLVNISFVEVYKEEVYDLL 205

>TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.633
           YKL079W
          Length = 803

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 82/167 (49%), Gaps = 18/167 (10%)

Query: 259 SAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNH-NGE 317
           S++ I+NL++ ++ + ++  + L  G  +R      M   +SRS+ +  I L +     +
Sbjct: 235 SSLEIENLRQVYVESFEELNSYLIEGRSNRN-----MKHLTSRSNIVIKINLEQVFLEDQ 289

Query: 318 VFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRE- 376
           + + S + L+D+A S+ I ++ +    AKEA  +N  + +    IN LA+     P+ + 
Sbjct: 290 LMKCSSLILLDMAASDYIDKNDSLGISAKEAKKLNYPMESFTSYINLLAETGTS-PYDQQ 348

Query: 377 ----------SKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTL 413
                     S L  ++   +GGN KT  I+TISP   N  ET  TL
Sbjct: 349 INGKKSNDYNSNLVDIMSIPIGGNCKTLFISTISPLLANQNETFITL 395

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 71  YTVDKVFGPSADQS-LIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERL 126
           + VDKVF     QS L+   I +    +   G+N +++ +G + TGK++TM G+  L
Sbjct: 51  FQVDKVFDRFTKQSDLLSSDIVKNKISELFDGFNSSIIAFGQSGTGKSFTMFGNNSL 107

>KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.633
           YKL079W
          Length = 667

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 69/266 (25%), Positives = 119/266 (44%), Gaps = 37/266 (13%)

Query: 255 SEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDF--SSRSHTIFTIML-Y 311
           ++Q    Y ++L    +T+  + IN +     +R   S    ++   S+SH I  I +  
Sbjct: 172 TKQDDEYYFKDLHVAFVTSRDELINYIMDAESNRFSGSCLHTNYVQRSKSHLITKINVEQ 231

Query: 312 KNHNGEVFRVSKMNLVDLAGSENISRSG--AQNQRAKEAGSINQSLLTLGRVINSLAD-- 367
           +N N +V +   ++  DLA  + I +    +    + E   +N    TL   I S+++  
Sbjct: 232 RNLNEDVVKRGSISFFDLAAIDFIDKDSMVSLGLTSDEVKKLNLESTTLKNSIISMSELS 291

Query: 368 --KNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIK-- 423
              NA IP++ S LT+LL     GN KT +I T S  K N  ET  TL+   K ++I   
Sbjct: 292 ENPNAVIPYKNSNLTKLLNQCFMGNMKTTVILTCSMLKSNEAETLETLKMGLKLESISSN 351

Query: 424 ---NKPQLGTLVMKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYK- 479
              NK  L +    D++V+++              KSK+  YM  +  + L ++L + + 
Sbjct: 352 VHMNKHALNSKKKLDLIVEDM--------------KSKEANYM--NRIRLLETELNDLRA 395

Query: 480 ------TEVQECKREIEKMNSQNVLL 499
                 +E    K E+ K  ++NV L
Sbjct: 396 SYGEAISETSSFKEEMNKERAKNVKL 421

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 52/106 (49%), Gaps = 11/106 (10%)

Query: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 130
           Y  D V   S +   ++  I   L ++  +GY+  V+ YG   TGK+    G +  Y+G 
Sbjct: 63  YQFDSVHEKSTE---LYNGIKGDLINNIFEGYHTGVITYGSAGTGKSSIFYGTDSTYEG- 118

Query: 131 LSDAAGIIPRILFKLFDTLET--QDEDYLVKCSFIELYNEELKDLL 174
                G++   +  L+D +++   D  + V  S IE++ E++ DLL
Sbjct: 119 -----GVVLMFVQDLYDKIDSIGNDTHFTVSLSTIEIHLEKMYDLL 159

>CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa]
           {ON} similar to uniprot|P32364 Saccharomyces cerevisiae
           YKL079w SMY1 kinesin-related protein
          Length = 675

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 83/188 (44%), Gaps = 25/188 (13%)

Query: 260 AIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTI---MLYKNHNG 316
            +Y Q     +I + K+   +++    +++ +  KM+   S SH +       L + H  
Sbjct: 205 GLYYQEANNEYINSIKEFDRVMKLIQDNKEASEKKMDSKRSTSHVVIRCSVEQLDRVHG- 263

Query: 317 EVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL---ADKN---- 369
                S +   DL GS    +   Q    +    +N S+  L  V+NS+     KN    
Sbjct: 264 -TITSSNIMFADLCGSNRFEKDVDQKLGVENIKKLNLSISNLESVVNSVLQNQQKNHLYI 322

Query: 370 -------------AHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYA 416
                          +P+++S+LT L+Q++LGGN++T ++      K + EET +TL + 
Sbjct: 323 ENKLVPSVNSSDLQRVPYKDSQLTGLIQEALGGNSRTRVVLNCFDDKSHHEETIATLRFG 382

Query: 417 TKAKNIKN 424
            + +NI N
Sbjct: 383 VQLQNILN 390

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 40/84 (47%), Gaps = 8/84 (9%)

Query: 55  NTTDELGITAQMNSKTYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTST 114
           NT     IT   +   +  +KV+        I K ++E +  D   GY+ +++ YG   +
Sbjct: 71  NTIIHYPITNFADESIFNFEKVYDVGVPLVDIHKSLSESVLKDIYDGYDVSIISYGEAGS 130

Query: 115 GKTYTMTGDERLYDGELSDAAGII 138
           GK++T+ G+E        D+ GII
Sbjct: 131 GKSFTLFGNE--------DSDGII 146

>KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633
           YKL079W
          Length = 681

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 64/134 (47%), Gaps = 10/134 (7%)

Query: 46  VTGSNEV-SINTTDELGITAQMNSKTYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNC 104
           V  SN V ++N T       ++  ++++  KV    A ++  F ++A  + DD + G NC
Sbjct: 69  VGNSNHVQTVNDT-----VVKLGEQSFSFSKVLNDQATKTEQFTELASKVTDDVLSGINC 123

Query: 105 TVLVYGMTSTGKTYTMTGDERLYDGELSDA---AGIIPRILFKLFDTLETQD-EDYLVKC 160
            V  YG      +  M G +     E  D+   +G++ +    +F+ +++    +Y V  
Sbjct: 124 CVTTYGSGLAADSLVMFGPQSGNSKEEQDSSRCSGLLQQTCKHIFNAIDSDSTSEYQVSL 183

Query: 161 SFIELYNEELKDLL 174
           S  E+Y +++ DLL
Sbjct: 184 SLCEVYVDKVFDLL 197

>NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON}
           Anc_2.633 YKL079W
          Length = 572

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 54/103 (52%), Gaps = 19/103 (18%)

Query: 91  AEPLFDDFI----KGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSDAAGIIPRILFKLF 146
            EPL  D I    +G +C+++ YG ++TGKT+ +    R          GIIP  + +L+
Sbjct: 65  PEPLVIDNINELTRGVDCSMVTYGQSATGKTHVLFDQVR----------GIIPLFIEQLY 114

Query: 147 DTLETQ-DEDYLVKCSFIELYNE-ELKDL---LNEPQESGVIK 184
             LE Q D  Y +  S  E  ++ +++DL   LN+PQ+   +K
Sbjct: 115 IYLEAQSDLQYQIGLSVWEADSKGKIRDLLVPLNDPQQQKSLK 157

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 67/152 (44%), Gaps = 28/152 (18%)

Query: 283 RGLKHRQVAS-TKMNDF--------SSRSHTIFTIML-YKNHNGEVFRVSKMNLVDLAGS 332
           +GLK   V+S  ++ D+        +S  HT   I L   N + + FR   +  VDL   
Sbjct: 166 KGLKEVFVSSRCELQDYLNAACDLQNSTFHTFVKISLQLVNCHEDSFRKCCIEFVDLCAQ 225

Query: 333 ENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTK 392
           E++                 Q + +L  V+++  D +  I   +S+  +LL +S+GGN K
Sbjct: 226 EDVL----------------QLVCSLVAVLSN--DNDKKIGKEKSQFCKLLSNSIGGNRK 267

Query: 393 TALIATISPAKINAEETSSTLEYATKAKNIKN 424
           T  I   S  + N + +  TLE+  K   + N
Sbjct: 268 TTFILACSTLEQNEKISLETLEFGLKVSQVVN 299

>NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401
          Length = 874

 Score = 35.8 bits (81), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 56/127 (44%), Gaps = 15/127 (11%)

Query: 276 DGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHNGEVFRV---------SKMNL 326
           D I LL    K+  V S  +N     S T   + L +      F           S+  +
Sbjct: 372 DAIELLGSTFKNLSVRSYAVNRLKKASDTELELYLLQLVQAVCFENISTFSDKTNSEFTI 431

Query: 327 VDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHI---PFRESKLTRLL 383
           VD+ G++++ +S  QN   K    +N SLLTLG+ IN+L      I   P  E  + R L
Sbjct: 432 VDMNGTQHLGKS--QNVMPKTT-ELNSSLLTLGKSINNLNLDEMPIVISPLAEFLIRRAL 488

Query: 384 QDSLGGN 390
           ++S  GN
Sbjct: 489 KNSRLGN 495

>TBLA0A02600 Chr1 complement(630904..632709) [1806 bp, 601 aa] {ON}
           Anc_5.466 YOR132W
          Length = 601

 Score = 33.9 bits (76), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 24/37 (64%)

Query: 654 LLDISTVVDSYSNELVKNLGDISEEYNNFREYLNEHL 690
           + D+ST + ++  +L +N+    EE+NNF +YLN  L
Sbjct: 121 IFDVSTNIPTFRRKLYRNIKKTYEEFNNFFKYLNGSL 157

>TBLA0F00220 Chr6 complement(34471..40722) [6252 bp, 2083 aa] {ON}
            Anc_6.373 YCR093W
          Length = 2083

 Score = 34.3 bits (77), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 66/134 (49%), Gaps = 5/134 (3%)

Query: 534  QHKNEQDLVCTIHTLKDAIYTVQNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLA 593
            ++++E D    +H +   +  ++ + K     +L  K++++DVL   +T   QS  +   
Sbjct: 1325 RNESEHDHRMLVHLMDSLVAQIKENAKKKTLSELGEKNQIKDVLLQILTCIAQSAQKDQL 1384

Query: 594  AMKASHSSRH-LGIDGNIDIIQEELSQVLESICSTSVDVCRSCVEKILES--NPKHFESI 650
            AMK + +  + L       + +E LS +LE +CS S+   +  V  ++ S  N K    +
Sbjct: 1385 AMKVAQAVVNSLFATSESPLCREVLSLLLEKLCSLSIVARKDVVWWLVYSQDNRKLSIPV 1444

Query: 651  RRDLLDIS--TVVD 662
             + LLD+   TV+D
Sbjct: 1445 IKSLLDVHLITVLD 1458

>KLLA0B13882g Chr2 (1216203..1217858) [1656 bp, 551 aa] {ON} highly
           similar to uniprot|P40413 Saccharomyces cerevisiae
           YJR064W CCT5 Subunit of the cytosolic chaperonin Cct
           ring complex related to Tcp1p required for the assembly
           of actin and tubulins in vivo
          Length = 551

 Score = 33.9 bits (76), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 57/125 (45%), Gaps = 31/125 (24%)

Query: 703 VDKTYHMLKKSAGELFSKFKEMMDSHL-------------EENKSLMIKSLKTA-SDEVV 748
           ++K  H +K + G  F K  ++  +HL             EE KS + K+ KT+   ++V
Sbjct: 130 IEKGVHPIKIANG--FDKASQIAIAHLDSQADDISASATQEEFKSYLFKAAKTSLGSKIV 187

Query: 749 AKEVKLFAPVKQKWESSLENINKCDSLNNTFDSTVKDA---LRRLEGNIEGSLEFSKNTA 805
           +K+  LFA +              D++    DS  +D    L +LEG + GSL+ SK   
Sbjct: 188 SKDHDLFAQMA------------VDAITTVMDSNRRDVDFDLIKLEGRVGGSLKDSKLIK 235

Query: 806 GDVKD 810
           G V D
Sbjct: 236 GVVID 240

>Kwal_55.21914 s55 (1034239..1042167) [7929 bp, 2642 aa] {ON} YLR454W
            - Hypothetical ORF [contig 124] FULL
          Length = 2642

 Score = 33.5 bits (75), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 32/48 (66%), Gaps = 1/48 (2%)

Query: 543  CTIH-TLKDAIYTVQNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIH 589
            C++H +++  IY +++ +K+ E+ + Q   +++D+  D  TS++ S+H
Sbjct: 1829 CSLHKSVRSPIYLIEDRMKSLEERRAQVVQQLKDINGDATTSYQSSLH 1876

>ZYRO0A03036g Chr1 (245136..247739) [2604 bp, 867 aa] {ON} similar
           to uniprot|P19735 Saccharomyces cerevisiae YBR055C PRP6
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 867

 Score = 33.1 bits (74), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 48/167 (28%), Positives = 74/167 (44%), Gaps = 24/167 (14%)

Query: 705 KTYHMLKKSAGELFSKFKEMMDSHLEENKSLMIKSLKTASDEVVAKEVKLFA-PVKQKWE 763
           +T H L ++A    S+F++      E   S ++  L  +  +VV  ++ L + P K  + 
Sbjct: 437 RTAHALTQAA---LSEFQD------EYEASRVVSELSDSIVKVVGFKILLKSNPTKYSFW 487

Query: 764 SSL----ENINKCDSLNNTFDSTVKDA---LRRLEGNIEGSLEFSK---NTAGDVKDSLK 813
            SL    E +NK D L NTF++ + D     R L+ N   SL +SK       D+  SL+
Sbjct: 488 QSLKKLCEKLNKMDELYNTFETLLFDESENFRILKQNPLLSLMYSKEIWKNGHDIPKSLE 547

Query: 814 KFDGISEVLKNNTKVVNNINEVKEKHTFLRDQVERTSSYIEAANEKF 860
             D    +L N+ +V       K K   L DQVE        A E+ 
Sbjct: 548 ILDRAQNILPNSLEVW----LAKLKFLCLTDQVELAQKSFAMAMERL 590

>Smik_13.244 Chr13 (383826..385331) [1506 bp, 501 aa] {ON} YMR065W
           (REAL)
          Length = 501

 Score = 32.7 bits (73), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 60/132 (45%), Gaps = 17/132 (12%)

Query: 669 VKNLGDISEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKFKEMMDSH 728
           + NL D+ E  ++ REY     FKNN  E ++I +D     LK+  G +    K++ +S 
Sbjct: 280 LNNLQDLVEMSHDVREYY----FKNN--ELVNIELDNFLMGLKEQLGGMS---KDLSESQ 330

Query: 729 LEE-------NKSLMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSL-NNTFD 780
           +E        N  L    L + +DE+V +       + Q+W S    +NK  +L N    
Sbjct: 331 MEAIELLQGFNSVLHDSLLPSMTDEIVPEMTNFKNSILQEWSSITSTLNKDFALWNEEIF 390

Query: 781 STVKDALRRLEG 792
           ST  +   RL G
Sbjct: 391 STFSEISERLNG 402

>Cgla_YGOB_Anc_5.639 Chr12 (1072242..1072856,1072860..1073696) [1452
           bp, 483 aa] {ON} ANNOTATED BY YGOB -
          Length = 483

 Score = 32.7 bits (73), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 55/134 (41%), Gaps = 19/134 (14%)

Query: 249 NKQQSLSEQSSAI---------YIQNLQEFHITNAKDGIN--LLQRGLKHRQVASTKMND 297
           +K+Q L  Q  AI         Y   LQ F      + IN  LLQ  +   ++A+     
Sbjct: 146 SKEQDLLHQKPAIIVLREDLDYYCVPLQTFKFATDDEQINDDLLQHYMTQVKLAAGSHLT 205

Query: 298 FSSRSHTIFTIMLYKNHNGE--------VFRVSKMNLVDLAGSENISRSGAQNQRAKEAG 349
             S    +F+    K+H G+        V   ++ +L+D+  S   S+      R +EAG
Sbjct: 206 NVSIFEGLFSSNRLKHHKGQPSKGRSEKVLGPAEQHLMDMLCSSGFSKQSTWGNRTQEAG 265

Query: 350 SINQSLLTLGRVIN 363
               S L+L R+ N
Sbjct: 266 KTVISSLSLCRLAN 279

>TPHA0D02110 Chr4 (433197..434267) [1071 bp, 356 aa] {ON} Anc_5.360
           YDR322W
          Length = 356

 Score = 31.6 bits (70), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 37/86 (43%), Gaps = 1/86 (1%)

Query: 33  IKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVDKVFGPSADQSLIFKQIAE 92
           ++ K+ V V  P  TG N+  IN+ + L   A      + V +    + D+ L    +  
Sbjct: 168 LEPKADVHVKFPYSTGINK-WINSGETLSTLATSLPPVFKVQEYDSINVDKQLYTILVVN 226

Query: 93  PLFDDFIKGYNCTVLVYGMTSTGKTY 118
           P   D I    CT L YG+T+    Y
Sbjct: 227 PDVPDLINDTYCTCLNYGLTNLKLKY 252

>Kpol_1008.29 s1008 complement(62595..64211) [1617 bp, 538 aa] {ON}
           complement(62595..64211) [1617 nt, 539 aa]
          Length = 538

 Score = 32.0 bits (71), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 36/57 (63%), Gaps = 5/57 (8%)

Query: 263 IQNLQEFHITNAKDGINLLQRGLKHRQV--ASTKMNDFSSRSHTIFTIMLYKNHNGE 317
           I+NLQ+ +  + +   N LQR  K+ ++   + K+N+  S+S+ IF  +L KNHNG+
Sbjct: 455 IENLQDRYTKSERQ--NKLQRT-KYEELYLENQKVNEVVSKSNKIFNGLLLKNHNGD 508

>TBLA0F03210 Chr6 complement(779351..780796) [1446 bp, 481 aa] {ON}
           Anc_3.393 YBR130C
          Length = 481

 Score = 32.0 bits (71), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 45/83 (54%), Gaps = 23/83 (27%)

Query: 459 DGIYMTQDHYKELTSDLENYKTEVQECKREIEKMNSQNVLLLKDKRASHEVSELQRIKIK 518
           D I  +Q +Y+       +Y +EV E K++IE++          K++  ++++LQ+IK  
Sbjct: 192 DAIVESQQYYRN------HYNSEVTELKQQIEEL----------KKS--QINQLQKIKEH 233

Query: 519 HLNDKIAHLYDKMDKQHKNEQDL 541
           HL+     + DKMD  HK  +D+
Sbjct: 234 HLS-----IDDKMDHFHKKYKDM 251

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.130    0.353 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 96,127,284
Number of extensions: 4291586
Number of successful extensions: 18848
Number of sequences better than 10.0: 852
Number of HSP's gapped: 19154
Number of HSP's successfully gapped: 1308
Length of query: 948
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 829
Effective length of database: 39,836,145
Effective search space: 33024164205
Effective search space used: 33024164205
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 71 (32.0 bits)