Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E01056g6.15ON26926912930.0
KLLA0D01023g6.15ON2682158191e-110
Kwal_56.223996.15ON2742728091e-108
KAFR0A050606.15ON2692148021e-107
KLTH0C11352g6.15ON2682257981e-107
ZYRO0C07920g6.15ON2932157721e-102
ACR011C6.15ON2532277541e-100
NCAS0D026606.15ON2612337511e-100
TDEL0G045406.15ON2452527375e-98
KNAG0F028806.15ON2692187397e-98
NDAI0I022506.15ON2712177371e-97
Kpol_1045.746.15ON2572297301e-96
CAGL0E02673g6.15ON2632467282e-96
Ecym_30196.15ON2662187283e-96
Suva_15.1796.15ON2592157083e-93
YOR004W (UTP23)6.15ON2541747013e-92
Skud_15.1656.15ON2572216971e-91
Smik_15.1736.15ON2512166901e-90
TPHA0J002806.15ON2712536815e-89
TBLA0A072906.15ON2591775936e-76
KLTH0E02860g5.392ON1891461707e-14
ZYRO0A06754g5.392ON1891461699e-14
Kpol_1055.185.392ON1891461699e-14
Kwal_55.200895.392ON1891461681e-13
TDEL0E023305.392ON1891461644e-13
NDAI0C045505.392ON1891461635e-13
AEL102W5.392ON1891461629e-13
TPHA0D023105.392ON1891461611e-12
NCAS0F030905.392ON1891461611e-12
CAGL0M01056g5.392ON1891461611e-12
Ecym_74695.392ON1891461583e-12
Smik_4.5995.392ON1891461583e-12
Suva_2.5095.392ON1891461583e-12
Skud_4.6065.392ON1891461583e-12
YDR339C (FCF1)5.392ON1891461583e-12
SAKL0G07766g5.392ON1891461574e-12
KAFR0D042805.392ON1891461574e-12
KNAG0C052705.392ON1891461557e-12
TBLA0H017505.392ON1891461541e-11
KLLA0A07018g5.392ON1891431513e-11
TBLA0J002607.514ON70758675.0
Suva_16.676.267ON70738675.8
Smik_6.4446.267ON70638675.8
YPL240C (HSP82)6.267ON70938676.3
Skud_16.396.267ON71038668.2
KAFR0A077302.48ON80428668.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E01056g
         (269 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar t...   502   0.0  
KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar t...   320   e-110
Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W...   316   e-108
KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {...   313   e-107
KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {O...   311   e-107
ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {O...   301   e-102
ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON} Sy...   295   e-100
NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON...   293   e-100
TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON...   288   5e-98
KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON...   289   7e-98
NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15...   288   1e-97
Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {...   285   1e-96
CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar...   285   2e-96
Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to A...   285   3e-96
Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W...   277   3e-93
YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}  UTP23Compo...   274   3e-92
Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W...   273   1e-91
Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W...   270   1e-90
TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15 ...   266   5e-89
TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6....   233   6e-76
KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly ...    70   7e-14
ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly ...    70   9e-14
Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON...    70   9e-14
Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C...    69   1e-13
TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.39...    68   4e-13
NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {...    67   5e-13
AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic hom...    67   9e-13
TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON...    67   1e-12
NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON...    67   1e-12
CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly...    67   1e-12
Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON} ...    65   3e-12
Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {O...    65   3e-12
Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}...    65   3e-12
Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {O...    65   3e-12
YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON} ...    65   3e-12
SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly ...    65   4e-12
KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.39...    65   4e-12
KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5....    64   7e-12
TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.39...    64   1e-11
KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {O...    63   3e-11
TBLA0J00260 Chr10 (45003..47126) [2124 bp, 707 aa] {ON} Anc_7.51...    30   5.0  
Suva_16.67 Chr16 complement(105527..107650) [2124 bp, 707 aa] {O...    30   5.8  
Smik_6.444 Chr6 (725685..727805) [2121 bp, 706 aa] {ON} YPL240C ...    30   5.8  
YPL240C Chr16 complement(96496..98625) [2130 bp, 709 aa] {ON}  H...    30   6.3  
Skud_16.39 Chr16 complement(70011..72143) [2133 bp, 710 aa] {ON}...    30   8.2  
KAFR0A07730 Chr1 (1554827..1557241) [2415 bp, 804 aa] {ON} Anc_2...    30   8.2  

>SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 269

 Score =  502 bits (1293), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/269 (93%), Positives = 252/269 (93%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120
           ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA
Sbjct: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120

Query: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHAGLA 180
           TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHAGLA
Sbjct: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHAGLA 180

Query: 181 HDESVDLXXXXXXXXXXXXXXXXXEPNPLSVKRKRDQREENTKAPAETAEQSERKRRKRR 240
           HDESVDL                 EPNPLSVKRKRDQREENTKAPAETAEQSERKRRKRR
Sbjct: 181 HDESVDLVDSVKQKQPSKKKGGPKEPNPLSVKRKRDQREENTKAPAETAEQSERKRRKRR 240

Query: 241 HGKPALKSSGEGAPENGTAKAPQSDSDSS 269
           HGKPALKSSGEGAPENGTAKAPQSDSDSS
Sbjct: 241 HGKPALKSSGEGAPENGTAKAPQSDSDSS 269

>KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 268

 Score =  320 bits (819), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 149/215 (69%), Positives = 177/215 (82%), Gaps = 1/215 (0%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQMLVYNHTFKFR+PYQVLVDDQ+V+ T+ SSFD  KGL+RTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60

Query: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120
           ITQCCMQ+LY T +QGAI+  K +ERRRCNH PKE K+ LEC+ SVV+ NGKNKHRYVVA
Sbjct: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120

Query: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHAGLA 180
           TQD++IRR+LR++PGVPL+YMNRSVMVMEPLS ASE++S+  EE+KL+KGLNDPK AG+A
Sbjct: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGIA 180

Query: 181 HDESVDLXXXXXXXXXXXXXXXXXEPNPLSVKRKR 215
            DE+ D                  EPNPLS+K+K+
Sbjct: 181 RDEN-DEAGAENQENKPKKRKGPKEPNPLSMKKKK 214

>Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W -
           Protein required for cell viability [contig 185] FULL
          Length = 274

 Score =  316 bits (809), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 162/272 (59%), Positives = 193/272 (70%), Gaps = 19/272 (6%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQMLVYNH FKFREPYQVLVDDQIV  T+K++FDL KGLKRTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120
           ITQCC+QA+Y T DQ AIE+AK++ERRRCNHPPKE+K  LEC++SVVN NG NKHRYVVA
Sbjct: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120

Query: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHAGLA 180
           TQ+ +IR  LR+VPGVPL++MNRSVMVMEPLS+AS+ +S+V+E EKLFKGLNDPK AGL 
Sbjct: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGLP 180

Query: 181 HDE-----SVDLXXXXXXXXXXXXXXXXXEPNPLSVKRKRDQREENTKAPAETAEQSE-- 233
             E     +                     PNPLS+K+K+    E+ K P   AE +   
Sbjct: 181 LTEQPATATAATVDKEGAGAPAKKRKGPKGPNPLSIKKKKT--SESRKEPVNPAENTSAT 238

Query: 234 ----------RKRRKRRHGKPALKSSGEGAPE 255
                      +RRKR H K   +++ E   E
Sbjct: 239 LTENDNKEQPSRRRKRSHKKTTPQTAEETTSE 270

>KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  313 bits (802), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 147/214 (68%), Positives = 173/214 (80%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVY+HTFKFREPYQVLVD++IV  +  S+FDL KGLKRTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120
           ITQCCMQALY T+DQ AI+MAK +ERRRCNHPPKE KT +EC+ SVVN NGKNKHRYVVA
Sbjct: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120

Query: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHAGLA 180
           +QDIDIRR+LRRVPGVPL++++RSVM+MEPLS+ S ++S   E+EKL+KGLNDPK+AGL 
Sbjct: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK 180

Query: 181 HDESVDLXXXXXXXXXXXXXXXXXEPNPLSVKRK 214
            DE                      PNPLSV++K
Sbjct: 181 LDEEEATETQGSGEKTAKKKRGPKGPNPLSVRKK 214

>KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 268

 Score =  311 bits (798), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 149/225 (66%), Positives = 179/225 (79%), Gaps = 1/225 (0%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQMLVYNH FKFREPYQVLVDDQIV  T+++SFDL KGL+RTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60

Query: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120
           ITQCC+QA+Y TK+Q AIE+AK++ERRRCNHPPKE+K  +EC++SVV+ NG NKHRYVVA
Sbjct: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120

Query: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHAGLA 180
           +QD  IR+KLR+VPGVPLIYMNRSVMVMEPLS+AS   S+ +E+EKLFKGLNDPK+AGL 
Sbjct: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGLP 180

Query: 181 HDESVDLXXXXXXXXXXXXXXXXXEPNPLSVKRKRDQREENTKAP 225
            +E                      PNPLS+K+K+   +   ++P
Sbjct: 181 AEEEGG-KTDNGTEVSKNKRKGPKGPNPLSIKKKKTVPDSKDESP 224

>ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 293

 Score =  301 bits (772), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 144/215 (66%), Positives = 170/215 (79%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60
           MRQKRAKSY+KQMLVYN+ F+FREPYQVL+DDQ+V    KS +DL  GLKRTLQAEVKPM
Sbjct: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120
           ITQCCMQALY TK+Q AIE+ K++ERRRCNHPPKE+K   ECI+SVVN NG NKHRYVVA
Sbjct: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120

Query: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHAGLA 180
           +QD+ +RRKLR+VPGVPLI+M+RSVMVMEPLSEAS R++++ E EKL KGLNDPK AGL 
Sbjct: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKLAGLK 180

Query: 181 HDESVDLXXXXXXXXXXXXXXXXXEPNPLSVKRKR 215
              SV+                   PNPLSV++K+
Sbjct: 181 TTPSVENELESESQPPAKKRKGPKGPNPLSVRKKQ 215

>ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR004W
          Length = 253

 Score =  295 bits (754), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 144/227 (63%), Positives = 174/227 (76%), Gaps = 2/227 (0%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60
           MRQKRAK+Y+KQMLVYNHTFKFREPYQVLVDDQIV+ T KSSFDL KGLKRTLQAEVKPM
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120
           ITQCCMQ LY TK+Q AI   K YERRRCNH  KE K  +EC++SVV  NG+N+HRY+VA
Sbjct: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNH-VKEPKEPIECLQSVVAVNGQNRHRYIVA 119

Query: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHAGLA 180
           +QDI IRR LR+VPGVPL+Y+NR+VMVMEPLS  SE++S+  E++KLFKGLNDPK+ G+A
Sbjct: 120 SQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGIA 179

Query: 181 HDESVDLXXXXXXXXXXXXXXXXXEPNPLSVKRKRDQREENTKAPAE 227
            + S                     PNPLS+K+++ + E+ T   +E
Sbjct: 180 EN-SAPAGAQPAEGAPTLKRKGPKAPNPLSMKKRKVKEEQPTSDASE 225

>NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON}
           Anc_6.15
          Length = 261

 Score =  293 bits (751), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 141/233 (60%), Positives = 176/233 (75%), Gaps = 2/233 (0%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVYNHTF+FREPYQ+LVD+QIV     S++DL KGL RTLQAEVK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60

Query: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120
           ITQCCMQALY   DQ AIE+A+ +ERRRCNH PK+ KT +ECIESVVN NG+NKHRYVVA
Sbjct: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120

Query: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHAGLA 180
            QD+ IRRKLR+VPGVPL++++R+VM+MEPLS+AS ++SK +E EKL+KGLNDPK+ G+ 
Sbjct: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGVK 180

Query: 181 HDESVDLXXXXXXXXXXXXXXXXXEPNPLSVKRKRDQREENTKAPAETAEQSE 233
              + +                   PNPLS+K+K+ + + N +   E  E SE
Sbjct: 181 --TAAEDVKIDDKPKPKKSKYGPKSPNPLSMKKKKQEPKRNREDSTEDQESSE 231

>TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON}
           Anc_6.15 YOR004W
          Length = 245

 Score =  288 bits (737), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 150/252 (59%), Positives = 183/252 (72%), Gaps = 12/252 (4%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60
           MRQKRAK+YRKQMLVYNHTFKFREPYQVLVD+QIV+  + S+FDL KGL+RTLQAEVK M
Sbjct: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60

Query: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120
           ITQCCMQALY T  QGAIE+AKT+ERRRCNHPPKE K  +EC+ES+V  NG NKHRYVVA
Sbjct: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120

Query: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHAGLA 180
           +QDID RR LRR PGVPL++  RSVMVMEPLS+AS ++S   E EKL KGLNDP++AG+ 
Sbjct: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLSDASAKVSSAAEAEKLHKGLNDPRNAGIK 180

Query: 181 HDESVDLXXXXXXXXXXXXXXXXXEPNPLSVKRKRDQREENTKAPAETAE-QSERKRRKR 239
            +                      +PNPLSVK+++ + +   KA  +T    S  K+R+R
Sbjct: 181 TENP-----------QTSIKKRTKQPNPLSVKKRKTESKGEPKAAQDTEPVASNTKKRRR 229

Query: 240 RHGKPALKSSGE 251
           +H     +  G+
Sbjct: 230 KHKSSTTEPQGQ 241

>KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  289 bits (739), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 139/218 (63%), Positives = 172/218 (78%), Gaps = 3/218 (1%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVYNHTF+FREPYQV++DD+IV+   +S FDL K L+RT+QAEVK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQVILDDEIVLQATESKFDLYKALQRTVQAEVKLM 60

Query: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120
           ITQCCMQALYAT ++ AI+MAK YERRRCNHPPK+ K+  ECIESVV+  G+NKHRY+VA
Sbjct: 61  ITQCCMQALYATNNRQAIDMAKRYERRRCNHPPKDPKSPFECIESVVDIKGENKHRYIVA 120

Query: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHAGL- 179
            Q+ID+RRKLRRVPGVPLI+++R+VM+MEPLS+AS R+SK  E++KLF GLND K AG+ 
Sbjct: 121 CQNIDLRRKLRRVPGVPLIHVSRAVMIMEPLSDASARISKRMEQQKLFSGLNDAKAAGIK 180

Query: 180 -AHDESV-DLXXXXXXXXXXXXXXXXXEPNPLSVKRKR 215
            A  E V D                  +PNPLS+K+K+
Sbjct: 181 AAETEKVEDKGKEAPEAKPKKRKLGPKQPNPLSMKKKK 218

>NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  288 bits (737), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 169/217 (77%), Gaps = 2/217 (0%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVYNHTFKFR PYQVLVD+QIV+    S++DLAKGLK TLQ+EVK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60

Query: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120
           ITQCCMQALY   +Q AIE+A+ +ERRRCNH PKE KT++ECIESVVN NG+NKHRYVVA
Sbjct: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120

Query: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHAGL- 179
           +QD+  RRKLR+VPGVPLI+++R+VM+MEPLS+ S ++S+ +E EKL+KGLNDPK  G+ 
Sbjct: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180

Query: 180 -AHDESVDLXXXXXXXXXXXXXXXXXEPNPLSVKRKR 215
            A D+                      PNPLS+K+K+
Sbjct: 181 SAVDKETVKEKESTDQQKKKRKIGPKGPNPLSMKKKK 217

>Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {ON}
           complement(173726..174499) [774 nt, 258 aa]
          Length = 257

 Score =  285 bits (730), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 138/229 (60%), Positives = 176/229 (76%), Gaps = 6/229 (2%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60
           MRQ+RAKSYRKQMLVYNHTFKFREPYQ +VDDQ+V+   +S FD+ KGLKRTLQAEVK M
Sbjct: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60

Query: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120
           ITQCCMQALY T +Q AI +AK +ERRRCNHPPK+ K+ LECIES+V+  G NKHRYVVA
Sbjct: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120

Query: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKH-AGL 179
           +QD+DIRRKLR++PGVP+++++R+VM++EPLS+AS ++S+  E++KL+KGLND KH AGL
Sbjct: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 180

Query: 180 AHDESVDLXXXXXXXXXXXXXXXXXEPNPLSVKRKRDQREENTKAPAET 228
              +S                    +PNPLS+K KR  +  + +  AET
Sbjct: 181 DEPKS----EKSEKTSESKKNKGPKQPNPLSMK-KRKSKPASNEVEAET 224

>CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004w
          Length = 263

 Score =  285 bits (728), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 143/246 (58%), Positives = 184/246 (74%), Gaps = 5/246 (2%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVYNHTFKFREPYQVL+DDQIVM +  S +DL K LKRTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60

Query: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120
           ITQCCMQALY TK++ AI++ K +ERRRC H P E+ +  ECI +VV+  GKNKHRYVVA
Sbjct: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120

Query: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHAGLA 180
            QD++IRR LR+VPGVPL++++RSVM+MEPLS+AS ++S++ EE KLF+GLNDPK+AGL 
Sbjct: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGLK 180

Query: 181 HDESVDLXXXXXXXXXXXXXXXXXEPNPLSVKRKRDQREENTKAPAETAEQSE----RKR 236
             E  +                  +PNPLS+K+K+ +  +  +    +A+QS+    R+ 
Sbjct: 181 -GEHEEEEQSKEQTVAKKRKIGPKQPNPLSMKKKKKENTKKEQQTETSADQSQPTKRRRS 239

Query: 237 RKRRHG 242
           RK +HG
Sbjct: 240 RKHKHG 245

>Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to
           Ashbya gossypii ACR011C
          Length = 266

 Score =  285 bits (728), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 150/218 (68%), Positives = 169/218 (77%), Gaps = 5/218 (2%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60
           MRQKRAK+Y+KQMLVYNHTFKFR+PYQVLVDDQ+V+ T KSSFDL KGLKRTLQAEVKPM
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120
           ITQCC+Q LY +K+QGAI  AK YERRRCNH  KE K   ECI SVV+ NG+N HRYVVA
Sbjct: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNH-YKEPKEPSECIRSVVDINGRNLHRYVVA 119

Query: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHAGLA 180
           TQDI+IRR LRRVPGVPLIYMNRSVMVMEPLS  S+++S+  E EKL KGLNDPK+AG  
Sbjct: 120 TQDIEIRRILRRVPGVPLIYMNRSVMVMEPLSSNSQQVSQQVENEKLVKGLNDPKYAGTP 179

Query: 181 H---DESVDLXXXXXXXXXXXXXXXXXEPNPLSVKRKR 215
           +   D SVD                  EPNPLS+K+ R
Sbjct: 180 NNTEDASVD-PKSPDANQLKRKIKGPKEPNPLSIKKPR 216

>Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W
           (REAL)
          Length = 259

 Score =  277 bits (708), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 165/215 (76%), Gaps = 4/215 (1%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVY+HTFKFREPYQVLVD+Q+V     S+FDL  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120
           ITQCC+QALY T+++GAI++AK +ERRRCNH  K+ K+  ECIESVVN NG NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120

Query: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHAGLA 180
           +QDID+RRKLR VPGVPLI++ RSVM+MEPLS AS + S++ EE+KL+KGLNDP    + 
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDP---NIE 177

Query: 181 HDESVDLXXXXXXXXXXXXXXXXXEPNPLSVKRKR 215
             E++                    PNPLS+K+K+
Sbjct: 178 KAEAIS-KGSEKESTPKKRKAGPKAPNPLSMKKKK 211

>YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}
           UTP23Component of the small subunit processome, involved
           in 40S ribosomal subunit biogenesis; interacts with
           snR30 and is required for dissociation of snR30 from
           large pre-ribosomal particles; has homology to PINc
           domain protein Fcf1p, although the PINc domain of Utp23p
           is not required for function; essential protein
          Length = 254

 Score =  274 bits (701), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 150/174 (86%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVY+HTFKFREPYQVLVD+Q+V+    S+F+L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120
           ITQCC+QALY T++ GAI +AK +ERRRCNH  K+ K+  ECIESVVN +G NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120

Query: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDP 174
           +QDID+RRKLR VPGVPLI++ RSVMVMEPLS AS + SK+ EE+KL+KGLNDP
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDP 174

>Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W
           (REAL)
          Length = 257

 Score =  273 bits (697), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 136/221 (61%), Positives = 164/221 (74%), Gaps = 4/221 (1%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVY+HTFKFREPYQVLVD+Q+V     S+F+L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120
           ITQCC+QALY T+++GAI++AK +ERRRCNH  K+ K+  ECIESVV+ NG NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120

Query: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHAGLA 180
           +QDI +RRKLR VPGVPLI++ RSVM+MEPLS AS + SK  EE+KLFKGLNDP    + 
Sbjct: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDP---NVE 177

Query: 181 HDESVDLXXXXXXXXXXXXXXXXXEPNPLSVKRKRDQREEN 221
             E V                    PNPLSVK+K+  +  N
Sbjct: 178 KTEKVS-SESGKESAPKKRKIGPKAPNPLSVKKKKTSQPSN 217

>Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W
           (REAL)
          Length = 251

 Score =  270 bits (690), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 133/216 (61%), Positives = 164/216 (75%), Gaps = 6/216 (2%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVY+HTFKFREPYQVLVD+Q+V+    S+F+L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120
           ITQCC+QALY T+++GAI++AK +ERRRCNH  K+ K+  +CIESVV+ NG NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120

Query: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHAGLA 180
           +QDI +RRKLR VPGVPLI++ RSVMVMEPLS AS + SK+ EE KL+KGLNDP      
Sbjct: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPN----- 175

Query: 181 HDESVDLXXXXXXXXXXXXXXXX-XEPNPLSVKRKR 215
            D+  ++                   PNPLSVK+K+
Sbjct: 176 VDKVQEISEGSGKESVTKKRKFGPKAPNPLSVKKKK 211

>TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  266 bits (681), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 132/253 (52%), Positives = 182/253 (71%), Gaps = 3/253 (1%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAE-VKP 59
           MRQKRAKSY+KQM+VYNHTFKFREPYQ+LVD+QIV  +++S+++L + L++TLQAE +K 
Sbjct: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60

Query: 60  MITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVV 119
           MITQCCMQ LY T +Q  I+ AK +ERRRCNH  K+ K  LECIES+VN +G+NKHRYVV
Sbjct: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120

Query: 120 ATQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHAGL 179
           ATQ++++RRKLRRVPGVP+++++RSVM+MEP+S++S RL++  E+ KL+KGLNDPK++  
Sbjct: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 180

Query: 180 AHDESVDLXXXXXXXXXXXXXXXXXEPNPLSVKRKRDQREENTKAPAETAEQSERKRRKR 239
              +                     EPNPLS K+K   + E  K  A T + + +KRR++
Sbjct: 181 PTPKEGTPDTEGTQPAATKKRKGVKEPNPLSKKKK--VKVEIPKPAATTTDAANKKRRRK 238

Query: 240 RHGKPALKSSGEG 252
                  ++  EG
Sbjct: 239 HRSNKNSENGNEG 251

>TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6.15
           YOR004W
          Length = 259

 Score =  233 bits (593), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 106/177 (59%), Positives = 139/177 (78%), Gaps = 2/177 (1%)

Query: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAE--VK 58
           MRQKRAKSY+KQ++VYNHTFKFREPYQV++DD +V  T ++ ++L KGL   L +   +K
Sbjct: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60

Query: 59  PMITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYV 118
           PMITQCC+ ALY ++DQ +I + KT+ERRRCNH  KE  +  EC+ S+V+ NGKNKHRY+
Sbjct: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120

Query: 119 VATQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPK 175
           VATQD+++RRKLR++PGVPLI+  RSVMVMEPLS+AS   ++  E +KL  GLN  K
Sbjct: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTK 177

>KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 70.1 bits (170), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 78/146 (53%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPMITQCCMQAL--YA 71
           L + +    + PYQVL+D   +  + +   D+ +G+  TL A+  PMIT C M  L    
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDTLLAKCIPMITDCVMAELEKLG 110

Query: 72  TKDQGAIEMAKT--YERRRCNHPPKESKTSLECIESVVNFNGKNKHR-YVVATQDIDIRR 128
            K + A+++A+    +R  C+H   +   + +C+      N   +H+ Y+VAT D  +++
Sbjct: 111 PKYRIALKLARDPRIQRLTCSH---KGTYADDCL-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRRVPGVPLIYMNRSVMVMEPLSEA 154
           ++R+VPG+PL+ +     V+E L + 
Sbjct: 163 RIRKVPGIPLMSVGGHAYVIEKLPDV 188

>ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 69.7 bits (169), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 77/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPMITQCCMQAL--YA 71
           L + +    R PYQVL+D   +  + +   D+ KG+   L A+  P+IT C M  L    
Sbjct: 51  LFFQYNQAIRPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  TKDQGAIEMAKT--YERRRCNHPPKESKTSLECIESVVNFNGKNKHR-YVVATQDIDIRR 128
            K + A+++A+    +R  C H   +   + +C+      N   +H+ Y+VAT D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCTH---KGTYADDCL-----VNRVMQHKCYIVATNDAPLKQ 162

Query: 129 KLRRVPGVPLIYMNRSVMVMEPLSEA 154
           ++R++PG+PL+ +     V+E L +A
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPDA 188

>Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON}
           complement(40805..41374) [570 nt, 190 aa]
          Length = 189

 Score = 69.7 bits (169), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 77/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPMITQCCMQAL--YA 71
           L + +    + PYQVL+D   +  + +   D+ KG+   L A+  P+IT C M  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  TKDQGAIEMAKT--YERRRCNHPPKESKTSLECIESVVNFNGKNKHR-YVVATQDIDIRR 128
            K + A+ +A+    +R  C+H   +   + +CI      N   +H+ Y+VAT D+ +++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSH---KGTYADDCI-----VNRVLQHKCYIVATNDVGLKQ 162

Query: 129 KLRRVPGVPLIYMNRSVMVMEPLSEA 154
           ++R+VPG+PL+ +     V+E L + 
Sbjct: 163 RIRKVPGIPLMSVGGHSYVIEKLPDV 188

>Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C -
           Protein required for cell viability [contig 154] FULL
          Length = 189

 Score = 69.3 bits (168), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 78/146 (53%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPMITQCCMQAL--YA 71
           L + +    + PYQVL+D   +  + +   DL +G+  TL A+  P+IT C M  L    
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDTLLAKCIPLITDCVMAELEKLG 110

Query: 72  TKDQGAIEMAKT--YERRRCNHPPKESKTSLECIESVVNFNGKNKHR-YVVATQDIDIRR 128
            K + A+++A+    +R  C+H   +   + +C+      N   +H+ Y+VAT D  +++
Sbjct: 111 PKYRIALKLARDPRIQRLSCSH---KGTYADDCL-----VNRVLQHKCYIVATNDAALKQ 162

Query: 129 KLRRVPGVPLIYMNRSVMVMEPLSEA 154
           ++R+VPG+PL+ +     V+E L + 
Sbjct: 163 RIRKVPGIPLMSVGGHAYVIEKLPDV 188

>TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 67.8 bits (164), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPMITQCCMQAL--YA 71
           L + +    + PYQVL+D   +  + +   DL +G+   L A+  P+IT C M  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  TKDQGAIEMAKT--YERRRCNHPPKESKTSLECIESVVNFNGKNKHR-YVVATQDIDIRR 128
            K + A+++A+    +R  C H   +   + +CI      N   +H+ Y+VAT D  +++
Sbjct: 111 PKFRIALKLARDPRIKRLSCTH---KGTYADDCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRRVPGVPLIYMNRSVMVMEPLSEA 154
           ++R++PG+PL+ +      +E L +A
Sbjct: 163 RVRKIPGIPLMSVGGHAYAIEKLPDA 188

>NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {ON}
           Anc_5.392
          Length = 189

 Score = 67.4 bits (163), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 77/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPMITQCCMQAL--YA 71
           L + +    + PYQVL+D   +  + +   DL +G+   L A+  P+IT C M  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  TKDQGAIEMAKT--YERRRCNHPPKESKTSLECIESVVNFNGKNKHR-YVVATQDIDIRR 128
            K + A+++A+    +R  C+H   +   + +CI      N   +H+ Y+VAT D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH---KGTYADDCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRRVPGVPLIYMNRSVMVMEPLSEA 154
           ++R++PG+PL+ +     V+E L + 
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPDV 188

>AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR339C
          Length = 189

 Score = 67.0 bits (162), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 77/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPMITQCCMQAL--YA 71
           L + +    + PYQVL+D   +  + +   DL +G+   L A+  P+IT C M  L    
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 72  TKDQGAIEMAKT--YERRRCNHPPKESKTSLECIESVVNFNGKNKHR-YVVATQDIDIRR 128
            K + A+++A+    +R  C+H   +   + +C+      N   +H+ Y+VAT D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLNCSH---KGTYADDCL-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRRVPGVPLIYMNRSVMVMEPLSEA 154
           ++R+VPG+PL+ +     V+E L + 
Sbjct: 163 RIRKVPGIPLMSVGGHSYVIEKLPDV 188

>TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 66.6 bits (161), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 75/146 (51%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPMITQCCMQAL--YA 71
           L +      R PYQVL+D   +  + +   D+ KG+   L A+  P+IT C M  L    
Sbjct: 51  LFFQFNEAIRPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  TKDQGAIEMAKT--YERRRCNHPPKESKTSLECIESVVNFNGKNKHR-YVVATQDIDIRR 128
            K + A+ +A+    +R  C+H   +   + +CI      N   +H+ Y+VAT D  +++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSH---KGTYADDCI-----VNRVLQHKCYIVATNDQGLKQ 162

Query: 129 KLRRVPGVPLIYMNRSVMVMEPLSEA 154
           ++R++PG+PL+ +     V+E L + 
Sbjct: 163 RVRKIPGIPLMSVGGHAYVIEKLPDV 188

>NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 66.6 bits (161), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPMITQCCMQAL--YA 71
           L + +    + PYQVL+D   +  + +   DL KG+   L A+  P+IT C M  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  TKDQGAIEMAKT--YERRRCNHPPKESKTSLECIESVVNFNGKNKHR-YVVATQDIDIRR 128
            K + A+ +A+    +R  C+H   +   + +CI      N   +H+ ++VAT D  +++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSH---KGTYADDCI-----VNRVLQHKCFIVATNDAGLKQ 162

Query: 129 KLRRVPGVPLIYMNRSVMVMEPLSEA 154
           ++R++PG+PL+ +     V+E L + 
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPDV 188

>CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339c
          Length = 189

 Score = 66.6 bits (161), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPMITQCCMQAL--YA 71
           L + +    + PYQVL+D   +  + +   D+ KG+   L A+  P+IT C +  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 72  TKDQGAIEMAKT--YERRRCNHPPKESKTSLECIESVVNFNGKNKHR-YVVATQDIDIRR 128
            K + A+++A+    +R  C H   +   + +CI      N   +H+ Y+VAT D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLTCTH---KGTYADDCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRRVPGVPLIYMNRSVMVMEPLSEA 154
           ++R++PG+PL+ +     V+E L + 
Sbjct: 163 RVRKIPGIPLMSVGGHAYVIEKLPDV 188

>Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON}
           similar to Ashbya gossypii AEL102W
          Length = 189

 Score = 65.5 bits (158), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPMITQCCMQAL--YA 71
           L + +    + PYQVL+D   +  + +   D+ +G+   L A+  P+IT C M  L    
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 72  TKDQGAIEMAKT--YERRRCNHPPKESKTSLECIESVVNFNGKNKHR-YVVATQDIDIRR 128
            K + A+++A+    +R  C+H       + +C+      N   +H+ Y+VAT D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLTCSH---RGTYADDCL-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRRVPGVPLIYMNRSVMVMEPLSEA 154
           ++R+VPG+PL+ +     V+E L + 
Sbjct: 163 RIRKVPGIPLLSVGGHSYVIEKLPDV 188

>Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 65.5 bits (158), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPMITQCCMQAL--YA 71
           L + +    + PYQVL+D   +  + +   D+ +G+   L A+  P+IT C M  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  TKDQGAIEMAKT--YERRRCNHPPKESKTSLECIESVVNFNGKNKHR-YVVATQDIDIRR 128
            K + A+++A+    +R  C+H    +   L  +  V+      +H+ Y+VAT D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYADDCL--VHRVL------QHKCYIVATNDAGLKQ 162

Query: 129 KLRRVPGVPLIYMNRSVMVMEPLSEA 154
           ++R++PG+PL+ +     V+E L + 
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKLPDV 188

>Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 65.5 bits (158), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPMITQCCMQAL--YA 71
           L + +    + PYQVL+D   +  + +   D+ +G+   L A+  P+IT C M  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  TKDQGAIEMAKT--YERRRCNHPPKESKTSLECIESVVNFNGKNKHR-YVVATQDIDIRR 128
            K + A+++A+    +R  C+H    +   L  +  V+      +H+ Y+VAT D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYADDCL--VHRVL------QHKCYIVATNDAGLKQ 162

Query: 129 KLRRVPGVPLIYMNRSVMVMEPLSEA 154
           ++R++PG+PL+ +     V+E L + 
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKLPDV 188

>Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 65.5 bits (158), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPMITQCCMQAL--YA 71
           L + +    + PYQVL+D   +  + +   D+ +G+   L A+  P+IT C M  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  TKDQGAIEMAKT--YERRRCNHPPKESKTSLECIESVVNFNGKNKHR-YVVATQDIDIRR 128
            K + A+++A+    +R  C+H    +   L  +  V+      +H+ Y+VAT D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYADDCL--VHRVL------QHKCYIVATNDAGLKQ 162

Query: 129 KLRRVPGVPLIYMNRSVMVMEPLSEA 154
           ++R++PG+PL+ +     V+E L + 
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKLPDV 188

>YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON}
           FCF1Putative PINc domain nuclease required for early
           cleavages of 35S pre-rRNA and maturation of 18S rRNA;
           component of the SSU (small subunit) processome involved
           in 40S ribosomal subunit biogenesis; copurifies with
           Faf1p
          Length = 189

 Score = 65.5 bits (158), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPMITQCCMQAL--YA 71
           L + +    + PYQVL+D   +  + +   D+ +G+   L A+  P+IT C M  L    
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  TKDQGAIEMAKT--YERRRCNHPPKESKTSLECIESVVNFNGKNKHR-YVVATQDIDIRR 128
            K + A+++A+    +R  C+H    +   L  +  V+      +H+ Y+VAT D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYADDCL--VHRVL------QHKCYIVATNDAGLKQ 162

Query: 129 KLRRVPGVPLIYMNRSVMVMEPLSEA 154
           ++R++PG+PL+ +     V+E L + 
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKLPDV 188

>SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 65.1 bits (157), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPMITQCCMQAL--YA 71
           L + +    + PYQVL+D   +  + +   D+ +G+   L A+  P+IT C M  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 72  TKDQGAIEMAKT--YERRRCNHPPKESKTSLECIESVVNFNGKNKHR-YVVATQDIDIRR 128
            K + A+ +A+    +R  C+H   +   + +C+      N   +H+ Y+VAT D  +++
Sbjct: 111 PKYRIALRLARDPRIKRLNCSH---KGTYADDCL-----VNRVLQHKCYIVATNDAALKQ 162

Query: 129 KLRRVPGVPLIYMNRSVMVMEPLSEA 154
           ++R+VPG+PL+ +     V+E L + 
Sbjct: 163 RIRKVPGIPLMSVGGHSYVIEKLPDV 188

>KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 65.1 bits (157), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 77/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPMITQCCMQAL--YA 71
           L + +    + PYQVL+D   +  + +   D+ +G+   L A+  P+IT C +  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 72  TKDQGAIEMAKT--YERRRCNHPPKESKTSLECIESVVNFNGKNKHR-YVVATQDIDIRR 128
            K + A+++A+    +R  C+H   +   + +CI      N   +H+ Y+VAT D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH---KGTYADDCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRRVPGVPLIYMNRSVMVMEPLSEA 154
           ++R++PG+PL+ +     V+E L + 
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPDV 188

>KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 64.3 bits (155), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 77/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPMITQCCMQAL--YA 71
           L + +    + PYQVL+D   +  + +   D+ +G+   L A+  P+IT C +  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 72  TKDQGAIEMAKT--YERRRCNHPPKESKTSLECIESVVNFNGKNKHR-YVVATQDIDIRR 128
            K + A+++A+    +R  C+H   +   + +C+      N   +H+ Y+VAT D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH---KGTYADDCL-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRRVPGVPLIYMNRSVMVMEPLSEA 154
           ++R++PG+PL+ +     V+E L + 
Sbjct: 163 RVRKIPGIPLMSVGGHAYVIEKLPDV 188

>TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 63.9 bits (154), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPMITQCCMQAL--YA 71
           L + +    + PYQVL+D   +  + +   D+ +G+   L A+  P+IT C +  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVVAELEKLG 110

Query: 72  TKDQGAIEMAKT--YERRRCNHPPKESKTSLECIESVVNFNGKNKHR-YVVATQDIDIRR 128
            K + A+++A+    +R  C+H       + +CI      N   +H+ Y+VAT D  +++
Sbjct: 111 PKFRIALKLARDPRIKRLSCSH---RGTYADDCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRRVPGVPLIYMNRSVMVMEPLSEA 154
           ++R++PG+PL+ +     V+E L + 
Sbjct: 163 RVRKIPGIPLMSVGGHSYVVEKLPDV 188

>KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {ON}
           highly similar to uniprot|Q05498 Saccharomyces
           cerevisiae YDR339C Protein required for cell viability
          Length = 189

 Score = 62.8 bits (151), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 75/143 (52%), Gaps = 13/143 (9%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPMITQCCMQAL--YA 71
           L + +    + PYQVL+D   +  + +   D+ KG+   L A+   +IT C M  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNILITDCVMAELEKLG 110

Query: 72  TKDQGAIEMAKT--YERRRCNHPPKESKTSLECIESVVNFNGKNKHR-YVVATQDIDIRR 128
            K + A+++A+    +R  C+H   +   + +CI   V      +H+ Y+VAT D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH---KGTYADDCIVHRV-----LQHKCYIVATNDAGLKQ 162

Query: 129 KLRRVPGVPLIYMNRSVMVMEPL 151
           ++R+VPG+PL+ +     V+E L
Sbjct: 163 RVRKVPGIPLMSVGGHSYVIEKL 185

>TBLA0J00260 Chr10 (45003..47126) [2124 bp, 707 aa] {ON} Anc_7.514
           YLR452C
          Length = 707

 Score = 30.4 bits (67), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 28/58 (48%)

Query: 38  TYKSSFDLAKGLKRTLQAEVKPMITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKE 95
           TY  SF LA+  ++  + E+K  +   C+   Y+ K + A  + K +   +  H P +
Sbjct: 61  TYPYSFSLAQAFEKMNKLELKVDMNTTCISVSYSIKPELAHYLLKIFMSAKLLHTPAD 118

>Suva_16.67 Chr16 complement(105527..107650) [2124 bp, 707 aa] {ON}
           YPL240C (REAL)
          Length = 707

 Score = 30.4 bits (67), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 5/38 (13%)

Query: 139 IYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKH 176
           +Y N+ + + E +S AS+ L K+R     +K L+DPK 
Sbjct: 23  VYSNKEIFLRELISNASDALDKIR-----YKALSDPKQ 55

>Smik_6.444 Chr6 (725685..727805) [2121 bp, 706 aa] {ON} YPL240C
           (REAL)
          Length = 706

 Score = 30.4 bits (67), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 5/38 (13%)

Query: 139 IYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKH 176
           +Y N+ + + E +S AS+ L K+R     +K L+DPK 
Sbjct: 23  VYSNKEIFLRELISNASDALDKIR-----YKSLSDPKQ 55

>YPL240C Chr16 complement(96496..98625) [2130 bp, 709 aa] {ON}
           HSP82Hsp90 chaperone required for pheromone signaling
           and negative regulation of Hsf1p; docks with Tom70p for
           mitochondrial preprotein delivery; promotes telomerase
           DNA binding and nucleotide addition; interacts with
           Cns1p, Cpr6p, Cpr7p, Sti1p
          Length = 709

 Score = 30.4 bits (67), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 5/38 (13%)

Query: 139 IYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKH 176
           +Y N+ + + E +S AS+ L K+R     +K L+DPK 
Sbjct: 23  VYSNKEIFLRELISNASDALDKIR-----YKSLSDPKQ 55

>Skud_16.39 Chr16 complement(70011..72143) [2133 bp, 710 aa] {ON}
           YMR186W (REAL)
          Length = 710

 Score = 30.0 bits (66), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 5/38 (13%)

Query: 139 IYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKH 176
           +Y N+ + + E +S AS+ L K+R     +K L+DPK 
Sbjct: 23  VYSNKEIFLRELISNASDALDKIR-----YKSLSDPKE 55

>KAFR0A07730 Chr1 (1554827..1557241) [2415 bp, 804 aa] {ON} Anc_2.48
           YNL201C
          Length = 804

 Score = 30.0 bits (66), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 9/28 (32%), Positives = 19/28 (67%)

Query: 98  TSLECIESVVNFNGKNKHRYVVATQDID 125
           T++ C ++++N N K  HRY+++   +D
Sbjct: 618 TAVRCFKNILNLNDKYYHRYIISNNLVD 645

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.128    0.359 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,670,857
Number of extensions: 960546
Number of successful extensions: 4003
Number of sequences better than 10.0: 80
Number of HSP's gapped: 4056
Number of HSP's successfully gapped: 81
Length of query: 269
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 161
Effective length of database: 41,097,471
Effective search space: 6616692831
Effective search space used: 6616692831
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 65 (29.6 bits)