Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E01034gna 1ON24724712121e-170
KLLA0D01001gna 1ON2292381242e-07
KAFR0J00420na 2ON24766683.0
TDEL0C043702.220ON49751674.2
Ecym_40995.563ON43448674.8
Smik_14.2732.256ON48945666.5
AER318C5.563ON43548657.6
KLLA0E05831g7.490ON275114647.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E01034g
         (247 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E01034g Chr5 (78600..79343) [744 bp, 247 aa] {ON} conserved...   471   e-170
KLLA0D01001g Chr4 (88911..89600) [690 bp, 229 aa] {ON} conserved...    52   2e-07
KAFR0J00420 Chr10 complement(74107..74850) [744 bp, 247 aa] {ON}...    31   3.0  
TDEL0C04370 Chr3 (782183..783676) [1494 bp, 497 aa] {ON} Anc_2.2...    30   4.2  
Ecym_4099 Chr4 (201245..202549) [1305 bp, 434 aa] {ON} similar t...    30   4.8  
Smik_14.273 Chr14 (504029..505498) [1470 bp, 489 aa] {ON} YNL053...    30   6.5  
AER318C Chr5 complement(1223937..1225244) [1308 bp, 435 aa] {ON}...    30   7.6  
KLLA0E05831g Chr5 (519783..520610) [828 bp, 275 aa] {ON} similar...    29   7.8  

>SAKL0E01034g Chr5 (78600..79343) [744 bp, 247 aa] {ON} conserved
           hypothetical protein
          Length = 247

 Score =  471 bits (1212), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 237/247 (95%), Positives = 237/247 (95%)

Query: 1   MVTPYPVKELDEFSLSNGEVPDTVKISPIEPSIATRLQESPKNAFKISDKPQPENIFPKF 60
           MVTPYPVKELDEFSLSNGEVPDTVKISPIEPSIATRLQESPKNAFKISDKPQPENIFPKF
Sbjct: 1   MVTPYPVKELDEFSLSNGEVPDTVKISPIEPSIATRLQESPKNAFKISDKPQPENIFPKF 60

Query: 61  SYNIXXXXXXXXXXCSSDPNDGSFIRVTTNVEPEHPSPAIGEDTSIIDVGSKVITRPKKP 120
           SYNI          CSSDPNDGSFIRVTTNVEPEHPSPAIGEDTSIIDVGSKVITRPKKP
Sbjct: 61  SYNIKNKLNTLKKKCSSDPNDGSFIRVTTNVEPEHPSPAIGEDTSIIDVGSKVITRPKKP 120

Query: 121 KKQERARSFERLRPAPVLLVKKPRLSVPTTINAKPFSPYMSKKDNQPVTKDLTPQCSPGL 180
           KKQERARSFERLRPAPVLLVKKPRLSVPTTINAKPFSPYMSKKDNQPVTKDLTPQCSPGL
Sbjct: 121 KKQERARSFERLRPAPVLLVKKPRLSVPTTINAKPFSPYMSKKDNQPVTKDLTPQCSPGL 180

Query: 181 DYLNSSYQIPIVGLIFQSVDTVIDTRLTYLAPYRKYLKVALILLAIIEINVFADHLIGYV 240
           DYLNSSYQIPIVGLIFQSVDTVIDTRLTYLAPYRKYLKVALILLAIIEINVFADHLIGYV
Sbjct: 181 DYLNSSYQIPIVGLIFQSVDTVIDTRLTYLAPYRKYLKVALILLAIIEINVFADHLIGYV 240

Query: 241 EKLTGLG 247
           EKLTGLG
Sbjct: 241 EKLTGLG 247

>KLLA0D01001g Chr4 (88911..89600) [690 bp, 229 aa] {ON} conserved
           hypothetical protein
          Length = 229

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/238 (24%), Positives = 98/238 (41%), Gaps = 29/238 (12%)

Query: 4   PYPVKELDEFSLSNGEVPDTVKISPIEPSIATRLQESPKNAFKISDK--PQPENIFPKFS 61
           PYP+K+LD F+LS    P   K++  +  +   LQ +     K SDK  P+  N+  KF 
Sbjct: 8   PYPIKDLDSFTLSEETRPTYDKLNTQQGKV--NLQHNSAGQIK-SDKTLPKLSNLKDKFK 64

Query: 62  Y--NIXXXXXXXXXXCSSDPNDGSFIRVTTNVEPEHPSPAIGEDTSIIDVGSKVITRPKK 119
              N              D    + + VT + EPE  +  + +D     + S++ T  ++
Sbjct: 65  IRNNKYLRSASSPEKEERDKQQNTIVIVTDDEEPEKQT--VQQDIYQEYIPSRIHTTGRE 122

Query: 120 PKKQERARSFERLRPAPVLLVKKPRLSVPTTINAKPFSPYMSKKDNQPVTKDLTPQCSPG 179
             K  + +   R    P    ++   S+ T +      P  S  D   +    +      
Sbjct: 123 SSKHRKIKLTNRRSANP----QRQSESIGTIVTQSTPIPVSSNIDQPSILNTFSSSLKSV 178

Query: 180 LDYLNSSYQIPIVGLIFQSVDTVIDTRLTYLAPYRKYLKVALILLAIIEINVFADHLI 237
            DY                VDTVID R   L  YR+++K+ LI++ I+++N + + LI
Sbjct: 179 FDY----------------VDTVIDVRFPLLISYRRHVKIMLIVIFILQVNWYIELLI 220

>KAFR0J00420 Chr10 complement(74107..74850) [744 bp, 247 aa] {ON}
           YHR043C
          Length = 247

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 32/66 (48%), Gaps = 4/66 (6%)

Query: 136 PVLLVKKPRLSVPTTINAKPFSPYMSKKDNQPVTKDLTPQCSPGLDYLNSSYQIPIVGLI 195
           PV L K     V TT   K F P +   +NQ V  DL  + S G DYLNS   IP    +
Sbjct: 41  PVELFKHSH-GVRTTEVLKMFFPNIDNANNQAVI-DL--ETSIGRDYLNSVTLIPGAQSL 96

Query: 196 FQSVDT 201
             S+DT
Sbjct: 97  LLSLDT 102

>TDEL0C04370 Chr3 (782183..783676) [1494 bp, 497 aa] {ON} Anc_2.220
           YNL076W
          Length = 497

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 5/51 (9%)

Query: 8   KELDEFSLSNGEVPDTVKISPIEPSIA----TRLQESPKNAFKISDKPQPE 54
           K+ D  ++  G  P+TV I+P  P+IA    +RL+E  KN F I   P PE
Sbjct: 179 KKEDPQTIVKGFEPNTV-ITPKNPAIARKVKSRLEEGEKNTFYIESTPSPE 228

>Ecym_4099 Chr4 (201245..202549) [1305 bp, 434 aa] {ON} similar to
           Ashbya gossypii AER318C
          Length = 434

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%)

Query: 111 SKVITRPKKPKKQERARSFERLRPAPVLLVKKPRLSVPTTINAKPFSP 158
           +K I  P++   + R R  ER R  P+  ++KP  SVP+    + F P
Sbjct: 120 TKDICVPQEEFLENRKRRIERFREKPLQPLRKPVASVPSCHEVQGFMP 167

>Smik_14.273 Chr14 (504029..505498) [1470 bp, 489 aa] {ON} YNL053W
          (REAL)
          Length = 489

 Score = 30.0 bits (66), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 3/45 (6%)

Query: 10 LDEFSLSNGEVPDTVKI---SPIEPSIATRLQESPKNAFKISDKP 51
          L EFSL N +VPD+V     +P+ P + ++  E  K   K+S +P
Sbjct: 44 LMEFSLPNQDVPDSVNFTSPTPLNPYMKSKPTELEKGPLKVSSRP 88

>AER318C Chr5 complement(1223937..1225244) [1308 bp, 435 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR448W
           (ADA2)
          Length = 435

 Score = 29.6 bits (65), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%)

Query: 111 SKVITRPKKPKKQERARSFERLRPAPVLLVKKPRLSVPTTINAKPFSP 158
           +K I  P++   +ER R  ER R  P+   +KP  SVP+    + F P
Sbjct: 120 TKDIRVPQEAFLEERKRRIERFREKPLQPPRKPLASVPSCHEVQGFMP 167

>KLLA0E05831g Chr5 (519783..520610) [828 bp, 275 aa] {ON} similar to
           uniprot|P47148 Saccharomyces cerevisiae YJR111C
           Hypothetical ORF
          Length = 275

 Score = 29.3 bits (64), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 41/114 (35%), Gaps = 26/114 (22%)

Query: 91  VEPEHPSPAIGEDTSIIDVGSKVITRPKKPKKQERARSFERLRPAP-------------V 137
           V  E  SP   +D+++ID  + V+T   K +  + A ++E L  +P              
Sbjct: 48  VMSEENSP---DDSALIDAANSVVTLCDKAESNDDASAYESLYQSPTVHQRELTEKFREA 104

Query: 138 LLVKKPRLSVPTTINA----------KPFSPYMSKKDNQPVTKDLTPQCSPGLD 181
           LL   P   +P  IN              +PY     N     DL P+     D
Sbjct: 105 LLKTSPLAGLPKAINGLRALHNVTPISLLAPYQHVSKNSTNVHDLFPKTKRNTD 158

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.136    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,777,844
Number of extensions: 1182725
Number of successful extensions: 3309
Number of sequences better than 10.0: 27
Number of HSP's gapped: 3384
Number of HSP's successfully gapped: 27
Length of query: 247
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 140
Effective length of database: 41,212,137
Effective search space: 5769699180
Effective search space used: 5769699180
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 64 (29.3 bits)