Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E01012g6.14ON54454427640.0
Kwal_56.223876.14ON54352820570.0
KLTH0C11396g6.14ON55052220230.0
KLLA0D00979g6.14ON56148119070.0
Smik_5.276.14ON60849518470.0
Skud_5.296.14ON60848818420.0
Suva_5.76.14ON66448818430.0
YEL060C (PRB1)6.14ON63549518370.0
TDEL0G045506.14ON56447318280.0
NCAS0F002206.14ON69550317770.0
TBLA0A073006.14ON57348717250.0
ACR012C6.14ON54151116980.0
NDAI0K028806.14ON70449717130.0
ZYRO0C07942g6.14ON54850616560.0
Kpol_1032.56.14ON68050616470.0
Ecym_30186.14ON57548816020.0
CAGL0B03619g6.14ON46847715790.0
KAFR0L003606.14ON50243915350.0
KNAG0E009206.14ON53149015040.0
Kpol_1045.756.14ON47747314310.0
TPHA0M002306.14ON58547113500.0
Suva_15.1786.14ON47642113281e-179
Smik_15.1726.14ON47841913251e-179
Skud_15.1646.14ON48241813121e-177
YOR003W (YSP3)6.14ON47841812811e-172
CAGL0E02651g6.14ON48542211591e-154
KAFR0B065506.14ON45642511021e-146
NCAS0D026306.14ON45143910231e-134
NDAI0I022806.14ON4824689401e-121
KNAG0F02970singletonON4203509071e-117
CAGL0L13266gsingletonON5794777953e-98
NCAS0D043906.313ON4924385355e-61
Kpol_1028.616.313ON5183195358e-61
TDEL0A072806.313ON4363625263e-60
ZYRO0D08822g6.313ON4903585269e-60
Kpol_1018.56.313ON4653575187e-59
KNAG0I024706.313ON4753755013e-56
CAGL0L10802g6.313ON5173625024e-56
Smik_3.1496.313ON4913125014e-56
Suva_3.846.313ON5273124982e-55
YCR045C (RRT12)6.313ON4913124901e-54
SAKL0A02002g6.313ON4793174892e-54
Ecym_21056.313ON6103434944e-54
Skud_3.1246.313ON5403184888e-54
KLTH0A06094g6.313ON4963154841e-53
AAR069W6.313ON7683164918e-53
TBLA0F039706.313ON7342984881e-52
KAFR0J024506.313ON4783164751e-52
NDAI0I005606.313ON4833444603e-50
TPHA0D037606.313ON6073174654e-50
Kwal_23.61836.313ON4933194569e-50
KLLA0F06028g6.313ON5083294447e-48
TBLA0A067006.313ON4973203841e-39
Kwal_33.133721.78ON3773103552e-36
KLTH0F02288g1.78ON3803143438e-35
Kpol_2000.691.78ON3863043351e-33
ZYRO0F16764g1.78ON3863613005e-29
TDEL0C062301.78ON3643032971e-28
TPHA0B045201.78ON3882722644e-24
TBLA0A054101.78ON3822792281e-19
SAKL0G00440g2.6ON83685930.013
NDAI0F038902.6ON833260910.019
Suva_14.1062.6ON809257860.078
Skud_14.1012.6ON819259850.11
YNL238W (KEX2)2.6ON814256840.14
Smik_14.972.6ON814257830.16
NCAS0A008802.6ON833255830.18
KLLA0D19811g2.6ON756240830.19
Ecym_64862.6ON78194830.21
KLTH0H00418g2.6ON81185800.37
TBLA0B001302.6ON842253800.42
TPHA0P017902.6ON79983790.52
ZYRO0F15598g2.6ON79087790.53
KAFR0A080402.6ON76688780.78
CAGL0J07546g2.6ON789250780.79
KNAG0F007702.6ON82688761.1
Kwal_56.248002.6ON80385751.5
Kpol_1050.725.85ON98935742.4
ADL360C8.867ON645107732.7
TPHA0H010105.111ON1072134724.0
NCAS0F004905.85ON98765724.0
Kpol_1015.82.6ON84385724.1
CAGL0E01903g3.46ON42966714.6
NDAI0D026205.85ON98765714.9
CAGL0F08041g5.85ON99168706.4
AGR144C8.207ON207169706.9
TDEL0G010905.85ON98346707.0
ABL203W2.6ON76886707.2
Smik_16.665.85ON98723698.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E01012g
         (544 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar ...  1069   0.0  
Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060...   796   0.0  
KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {...   783   0.0  
KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar ...   739   0.0  
Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON} Y...   716   0.0  
Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON} Y...   714   0.0  
Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON} YE...   714   0.0  
YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}  PR...   712   0.0  
TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {O...   708   0.0  
NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14 ...   689   0.0  
TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa] ...   669   0.0  
ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON} S...   658   0.0  
NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {...   664   0.0  
ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {...   642   0.0  
Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..841...   639   0.0  
Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to ...   621   0.0  
CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} simila...   612   0.0  
KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14...   595   0.0  
KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {O...   583   0.0  
Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa] ...   555   0.0  
TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14...   524   0.0  
Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003...   516   e-179
Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003...   514   e-179
Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003...   509   e-177
YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putat...   498   e-172
CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} simila...   451   e-154
KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6...   429   e-146
NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14     398   e-134
NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {O...   366   e-121
KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON}              353   e-117
CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} som...   310   3e-98
NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {O...   210   5e-61
Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON} (1383...   210   8e-61
TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa] ...   207   3e-60
ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} simila...   207   9e-60
Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON} (14365.....   204   7e-59
KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {O...   197   3e-56
CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa...   197   4e-56
Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON...   197   4e-56
Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}...   196   2e-55
YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}  ...   193   1e-54
SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} simila...   192   2e-54
Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar t...   194   4e-54
Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON...   192   8e-54
KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {...   191   1e-53
AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic ho...   193   8e-53
TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {O...   192   1e-52
KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {...   187   1e-52
NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313    181   3e-50
TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {O...   183   4e-50
Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa] ...   180   9e-50
KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some s...   175   7e-48
TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON} Anc_6...   152   1e-39
Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045...   141   2e-36
KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly...   136   8e-35
Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa] ...   133   1e-33
ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]...   120   5e-29
TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa] ...   119   1e-28
TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa] ...   106   4e-24
TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1...    92   1e-19
SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar ...    40   0.013
NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {O...    40   0.019
Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238...    38   0.078
Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238...    37   0.11 
YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}  KEX2Subti...    37   0.14 
Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W...    37   0.16 
NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6...    37   0.18 
KLLA0D19811g Chr4 complement(1672338..1674608) [2271 bp, 756 aa]...    37   0.19 
Ecym_6486 Chr6 complement(941694..944039) [2346 bp, 781 aa] {ON}...    37   0.21 
KLTH0H00418g Chr8 (46022..48457) [2436 bp, 811 aa] {ON} similar ...    35   0.37 
TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6 Y...    35   0.42 
TPHA0P01790 Chr16 complement(373247..375646) [2400 bp, 799 aa] {...    35   0.52 
ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]...    35   0.53 
KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa] ...    35   0.78 
CAGL0J07546g Chr10 complement(733686..736055) [2370 bp, 789 aa] ...    35   0.79 
KNAG0F00770 Chr6 (137641..140121) [2481 bp, 826 aa] {ON} Anc_2.6...    34   1.1  
Kwal_56.24800 s56 complement(1150009..1152420) [2412 bp, 803 aa]...    33   1.5  
Kpol_1050.72 s1050 complement(157470..160439) [2970 bp, 989 aa] ...    33   2.4  
ADL360C Chr4 complement(72248..74185) [1938 bp, 645 aa] {ON} Syn...    33   2.7  
TPHA0H01010 Chr8 (213903..217121) [3219 bp, 1072 aa] {ON} Anc_5....    32   4.0  
NCAS0F00490 Chr6 (89926..92889) [2964 bp, 987 aa] {ON} Anc_5.85 ...    32   4.0  
Kpol_1015.8 s1015 complement(19725..20576,20692..20940,20990..20...    32   4.1  
CAGL0E01903g Chr5 (190465..191754) [1290 bp, 429 aa] {ON} simila...    32   4.6  
NDAI0D02620 Chr4 complement(606774..609737) [2964 bp, 987 aa] {O...    32   4.9  
CAGL0F08041g Chr6 complement(792575..795550) [2976 bp, 991 aa] {...    32   6.4  
AGR144C Chr7 complement(1017912..1024127) [6216 bp, 2071 aa] {ON...    32   6.9  
TDEL0G01090 Chr7 (223036..225987) [2952 bp, 983 aa] {ON} Anc_5.8...    32   7.0  
ABL203W Chr2 (26256..28562) [2307 bp, 768 aa] {ON} Syntenic homo...    32   7.2  
Smik_16.66 Chr16 (123019..125982) [2964 bp, 987 aa] {ON} YGR240C...    31   8.4  

>SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 544

 Score = 1069 bits (2764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/544 (96%), Positives = 526/544 (96%)

Query: 1   MKVQSXXXXXXXXXXXXXXXXXXEVDKSSKDVSVKEINSDSQEVLASFAKEITRAAAEKG 60
           MKVQS                  EVDKSSKDVSVKEINSDSQEVLASFAKEITRAAAEKG
Sbjct: 1   MKVQSTILPIAALTTLAAALVIPEVDKSSKDVSVKEINSDSQEVLASFAKEITRAAAEKG 60

Query: 61  EEVKLAPLVSSPQPANIIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFF 120
           EEVKLAPLVSSPQPANIIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFF
Sbjct: 61  EEVKLAPLVSSPQPANIIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFF 120

Query: 121 AATKGSADEYGIAAKSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSL 180
           AATKGSADEYGIAAKSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSL
Sbjct: 121 AATKGSADEYGIAAKSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSL 180

Query: 181 VFASEFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDFN 240
           VFASEFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDFN
Sbjct: 181 VFASEFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDFN 240

Query: 241 GRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVV 300
           GRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVV
Sbjct: 241 GRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVV 300

Query: 301 KGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNEN 360
           KGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNEN
Sbjct: 301 KGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNEN 360

Query: 361 QDACNTSPAAAENAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLS 420
           QDACNTSPAAAENAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLS
Sbjct: 361 QDACNTSPAAAENAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLS 420

Query: 421 GTSMASPHVAGLLTYFLSLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVLYELPEDTPN 480
           GTSMASPHVAGLLTYFLSLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVLYELPEDTPN
Sbjct: 421 GTSMASPHVAGLLTYFLSLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVLYELPEDTPN 480

Query: 481 YLIYNGGGQDLSDFWGKSEEQVKEEGSIQDFKDFKLSELIESFDTKTDLLFEEVRSVFDK 540
           YLIYNGGGQDLSDFWGKSEEQVKEEGSIQDFKDFKLSELIESFDTKTDLLFEEVRSVFDK
Sbjct: 481 YLIYNGGGQDLSDFWGKSEEQVKEEGSIQDFKDFKLSELIESFDTKTDLLFEEVRSVFDK 540

Query: 541 LNII 544
           LNII
Sbjct: 541 LNII 544

>Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060C
           (PRB1) - vacuolar protease B [contig 185] FULL
          Length = 543

 Score =  796 bits (2057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/528 (74%), Positives = 449/528 (85%), Gaps = 14/528 (2%)

Query: 24  EVDKSSKD--VSVKEINSDSQE-VLASFAKEITRAAAEKGEEVKLAPLVSSPQPANIIPH 80
           EV+++SKD  V+V+E  +   E +L+SF+KE+T+ AAE G  V L+PLV++    + IPH
Sbjct: 23  EVEEASKDALVAVEETAASLGESILSSFSKEVTKKAAESGAGVTLSPLVTARNMYDAIPH 82

Query: 81  RYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFFAATKGSADEYGIAAKSSEGG 140
           RYI+VFK    PEE+ FH E++SEAHA+SV KLD+ D+FF AT    +E GI A S EGG
Sbjct: 83  RYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEATMD--EEMGIMATSREGG 140

Query: 141 IQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSLVFASEFDTQNGAPWGLSRIS 200
           I +SFD+  ML GYIGYFT E+VDFIRMN  V F+E+DS+V+A+EFDTQNGAPWGLSRIS
Sbjct: 141 ILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWGLSRIS 200

Query: 201 HRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDFNGRAVWGKTVPQNDEDADGNG 260
           HRE+LNLGSFNKYLYDD AGKGVTSYVIDTGIN++HKDF GRA WGKTVP ND D DGNG
Sbjct: 201 HREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQDGNG 260

Query: 261 HGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEASKKNKKG 320
           HGTHCAGTIAS+HYGVAKNA VVA+KVLRSNGSG+MSDVVKGVEFAA+SHQ+A KKNKKG
Sbjct: 261 HGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFAAKSHQDAVKKNKKG 320

Query: 321 FKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAENAITVGAS 380
           FKGSTANMSLGGGKSPALD+AVNAAVKAGIHFAVAAGNENQDACN+SPAAAENAITVGAS
Sbjct: 321 FKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAITVGAS 380

Query: 381 TLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLSLQ 440
           TL+DDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLSLQ
Sbjct: 381 TLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLSLQ 440

Query: 441 PDSDSEFFQAS-GITPAQLKKKLIAYSTKDVLYELPEDTPNYLIYNGGGQDLSDFWGKSE 499
           PDSDSE+F A+ GITP+QLKKKLIAYSTK+ L +LPEDT NYLIYNGGGQDL DFW K  
Sbjct: 441 PDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGDLPEDTVNYLIYNGGGQDLDDFWVKDL 500

Query: 500 EQVKEEGSIQDFKDFKLSE---LIESFDTKTDLLFEEVRSVFDKLNII 544
           E+      + D KD   SE   +I++ + KTD L+EE+R +F+ LNII
Sbjct: 501 EE-----KVADAKDNTASEFESIIDALEEKTDGLYEEIREIFEGLNII 543

>KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 550

 Score =  783 bits (2023), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/522 (71%), Positives = 450/522 (86%), Gaps = 13/522 (2%)

Query: 32  VSVKEINSDSQEVLASFAKEITRAAAEKGEEVKLAPLVSSPQPANIIPHRYIIVFKKDAT 91
           + VK++ +  + +++SF+K++T+ AA KGE V+L+PLVSS      IPHRYI+VFK++ +
Sbjct: 33  LKVKDVITAGESIVSSFSKQMTKDAASKGESVELSPLVSSSGKYLAIPHRYIVVFKQNLS 92

Query: 92  PEEISFHKEIISEAHAESVAKLDSKDSFFAATKGSAD--------EYGIAAKSSEGGIQE 143
           PEE+ FHK+I+SEAH +SVAKL+S   FF +T+   +        +   +A++ EGGIQ+
Sbjct: 93  PEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQRSFSAQTREGGIQD 152

Query: 144 SFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSLVFASEFDTQNGAPWGLSRISHRE 203
           SFD++ +L GYIGYFTDE+VDFIRMN  V+F+E+DS+VFA EF TQNGAPWGLSRISHRE
Sbjct: 153 SFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQNGAPWGLSRISHRE 212

Query: 204 RLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDFNGRAVWGKTVPQNDEDADGNGHGT 263
           +LNLGSFNKYLYDDDAGKGVTSYVIDTG+NV+HKDF GRA WGKT+P ND D DGNGHGT
Sbjct: 213 KLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTIPTNDLDQDGNGHGT 272

Query: 264 HCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEASKKNKKGFKG 323
           HCAGTIAS+HYGVAKNA VVA+KVLRSNGSG+MSDVVKGVEFAA+SHQ+A K+NKKGFKG
Sbjct: 273 HCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFAAKSHQDAVKENKKGFKG 332

Query: 324 STANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAENAITVGASTLS 383
           STANMSLGGGKSPALD+AVNAAVKAGIHFAVAAGNENQDACN+SPA+AENA+TVGASTL+
Sbjct: 333 STANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPASAENAVTVGASTLA 392

Query: 384 DDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLSLQPDS 443
           DDRAYFSNWGKCVDIFAPGLNVLSTYIGS+TATATLSGTSMASPHVAGLLTYFLSLQPDS
Sbjct: 393 DDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPHVAGLLTYFLSLQPDS 452

Query: 444 DSEFFQAS-GITPAQLKKKLIAYSTKDVLYELPEDTPNYLIYNGGGQDLSDFWGKSEEQV 502
           DSE+F A+ GITP+QLKKKLIAYSTK+VL ++P+DT NYLI+NGGG+ L DFWGK  E V
Sbjct: 453 DSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNGGGEGLDDFWGK--ESV 510

Query: 503 KEEGSIQDFKDFKLSELIESFDTKTDLLFEEVRSVFDKLNII 544
            +E  ++D    ++   I++ + KTD+L+EE+R VFD +NII
Sbjct: 511 VDE--VEDTISSEIESFIDALEEKTDVLYEEIREVFDHMNII 550

>KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 561

 Score =  739 bits (1907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/481 (72%), Positives = 412/481 (85%), Gaps = 4/481 (0%)

Query: 65  LAPLVSSPQPANIIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFFAATK 124
           LAPL +    AN IP+RYIIVFKKDA+ +E+ FH+E++S  HA+++  L   D FF AT 
Sbjct: 84  LAPLSTVNDIANKIPNRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPFFTATS 143

Query: 125 GSADEYGIAAKSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSLVFAS 184
           G   E+G+ A S EGGIQ+SFDIA  L+GY+GYFT EV+DFIR +  VEF+E+DS+VF++
Sbjct: 144 GEHSEFGVKAHSLEGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSN 203

Query: 185 EFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDFNGRAV 244
            F+TQN APWGL+RISHRE+LNLGSFNKYLYDDDAGKGVT+YV+DTG+NVNHKDF+GRAV
Sbjct: 204 SFNTQNSAPWGLARISHREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAV 263

Query: 245 WGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVKGVE 304
           WGKT+P++D D DGNGHGTHCAGTI S HYGVAKNA++VA+KVLRSNGSGTMSDVVKGVE
Sbjct: 264 WGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVE 323

Query: 305 FAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDAC 364
           + A++H++A ++ KKGFKGSTANMSLGGGKSPALDLAVNAAVKAG+HFAVAAGNENQDAC
Sbjct: 324 YVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDAC 383

Query: 365 NTSPAAAENAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSM 424
           NTSPAAAENAITVGASTLSD+RAYFSNWGKCVDIF PGLN+LSTYIGS+TATATLSGTSM
Sbjct: 384 NTSPAAAENAITVGASTLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSGTSM 443

Query: 425 ASPHVAGLLTYFLSLQPDSDSEFFQAS-GITPAQLKKKLIAYSTKDVLYELPEDTPNYLI 483
           A+PHV GLLTYFLSLQPD+DSE+F A+ GITP+QLKKKLI +STK+VL +LPEDT NYLI
Sbjct: 444 ATPHVVGLLTYFLSLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNVLSDLPEDTVNYLI 503

Query: 484 YNGGGQDLSDFWGKSEEQVKEEGSIQDFKDFKLSELIESFDTKTDLLFEEVRSVFDKLNI 543
           YNGGGQDL D WGK     KE  +     +F L  LI S D+KTD +F++VR + D+ NI
Sbjct: 504 YNGGGQDLDDLWGKDYSIGKEPSA---NPEFSLESLINSLDSKTDAIFDDVRQLLDQFNI 560

Query: 544 I 544
           I
Sbjct: 561 I 561

>Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/495 (71%), Positives = 413/495 (83%), Gaps = 20/495 (4%)

Query: 58  EKGE-EVKLAPLVSSPQ--P---ANIIPHRYIIVFKKDATPEEISFHKEIISEAHAESVA 111
           EKG    KLAPLVS+ Q  P   + IIP+RYI+VFKK    EE++FHKE + +A  +SV 
Sbjct: 126 EKGRPNNKLAPLVSTAQFNPDAISKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVE 185

Query: 112 KLDSKDSFFAATKGSADEYGIAAKSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQW 171
            L ++D+FF +T+   D Y   + S  GGIQ+SF+I N+ +GYIGYFT E++D IR N  
Sbjct: 186 NLSAEDAFFTSTR---DTY--LSTSEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPL 240

Query: 172 VEFIEKDSLVFASEFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTG 231
           V+F+E+DS+V A+EFDTQN APWGL+RISHRERLNLGSFNKYLYDDDAG+GVTSYVIDTG
Sbjct: 241 VDFVERDSVVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTG 300

Query: 232 INVNHKDFNGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSN 291
           +N+NHKDF  RA+WGKT+P NDED DGNGHGTHCAGTIAS+HYGVAKNA VVA+KVLRSN
Sbjct: 301 VNINHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSN 360

Query: 292 GSGTMSDVVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIH 351
           GSGTMSDVVKGVE+AA++HQ+ +++ KKGFKGSTANMSLGGGKSPALDLAVNAAV+AGIH
Sbjct: 361 GSGTMSDVVKGVEYAAKAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIH 420

Query: 352 FAVAAGNENQDACNTSPAAAENAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIG 411
           FAVAAGNENQDACNTSPA+A+ AITVGASTLSDDRAYFSNWGKCVD+FAPGLN+LSTYIG
Sbjct: 421 FAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIG 480

Query: 412 SETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQ--ASGITPAQLKKKLIAYSTKD 469
           S+ ATATLSGTSMASPHVAGLLTYFLSLQP SDSEFF+     +TP QLKKKLI YSTKD
Sbjct: 481 SDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKD 540

Query: 470 VLYELPEDTPNYLIYNGGGQDLSDFWGKSEEQVKEEGSIQDFKDFKLSELIESFDTKTDL 529
           +L+++PEDTPN+LIYNGGGQDLS FW  +++     GS     +  + E I S   KTDL
Sbjct: 541 ILFDIPEDTPNFLIYNGGGQDLSAFWNDTKKS-HPSGSKH---ELNMDEFIGS---KTDL 593

Query: 530 LFEEVRSVFDKLNII 544
           LFE+VR V DKLNII
Sbjct: 594 LFEQVRDVLDKLNII 608

>Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  714 bits (1842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/488 (71%), Positives = 406/488 (83%), Gaps = 19/488 (3%)

Query: 64  KLAPLVSSPQ--PA---NIIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDS 118
           KLAPLVS+ Q  PA    IIP+RYIIVFKK    E   FHKE + +A  +SV  L ++D+
Sbjct: 133 KLAPLVSTAQFDPAAMPKIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDA 192

Query: 119 FFAATKGSADEYGIAAKSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKD 178
           FF +T+ S+      + S  GGIQ+SF+I NM +GYIGYFT E++D IR N  V+F+E+D
Sbjct: 193 FFISTRDSS-----LSTSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERD 247

Query: 179 SLVFASEFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKD 238
           S+V A++FDTQN APWGL+RISHRERLNLGSFNKYLYDDDAG+GVTSYVIDTG+NVNHKD
Sbjct: 248 SVVEATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKD 307

Query: 239 FNGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSD 298
           F  RA+WGKT+P NDED DGNGHGTHCAGTIAS+HYGVAKNA VVA+KVLRSNGSGTMSD
Sbjct: 308 FEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSD 367

Query: 299 VVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGN 358
           VVKGVE+AA++HQ+ +++ KKGFKGSTANMSLGGGKSPALDLAVNAAV+AGIHFAVAAGN
Sbjct: 368 VVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGN 427

Query: 359 ENQDACNTSPAAAENAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATAT 418
           ENQDACNTSPA+A+ AITVGASTLSDDRAYFSNWGKCVDIFAPGLN+LSTYIGS+ ATAT
Sbjct: 428 ENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDATAT 487

Query: 419 LSGTSMASPHVAGLLTYFLSLQPDSDSEFFQAS--GITPAQLKKKLIAYSTKDVLYELPE 476
           LSGTSMASPHVAGLLTYFLSLQP SDSEFF+     +TP QLK KLI YSTKD+L+++PE
Sbjct: 488 LSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVPE 547

Query: 477 DTPNYLIYNGGGQDLSDFWGKSEEQVKEEGSIQDFKDFKLSELIESFDTKTDLLFEEVRS 536
           DTPN LIYNGGGQDLS FW  +    K+  S +  ++  + E I S   KTDL+FE+VR 
Sbjct: 548 DTPNALIYNGGGQDLSAFWNDT----KKSHSSRFKQELNMDEFIGS---KTDLIFEQVRD 600

Query: 537 VFDKLNII 544
           V DKLNII
Sbjct: 601 VLDKLNII 608

>Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON}
           YEL060C (REAL)
          Length = 664

 Score =  714 bits (1843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/488 (71%), Positives = 409/488 (83%), Gaps = 18/488 (3%)

Query: 64  KLAPLVSSPQ--P---ANIIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDS 118
           KLAPLVS+ Q  P     IIP+RYIIVFKKD  PEE +FH+E + +A  +SV  L ++D+
Sbjct: 188 KLAPLVSTEQFNPDAITKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDA 247

Query: 119 FFAATKGSADEYGIAAKSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKD 178
           FF +T+ +A      + S  GGIQ+SF+I ++ +GYIGYFT E+VD IR N  V+F+EKD
Sbjct: 248 FFISTRDAA-----LSSSEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKD 302

Query: 179 SLVFASEFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKD 238
           S+V A++FDTQN APWGL+R+SHRERLNLGSFNKYLYDDDAG+GVTSYVIDTG+NVNHKD
Sbjct: 303 SVVEATDFDTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKD 362

Query: 239 FNGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSD 298
           F  RA+WGKT+P NDED DGNGHGTHCAGTIAS+HYGVAKNA VVA+KVLRSNGSGTMSD
Sbjct: 363 FEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSD 422

Query: 299 VVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGN 358
           V+KGVE+AA++HQ+ +++ KKGFKGSTANMSLGGGKSPALDLAVNAAV+AGIHFAVAAGN
Sbjct: 423 VLKGVEYAAKAHQKQAEEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGN 482

Query: 359 ENQDACNTSPAAAENAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATAT 418
           ENQDACNTSPA+A+ AITVGASTLSDDRAYFSN+GKCVD+FAPGLN+LSTYIGS+ ATAT
Sbjct: 483 ENQDACNTSPASADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATAT 542

Query: 419 LSGTSMASPHVAGLLTYFLSLQPDSDSEFFQAS--GITPAQLKKKLIAYSTKDVLYELPE 476
           LSGTSMASPHVAGLLTYFLSLQP SDSEFF+     +TP QLKKKLI YSTKD+L+++P+
Sbjct: 543 LSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPD 602

Query: 477 DTPNYLIYNGGGQDLSDFWGKSEEQVKEEGSIQDFKDFKLSELIESFDTKTDLLFEEVRS 536
           DTPN LIYNGGGQDLS FW  +++     G  Q   +  L E I S   KTDL+FE+VR 
Sbjct: 603 DTPNALIYNGGGQDLSAFWNDTKKSHSSSGFKQ---ELNLDEFIGS---KTDLIFEQVRD 656

Query: 537 VFDKLNII 544
           V DKLNII
Sbjct: 657 VLDKLNII 664

>YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}
           PRB1Vacuolar proteinase B (yscB), a serine protease of
           the subtilisin family; involved in protein degradation
           in the vacuole and required for full protein degradation
           during sporulation; activity inhibited by Pbi2p
          Length = 635

 Score =  712 bits (1837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/495 (70%), Positives = 411/495 (83%), Gaps = 20/495 (4%)

Query: 58  EKGEEV-KLAPLVSSPQ--P---ANIIPHRYIIVFKKDATPEEISFHKEIISEAHAESVA 111
           EKG    +LAPLVS+ Q  P   + IIP+RYIIVFK+ A  EEI FHKE + +A  +SV 
Sbjct: 153 EKGRHHNRLAPLVSTAQFNPDAISKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVE 212

Query: 112 KLDSKDSFFAATKGSADEYGIAAKSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQW 171
            L ++D+FF +TK ++      + S  GGIQ+SF+I N+ +GYIGYFT E+VD IR N  
Sbjct: 213 NLSAEDAFFISTKDTS-----LSTSEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPL 267

Query: 172 VEFIEKDSLVFASEFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTG 231
           V+F+E+DS+V A+EFDTQN APWGL+RISHRERLNLGSFNKYLYDDDAG+GVTSYVIDTG
Sbjct: 268 VDFVERDSIVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTG 327

Query: 232 INVNHKDFNGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSN 291
           +N+NHKDF  RA+WGKT+P NDED DGNGHGTHCAGTIAS+HYGVAKNA VVA+KVLRSN
Sbjct: 328 VNINHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSN 387

Query: 292 GSGTMSDVVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIH 351
           GSGTMSDVVKGVE+AA++HQ+ +++ KKGFKGSTANMSLGGGKSPALDLAVNAAV+ GIH
Sbjct: 388 GSGTMSDVVKGVEYAAKAHQKEAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEVGIH 447

Query: 352 FAVAAGNENQDACNTSPAAAENAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIG 411
           FAVAAGNENQDACNTSPA+A+ AITVGASTLSDDRAYFSNWGKCVD+FAPGLN+LSTYIG
Sbjct: 448 FAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIG 507

Query: 412 SETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQ--ASGITPAQLKKKLIAYSTKD 469
           S+ ATATLSGTSMASPHVAGLLTYFLSLQP SDSEFF+     +TP QLKKKLI YSTKD
Sbjct: 508 SDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKD 567

Query: 470 VLYELPEDTPNYLIYNGGGQDLSDFWGKSEEQVKEEGSIQDFKDFKLSELIESFDTKTDL 529
           +L+++PEDTPN LIYNGGGQDLS FW  +    K+  S    ++  + E I S   KTDL
Sbjct: 568 ILFDIPEDTPNVLIYNGGGQDLSAFWNDT----KKSHSSGFKQELNMDEFIGS---KTDL 620

Query: 530 LFEEVRSVFDKLNII 544
           +F++VR + DKLNII
Sbjct: 621 IFDQVRDILDKLNII 635

>TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {ON}
           Anc_6.14 YOR003W
          Length = 564

 Score =  708 bits (1828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/473 (73%), Positives = 395/473 (83%), Gaps = 17/473 (3%)

Query: 74  PANIIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFFAATKGSADEYGIA 133
           P N  PHRYI+V K  ++PEEI+ H E I+++  +SV +L   D FF+A        G+ 
Sbjct: 107 PPNAFPHRYIVVLKH-SSPEEIALHMEAITQSQLQSVGELAQDDPFFSAQ-------GV- 157

Query: 134 AKSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSLVFASEFDTQNGAP 193
              + GGIQ+SFD+A +LNGY+GYFTD VV+ IR +  V+F+E DS V ASEFDTQNGAP
Sbjct: 158 --RTTGGIQDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAP 215

Query: 194 WGLSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDFNGRAVWGKTVPQND 253
           WGLSRISHRERLNLGSFNKYL+DD+AGKGVTSYVIDTGINV H+DF GRA WGKT+P ND
Sbjct: 216 WGLSRISHRERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTND 275

Query: 254 EDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEA 313
           ED DGNGHGTHCAGTIAS+HYGVAK A+VVA+KVLRSNGSG+MSDV+KGVEFAAQSHQ+A
Sbjct: 276 EDLDGNGHGTHCAGTIASKHYGVAKGADVVAVKVLRSNGSGSMSDVIKGVEFAAQSHQKA 335

Query: 314 SKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEN 373
            K  KKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAE 
Sbjct: 336 VKDKKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQ 395

Query: 374 AITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLL 433
           A+TVGASTLSDDRAYFSN+GKCVDIFAPGLN+LSTYIGS+ ATATLSGTSMASPHVAGLL
Sbjct: 396 AVTVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLL 455

Query: 434 TYFLSLQPDSDSEFFQA--SGITPAQLKKKLIAYSTKDVLYELPEDTPNYLIYNGGGQDL 491
           TYFLSLQPDSDS+FF A   G+TP QLKKKLIAYSTKD+LY+LPEDTPN LIYNGGG  L
Sbjct: 456 TYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNGGGHGL 515

Query: 492 SDFWGKSEEQVKEEGSIQDFKDFKLSELIESFDTKTDLLFEEVRSVFDKLNII 544
             FW   +   K+E + + F+D  L EL ++   KTD LF++VR V D+LNII
Sbjct: 516 KGFWDGHD---KQEANTR-FQDTDLQELSDNLGAKTDALFDQVRDVLDRLNII 564

>NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14
           YEL060C
          Length = 695

 Score =  689 bits (1777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/503 (68%), Positives = 404/503 (80%), Gaps = 30/503 (5%)

Query: 26  DKSSKDVSVKEINSDSQEVLASFAKEITRAAAEKGEEV------KLAPLVS-SPQPA--- 75
           DK    ++ K+ N D  +V+A ++++I  +A + G+ V      K+APLV+ +P P    
Sbjct: 29  DKDKLAINNKKFN-DITDVVAKYSEQIIESARKIGKSVQDSVNLKMAPLVTPTPYPVVSG 87

Query: 76  ---------NIIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFFAATKGS 126
                    NIIP+RYI+VFKK   PEE+ FHKE+I++   ES AKL   D FF+A+   
Sbjct: 88  ASANSNANSNIIPNRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKFFSAS--- 144

Query: 127 ADEYGIAAKS-SEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSLVFASE 185
                I  +S ++GGI  +F+I+N+LNGY+GYFTDEV++ IRMN  VE++EKDSLV A+E
Sbjct: 145 ----AIEDESINQGGILTTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATE 200

Query: 186 FDTQNGAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDFNGRAVW 245
           FD QN APWGL+RISHRERLNLGSFNKYLYDDDAGKGVT YVIDTGIN  H DFN RAVW
Sbjct: 201 FDNQNNAPWGLARISHRERLNLGSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVW 260

Query: 246 GKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEF 305
           GKT+P ND+D DGNGHGTHCAGTIAS HYGVAKNAEVVA+KVLRSNGSG+MSDV+KGVEF
Sbjct: 261 GKTIPLNDKDIDGNGHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEF 320

Query: 306 AAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACN 365
           AA+SH +A+K+ KKGFKGSTANMSLGGGKSP LDLAVNAAV AGIHFAVAAGNENQDACN
Sbjct: 321 AAESHIKAAKEKKKGFKGSTANMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACN 380

Query: 366 TSPAAAENAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMA 425
           TSPA+AE AITVGASTLSDDRAYFSNWGKCVDIFAPGLN+LSTYIG + ATATLSGTSMA
Sbjct: 381 TSPASAERAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMA 440

Query: 426 SPHVAGLLTYFLSLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVLYELPEDTPNYLIYN 485
           SPHVAGLLTYFLSLQP SDSEFF  + +TPAQ+KKKLI YS+KDVL++LPE TPN LI+N
Sbjct: 441 SPHVAGLLTYFLSLQPGSDSEFFDPTELTPAQMKKKLINYSSKDVLFDLPEGTPNKLIFN 500

Query: 486 GGGQDLSDFWGK--SEEQVKEEG 506
           G G +L D W K   EE +K +G
Sbjct: 501 GAGGNLDDLWNKKSQEEDIKVKG 523

>TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa]
           {ON} Anc_6.14 YOR003W
          Length = 573

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/487 (66%), Positives = 386/487 (79%), Gaps = 23/487 (4%)

Query: 61  EEVKLAPLVS-SPQPANIIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSF 119
           E   +APL S S  P NIIPHRYII FKKD  PEEI FH++ I+E   +S+A+L     +
Sbjct: 107 ESPAIAPLYSQSLHPQNIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPY 166

Query: 120 FAATKGSADEYGIAAKSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDS 179
           F + +G            +  I +SF+I ++L GYIGYFTD+V+DFIR+N  V+F+E+DS
Sbjct: 167 FNSVEG---------LDLQQPIIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDS 217

Query: 180 LVFASEFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDF 239
            V  +EFDTQNGAPWGL+RISHRERLNLGSFNKYL+DD AG+GVT+YVIDTG+NV H DF
Sbjct: 218 TVNINEFDTQNGAPWGLARISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDF 277

Query: 240 NGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDV 299
            GRA WGKT+P NDED DGNGHGTHCAGTIAS+HYGVAKNA VVA+KVLRSNGSG+MSDV
Sbjct: 278 EGRASWGKTIPNNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDV 337

Query: 300 VKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNE 359
           +KGVE+A  SH    K  K GFKGSTANMSLGGGKSP+LDLAVNAAVKAGIHFAVAAGNE
Sbjct: 338 LKGVEYATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNE 397

Query: 360 NQDACNTSPAAAENAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATL 419
           NQDACNTSPA+A+ AITVGASTLSDDRAYFSNWGKCVD+FAPGLN+LSTYIGS+ ATATL
Sbjct: 398 NQDACNTSPASAKYAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATL 457

Query: 420 SGTSMASPHVAGLLTYFLSLQPDSDSEFF--QASGITPAQLKKKLIAYSTKDVLYELPED 477
           SGTSMASPHVAGLL+YFLSLQP+ DSEF   +  GITPAQLKK+LI+Y TKD+L ++PE 
Sbjct: 458 SGTSMASPHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPEL 517

Query: 478 TPNYLIYNGGGQDLSDFWGKSEEQVKEEGSIQDFKDFKLSELIESFDTKTDLLFEEVRSV 537
           TPN L++NG GQDLSDFW  S+             D + +E+ ++ D   D+L+++   +
Sbjct: 518 TPNVLVFNGAGQDLSDFWNISKP-----------ADLESNEVYKNLDLVGDVLYDQFTGI 566

Query: 538 FDKLNII 544
           F K+N++
Sbjct: 567 FKKMNLL 573

>ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL060C
           (PRB1) and YOR003W (YSP3)
          Length = 541

 Score =  658 bits (1698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/511 (61%), Positives = 393/511 (76%), Gaps = 16/511 (3%)

Query: 43  EVLASFAKEITRAAAEKGEEVKLAPLVSSPQPANIIPHRYIIVFKKDATPEEISFHKEII 102
           +++   A+E     A+  E+   +PL         IPH+YI+VF++  + EE +FH E++
Sbjct: 38  QLVQWMARENQERKAQGAEQ--QSPLFRVDDVTRAIPHKYIVVFREGVSDEEAAFHMELV 95

Query: 103 SEAHAESVAKLDSKDSFFAATKGSADEYGIAAKSSEGGIQESFDIANMLNGYIGYFTDEV 162
             AHAESVA+LD + +FF +T+G  +E+GIAA  +EGGI+  F +   L GY+GYFT+++
Sbjct: 96  EAAHAESVARLDEQHAFFRSTRGENNEFGIAATRAEGGIEGEFALGEQLRGYVGYFTEDM 155

Query: 163 VDFIRMNQWVEFIEKDSLVFASEFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDDAGKG 222
           V  +R N  V F+E+DS+VFAS+F TQNGAPWGL+R+SHRE+LN GSFNKYLYDD++G+G
Sbjct: 156 VGLLRSNPHVHFVEEDSMVFASDFTTQNGAPWGLARVSHREKLNSGSFNKYLYDDNSGEG 215

Query: 223 VTSYVIDTGINVNHKDFNGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEV 282
           VTSYVIDTGIN++H DF  RA+WGKT+P ND D DGNGHGTHCAGTIAS+ YGVAK A V
Sbjct: 216 VTSYVIDTGINIDHVDFEDRALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGVAKKANV 275

Query: 283 VAIKVLRSNGSGTMSDVVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAV 342
           VA+KVLRSNG+G+MSDV++GVE+A ++H++A++K  KGFKGSTANMSLGGG+S ALDLAV
Sbjct: 276 VAVKVLRSNGTGSMSDVLRGVEYAVKAHRKAAEKADKGFKGSTANMSLGGGRSQALDLAV 335

Query: 343 NAAVKAGIHFAVAAGNENQDACNTSPAAAENAITVGASTLSDDRAYFSNWGKCVDIFAPG 402
           +AAV AGIHFAVAAGNENQDACNTSPAA++ AITVGASTL+DDRAYFSNWG+CVD+FAPG
Sbjct: 336 DAAVDAGIHFAVAAGNENQDACNTSPAASQKAITVGASTLADDRAYFSNWGRCVDLFAPG 395

Query: 403 LNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQASGITPAQLKKKL 462
           +N+LSTYIGS+TA ATLSGTSMASPHVAGLLTYFLSLQPD DSEF     I+P  LKKK+
Sbjct: 396 MNILSTYIGSDTAVATLSGTSMASPHVAGLLTYFLSLQPDGDSEFRNKQTISPEVLKKKV 455

Query: 463 IAYSTKDVLYELPEDTPNYLIYNGGGQDLSDFWGKSEEQVK---------EEGSIQDFKD 513
           I + TKD L  LP  T N LIYNGGG DLSDFWG   ++V          EE    D   
Sbjct: 456 IDFGTKDALSSLPARTANVLIYNGGGADLSDFWGNKPKKVSGPKFTYADDEEAMGSD--- 512

Query: 514 FKLSELIESFDTKTDLLFEEVRSVFDKLNII 544
             L  LI   ++ TD +F   R++ D++NII
Sbjct: 513 --LDRLIHELESSTDAMFSGFRTILDRMNII 541

>NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {ON}
           Anc_6.14
          Length = 704

 Score =  664 bits (1713), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/497 (66%), Positives = 392/497 (78%), Gaps = 21/497 (4%)

Query: 63  VKLAPLVSSP----------QPANIIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAK 112
           +KLAPL++            +   I+P++YIIVFK     +EIS+HKE+ISE   +S ++
Sbjct: 214 IKLAPLITPTFGDDIHTQGFKHPRILPNKYIIVFKDSINIDEISYHKELISEIQQQSASR 273

Query: 113 LDSKDSFFAATKGSADEYGIAAKSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWV 172
           L     FF +T               GGI  SF+I N+L+GY GYFT EV+D IR+N  V
Sbjct: 274 LPPHHHFFHSTSEEE-----EESFRNGGIISSFNINNILSGYSGYFTQEVIDLIRLNPLV 328

Query: 173 EFIEKDSLVFASEFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGI 232
           +++E+DS+V  +EF+TQN APWGLSRISHRERLNLGSFNKYLYDDDAGKGVT +VIDTGI
Sbjct: 329 KYVERDSIVQTTEFNTQNNAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGI 388

Query: 233 NVNHKDFNGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNG 292
           NVNH DF  RA+WGKT+P ND+D DGNGHGTHCAGTIAS HYGVAKNAEVVA+KVLRSNG
Sbjct: 389 NVNHVDFGKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNG 448

Query: 293 SGTMSDVVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHF 352
           SG+MSDV+KGVEFAA++H   ++KNKK +KGSTANMSLGGGKSP LDLAVNAAV+AGIHF
Sbjct: 449 SGSMSDVIKGVEFAAETHLN-NEKNKKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHF 507

Query: 353 AVAAGNENQDACNTSPAAAENAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGS 412
           +VAAGNENQDACN+SPA+AENAITVGASTLSDDRAYFSNWG+CVD+FAPGLN+LSTY+G 
Sbjct: 508 SVAAGNENQDACNSSPASAENAITVGASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGD 567

Query: 413 -ETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQASG---ITPAQLKKKLIAYSTK 468
               TATLSGTSMASPHVAGLLTYFLSLQPDS S FF +     ITP QLKKKLIAYST 
Sbjct: 568 GNDNTATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTS 627

Query: 469 DVLYELPEDTPNYLIYNGGGQDLSDFW-GKSEEQVKEEGSIQDFKDFKLSELIESFDTKT 527
           D+LY+LP+ TPN LIYNG G D+SD W GK +EQ  EE + +D  +F+     +S   KT
Sbjct: 628 DILYDLPDGTPNKLIYNGAGGDISDLWNGKVQEQAHEEPAHEDKINFENLVDSDSMSGKT 687

Query: 528 DLLFEEVRSVFDKLNII 544
           DL F+++R+VF+K+NII
Sbjct: 688 DLFFDQIRNVFEKMNII 704

>ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 548

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/506 (61%), Positives = 386/506 (76%), Gaps = 16/506 (3%)

Query: 41  SQEVLASFAKEITRAAAEKGEEVKLAPLVSSPQPANIIPHRYIIVFKKDATPEEISFHKE 100
           S++ LA FA ++T+   ++      APLV       ++ +RYII+FKK   P+EI FH+E
Sbjct: 57  SKDELAVFASKLTQEVQDR-----FAPLVVPEDTLGVLENRYIILFKKGVNPQEIGFHRE 111

Query: 101 IISEAHAESVAKLDSKDSFFAATK--GSADEYGIAAKSSEGGIQESFDIANMLNGYIGYF 158
           +I + H + V++L  + SFF   +  G  D       S  GGI  +FDI  ML GY GYF
Sbjct: 112 LIEQVHLQEVSQLPEEHSFFEGIRLDGVYD-------SPLGGIDHTFDINGMLMGYSGYF 164

Query: 159 TDEVVDFIRMNQWVEFIEKDSLVFASEFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDD 218
             +V+D IRM+  +E +E+DS+V+  + DT+NGAPWGL+RISHRERLNLGS+NKYLYD+ 
Sbjct: 165 PSKVLDVIRMSPLIEMVEQDSVVYTQKADTENGAPWGLARISHRERLNLGSYNKYLYDEQ 224

Query: 219 AGKGVTSYVIDTGINVNHKDFNGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAK 278
            G GVTSYVIDTG+NV+H  F GRA WGKT+P  D D DGNGHGTHCAGTI S  YGVAK
Sbjct: 225 GGSGVTSYVIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAK 284

Query: 279 NAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPAL 338
            A++VA+KVLRSNGSG+MSDV+KGVE+AAQ HQ A K+ K GFKGSTANMSLGGGKSP+L
Sbjct: 285 GADIVAVKVLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSL 344

Query: 339 DLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAENAITVGASTLSDDRAYFSNWGKCVDI 398
           D AVNAAV AG++FAVAAGNE+QDACNTSPA+A   ITVGASTLSDDRAYFSN+GKCVD+
Sbjct: 345 DQAVNAAVAAGLNFAVAAGNEDQDACNTSPASASGPITVGASTLSDDRAYFSNYGKCVDV 404

Query: 399 FAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQASGITPAQL 458
           FAPGLN+LSTYIGS+++TATLSGTSMASPHVAGLL YFLSLQP SDSEF   S I+P QL
Sbjct: 405 FAPGLNILSTYIGSDSSTATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQL 464

Query: 459 KKKLIAYSTKDVLYELPEDTPNYLIYNGGGQDLSDFWGKSEEQVKEEGSIQDFKDFKLSE 518
           KKKL+A+STKDVL ++P  TPN LIYNGGG DLS FWG  E  V +E    +  D +L +
Sbjct: 465 KKKLLAFSTKDVLSDIPSGTPNLLIYNGGGGDLSGFWGSKE--VAQELEFNEKVDLELHD 522

Query: 519 LIESFDTKTDLLFEEVRSVFDKLNII 544
           L++   +KTD +F ++R + D+L+II
Sbjct: 523 LVDELGSKTDAVFGQIRGLMDRLDII 548

>Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..8410)
           [2043 nt, 681 aa]
          Length = 680

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/506 (61%), Positives = 401/506 (79%), Gaps = 25/506 (4%)

Query: 43  EVLASFAKEITRAAAEKGEEVKLAPLVSSPQPAN---IIPHRYIIVFKKDATPEEISFHK 99
           +++ S  ++I  +A + GE+VK APL S         +IP++YIIVFKKD + +++  HK
Sbjct: 194 DIVDSVTQQIFESAEKSGEKVKYAPLHSMENTKYENLVIPNKYIIVFKKDVSVKDMQIHK 253

Query: 100 EIISEAHAESVAKLDSKDSFFAATKGSADEYGIAAKSSEGGIQESFDIANMLNGYIGYFT 159
           ++I+ A  +  +  D   S                 S  GGI+E+F++AN+ +GYIG+F 
Sbjct: 254 DLIARAQFQYASVSDETSS-----------------SILGGIEEAFNVANLFHGYIGHFN 296

Query: 160 DEVVDFIRMNQWVEFIEKDSLVFASEFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDDA 219
           +++V FIR++  V+F+E+DS+V A+E DTQN APWGL+RISHR+ LNLGS+NKYLYDD A
Sbjct: 297 EQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLARISHRDGLNLGSYNKYLYDDVA 356

Query: 220 GKGVTSYVIDTGINVNHKDFNGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKN 279
           G+GVT+YVIDTGIN+ HK+F GRAVWGKT+P+ND+D DGNGHGTHCAGTIAS++YGVAKN
Sbjct: 357 GEGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDVDGNGHGTHCAGTIASKNYGVAKN 416

Query: 280 AEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALD 339
           AEVVA+KVLRS+GSGTMSDV+KGVE+AA SHQ+A ++ KKGFKGSTANMSLGGGKS +LD
Sbjct: 417 AEVVAVKVLRSDGSGTMSDVLKGVEYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLD 476

Query: 340 LAVNAAVKAGIHFAVAAGNENQDACNTSPAAAENAITVGASTLSDDRAYFSNWGKCVDIF 399
           LAV+AAVK+GIHFAVAAGNENQDACN+SPAA+ENAITVGASTLSDDRAYFSNWGKCVD+F
Sbjct: 477 LAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVGASTLSDDRAYFSNWGKCVDVF 536

Query: 400 APGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQ--ASGITPAQ 457
           APGLN+LSTYIGS+ ATATLSGTSMASPHVAGLL+YFLS+QPD+DSEFF   ++ I+PAQ
Sbjct: 537 APGLNILSTYIGSDEATATLSGTSMASPHVAGLLSYFLSMQPDADSEFFSSGSNSISPAQ 596

Query: 458 LKKKLIAYSTKDVLYELPEDTPNYLIYNGGGQDLSDFWGKSEEQVKEEGSIQDFKDFKLS 517
           LKKKLIAYSTK++  +LPE TPN L+YN  G ++SDFW    E   E    +  K+F+L 
Sbjct: 597 LKKKLIAYSTKNLFQDLPEKTPNLLVYN-AGHNISDFWKPKSESSAEPN--ERAKEFELE 653

Query: 518 ELIESFDTKTDLLFEEVRSVFDKLNI 543
           +L++S     D     ++ VF+++++
Sbjct: 654 DLVDSAQWIADTWLNGIQQVFERMDL 679

>Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to
           Ashbya gossypii ACR012C
          Length = 575

 Score =  621 bits (1602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/488 (62%), Positives = 379/488 (77%), Gaps = 13/488 (2%)

Query: 62  EVKLAPLVSSPQPANIIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFFA 121
           ++KLA L  + +    IPHRYI++FK   T  ++  H+++++ AH E++A+LD   SFF 
Sbjct: 96  DMKLASLSDNSRA---IPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFD 152

Query: 122 ATKGSADEYGIAAKSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSLV 181
           AT+G   E GI+A+S EGGI+E F+IA  L GY GYFTD ++D IR +  V+ IE+DS+V
Sbjct: 153 ATEGMHHE-GISARSVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIV 211

Query: 182 FASEFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDFNG 241
            AS+F+TQ GAPWGL+R+SHRERLNLGSFNKYLYDD+AGKGVT+YVIDTGIN++H +F G
Sbjct: 212 HASDFETQTGAPWGLARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEG 271

Query: 242 RAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVK 301
           RA WGKT+P ND D DGNGHGTHCAGTIAS+ YGVAKNA+VVA+KVLR+NG+GTMSDV++
Sbjct: 272 RAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLR 331

Query: 302 GVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQ 361
           GVE+    H++AS      FKGSTANMSLGGGKS AL+LAV+AAV AGIHFAVAAGNENQ
Sbjct: 332 GVEYVVAEHRKAS--GDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQ 389

Query: 362 DACNTSPAAAENAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSG 421
           DACNTSPA+++  ITV ASTLSDDRAYFSNWG CVDIFAPGLN+LSTYIGS+TA ATLSG
Sbjct: 390 DACNTSPASSKKCITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSG 449

Query: 422 TSMASPHVAGLLTYFLSLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVLYELPEDTPNY 481
           TSMASPHVAGLL YFLSLQPDS SE++  S I+P  LKKK++AY +K++L  +P  T N 
Sbjct: 450 TSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANN 509

Query: 482 LIYNGGGQDLSDFW-----GKSEEQVKEEGSIQDFKDFKLSELIESFDTKTDLLFEEVRS 536
           LI+NGGG  L  FW     G  +E+V       D  DF+   L++   + +  LF E+R+
Sbjct: 510 LIFNGGGGSLDSFWNSKCDGCEQEKVSSSHGKAD--DFESESLMDCLHSTSHSLFGEIRN 567

Query: 537 VFDKLNII 544
             D+L++I
Sbjct: 568 FLDRLDLI 575

>CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} similar
           to uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
           protease B or uniprot|P25036 Saccharomyces cerevisiae
           YOR003w YSP3
          Length = 468

 Score =  612 bits (1579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/477 (64%), Positives = 371/477 (77%), Gaps = 18/477 (3%)

Query: 77  IIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFFAATKGSADEYGIAAKS 136
           ++PH+YI+V KK  +PE ++     +S AHA ++  L  +  FF         +  A   
Sbjct: 1   MVPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFF--------NFVNAEGL 52

Query: 137 SEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSLVFASEFDTQNGAPWGL 196
             GGI++ F+I ++  G IGYF + VV  +  +  VEF+E+DS+V AS FDTQN APWGL
Sbjct: 53  PRGGIKDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGL 112

Query: 197 SRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDFNGRAVWGKTVPQNDEDA 256
           +RISHR+RLNLG+FNKYLYD+  G+GVT+YVIDTGINV H +F+GRA WGKT+P ND D 
Sbjct: 113 ARISHRDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDI 172

Query: 257 DGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEASKK 316
           DGNGHGTHCAGTIAS+HYG+AK A VVA+KVL+S+GSGTMSDV+KGVE+AAQ+H + SK 
Sbjct: 173 DGNGHGTHCAGTIASKHYGIAKKANVVAVKVLKSDGSGTMSDVIKGVEYAAQAHLKESKN 232

Query: 317 NKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAENAIT 376
           NKK FKGSTANMSLGGGKSPALD+AVNAAV AGIHFAVAAGNENQDACNTSPA+AE AIT
Sbjct: 233 NKK-FKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAIT 291

Query: 377 VGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIG-SETATATLSGTSMASPHVAGLLTY 435
           VGASTLSDDRAYFSNWGKCVDIFAPGLN+LSTYIG +   TA+LSGTSMASPHVAGLLTY
Sbjct: 292 VGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTY 351

Query: 436 FLSLQPDSDSEFFQAS--GITPAQLKKKLIAYSTKDVLYELPE-DTPNYLIYNGGGQDLS 492
           FLSLQPDSDSEF+ AS  G+TPAQLKKKLIAYSTK+VL +LP+ D+PN LIYNG G DL 
Sbjct: 352 FLSLQPDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLG 411

Query: 493 DFWGKS--EEQVKEEGSIQDFKDF---KLSELIESFDTKTDLLFEEVRSVFDKLNII 544
            FW  +  +EQ  E    +   +     L++++      TD LF +VR++ DK+NII
Sbjct: 412 VFWNSTSADEQSAEHPEQRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLLDKMNII 468

>KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14
           YOR003W
          Length = 502

 Score =  595 bits (1535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/439 (65%), Positives = 348/439 (79%), Gaps = 7/439 (1%)

Query: 65  LAPLVSSPQPANIIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFFAATK 124
           LAP V +    NIIPHRYIIVFK   + E+I FHKE+I+  H +  +   +  + +  T 
Sbjct: 46  LAP-VHNADAENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEYLQTD 104

Query: 125 GSADEYGIAAKSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSLVFAS 184
            +  E   + + S GGI   FDI+++L+GYI Y +DE++ FIR+N  + FIE D++V  +
Sbjct: 105 INVPE---SMRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTT 161

Query: 185 EFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDFNGRAV 244
           +F+TQN APWGL+RISHRE LNL +FNKYLYDDDAGK V +YVIDTG++VNH +F+ RA 
Sbjct: 162 DFNTQNNAPWGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAH 221

Query: 245 WGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVKGVE 304
           WGKT+P ND+D DGNGHGTH AGTI S+HYGVAK+  ++A+KVLRSNGSG+MSDVVKGVE
Sbjct: 222 WGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVE 281

Query: 305 FAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDAC 364
           FA  SH E   KN+K  KGS ANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQ+AC
Sbjct: 282 FAVSSHLE-RMKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNAC 340

Query: 365 NTSPAAAENAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGS-ETATATLSGTS 423
           N+SPA+AE A+TVGAST+SD+RAYFSNWG+CVDIFAPGLN+LSTYIG+ +  TATLSGTS
Sbjct: 341 NSSPASAEQAVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTS 400

Query: 424 MASPHVAGLLTYFLSLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVLYELPEDTPNYLI 483
           MASPHVAGLL Y+LSLQP+  SE F    I+ +QLKKKLI Y+TKDVL +LPE TPN LI
Sbjct: 401 MASPHVAGLLAYYLSLQPEKSSE-FSTRAISTSQLKKKLIEYATKDVLEDLPEGTPNVLI 459

Query: 484 YNGGGQDLSDFWGKSEEQV 502
           YNGGGQDLSDFW     ++
Sbjct: 460 YNGGGQDLSDFWNLQNSKI 478

>KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {ON}
           Anc_6.14 YOR003W
          Length = 531

 Score =  583 bits (1504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/490 (59%), Positives = 366/490 (74%), Gaps = 32/490 (6%)

Query: 58  EKGEEVKLAPLVS---SPQPANIIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLD 114
           E  +E +LAPL +   +   ++   ++YII+FK+  T E+IS HK+++ +        L+
Sbjct: 71  EAHDEEELAPLYTPGSALSASSSRSNKYIILFKEGVTAEQISAHKQLLQQV------LLE 124

Query: 115 SKDSFFAATKGSADEYGIAAKSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEF 174
           + D              ++A+     + +SFD+  +L+GY+   +  V++ +R + +V+ 
Sbjct: 125 TSD--------------VSAQGIVADVLDSFDLEGVLSGYVAELSPMVLELVRRSPFVQL 170

Query: 175 IEKDSLVFASEFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINV 234
           +E+DS V  +EFDTQN APWGL+RISHR+ L+LGSFNKYLYDD AG+GV SY+IDTGINV
Sbjct: 171 VEQDSEVHTNEFDTQNNAPWGLARISHRDPLSLGSFNKYLYDDAAGEGVDSYIIDTGINV 230

Query: 235 NHKDFNGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSG 294
            HK+F GRA WGKT+P ND D DGNGHGTHCAGTIAS+HYGVAK A V+A+KVLRSNGSG
Sbjct: 231 KHKEFEGRAQWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSG 290

Query: 295 TMSDVVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAV 354
           +MSDV+ GVEFAA+ H   +K N K FKGSTANMSLGGGKSP+LD  V+AAVK G+HF+V
Sbjct: 291 SMSDVIMGVEFAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSV 350

Query: 355 AAGNENQDACNTSPAAAENAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSET 414
           AAGNENQDACNTSPAA+E AITVGASTLSDDRAYFSNWG CVDIFAPGLN+LSTY GS+ 
Sbjct: 351 AAGNENQDACNTSPAASERAITVGASTLSDDRAYFSNWGSCVDIFAPGLNILSTYTGSDD 410

Query: 415 ATATLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVLYEL 474
           ATATLSGTSMASPHVAGLLTYFLSLQP+  S+F  ++ ITP QLKKKL+ YSTK VL++L
Sbjct: 411 ATATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGTSAQITPEQLKKKLLDYSTKGVLFDL 470

Query: 475 PEDTPNYLIYNGGGQDLSDFWGKSEEQVKEEGSIQDFKDFKLSELIESFDTKTDLLFEEV 534
           PEDTPN LIYNGGG DLSDFWG   ++  +     ++ +   S         +D +FE+V
Sbjct: 471 PEDTPNALIYNGGGADLSDFWGDKGKKSHKPLFAHEYDNVWAS---------SDAMFEQV 521

Query: 535 RSVFDKLNII 544
           R++F KLNI 
Sbjct: 522 RAMFGKLNIF 531

>Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa]
           {ON} complement(174972..176405) [1434 nt, 478 aa]
          Length = 477

 Score =  555 bits (1431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/473 (57%), Positives = 345/473 (72%), Gaps = 18/473 (3%)

Query: 61  EEVKLAPLVSSPQPANIIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFF 120
           EEV+ A L++ P  + +IP+ YI+VF +  T  EIS H E +S+   +SV  L     FF
Sbjct: 20  EEVRPASLIT-PN-SEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFF 77

Query: 121 AATKGSADEYGIAAKSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSL 180
             +  S     + +    GG+++ F I N L+GY G FTDEVV+F+R++  V+FIE+DS+
Sbjct: 78  TISTSS----DVNSNGLLGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSM 133

Query: 181 VFASEFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDFN 240
           V  +E  TQ  APWGL+RISHR RLNL +FNKYLYDD  GKGV +YVIDTGIN+ + DF 
Sbjct: 134 VHTTEATTQYNAPWGLARISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFG 193

Query: 241 GRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVV 300
           GRA WGKT+P  + + DGNGHGTH AGTIAS HYGVAK  +V A+KVLRSNG+G+MSDV+
Sbjct: 194 GRAYWGKTIPAGEANVDGNGHGTHVAGTIASIHYGVAKQVKVYAVKVLRSNGAGSMSDVL 253

Query: 301 KGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNEN 360
           KGVE+   +HQ        GFKGS ANMSLGGGKS +LDLAVNAAV AG+HFAVAAGNEN
Sbjct: 254 KGVEYVVGAHQR--DVGTAGFKGSVANMSLGGGKSRSLDLAVNAAVGAGVHFAVAAGNEN 311

Query: 361 QDACNTSPAAAENAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLS 420
           QDACNTSPAAAE AITVGASTLSD RAYFSNWG+CV IFAPGLN+LSTYIGS  ATATLS
Sbjct: 312 QDACNTSPAAAERAITVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLS 371

Query: 421 GTSMASPHVAGLLTYFLSLQPDSDSEFF---QASGITPAQLKKKLIAYSTKDVLYELPED 477
           GTSMASPH+AGL+ YFLSLQP   S+F+   QA+ ITP QLKKK++A+ TK+ L +LP +
Sbjct: 372 GTSMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPAN 431

Query: 478 TPNYLIYNGGGQDLSDFWGKSEEQVKEEGSIQDFKDFKLSELIESFDTKTDLL 530
           TPN + YNG G+ L DFW  ++        +++++   ++E ++    K ++ 
Sbjct: 432 TPNVIAYNGAGKSLEDFWNANDY-------VKNYQSLVITEQLQFILNKMNIF 477

>TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14
           YOR003W
          Length = 585

 Score =  524 bits (1350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/471 (58%), Positives = 343/471 (72%), Gaps = 27/471 (5%)

Query: 81  RYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFFAATKGSADEYGIAAKSSEGG 140
           RYIIVFKK    E++  H +++S     ++ +  S++   AA  G++     A +     
Sbjct: 135 RYIIVFKKGVFKEQVDQHLKMMS-----ALFRRLSEEQRPAAAPGAS-----ALRDGFDR 184

Query: 141 IQESFDIANMLNGYIGYF-TDEVVDFIRMNQWVEFIEKDSLVFASEFDTQNGAPWGLSRI 199
           + ++F++A   +GYI    + ++VDFIR+N  V+++EKDS+V + + +TQN APWGL+RI
Sbjct: 185 VMDTFEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNNAPWGLARI 243

Query: 200 SHRERLNLGSFNKYLY-DDDAGKGVTSYVIDTGINVNHKDFNGRAVWGKTVPQNDEDADG 258
           SHRE LNLG+FNKYLY  + AGKGVT+YV+DTGI+V+H +F  RA WGKT+P ND D DG
Sbjct: 244 SHREGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDG 303

Query: 259 NGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSH----QEAS 314
           NGHGTHCAGTI SEHYGVAK A +VA+KVLRS+GSGTMSDV+KGVE+ A  H    +E+ 
Sbjct: 304 NGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESR 363

Query: 315 KKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAENA 374
           K     +KG+TANMSLGGGKSPALD AVNAAVKAG+HFAVAAGNENQDACN+SPAAAENA
Sbjct: 364 KDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENA 423

Query: 375 ITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLT 434
           ITVGASTLSDDRAYFSN+GKCVDIFAPGLN+LSTYIG+  ATATLSGTSMASPHVAGLLT
Sbjct: 424 ITVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLLT 483

Query: 435 YFLSLQPDSDSEFFQA-SGITPAQLKKKLIAYSTKDVLYELPEDTPNYLIYNGGGQDLSD 493
           Y LSLQPD  SEF+   S +TP Q+KKK+I Y+TK+ L +LP DTPN LIYNGG    +D
Sbjct: 484 YLLSLQPDKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNGGFNS-TD 542

Query: 494 FWGKSEEQVKEEGSIQDFKDFKLSELIESFDTKTDLLFEEVRSVFDKLNII 544
           FW  +      +        + L   ++S     +  F      FD +NI 
Sbjct: 543 FWASAAAPQSHKVKTN---RYSLGSFLDSIQDSNNHWFN-----FDNMNIF 585

>Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003W
           (REAL)
          Length = 476

 Score =  516 bits (1328), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 243/421 (57%), Positives = 317/421 (75%), Gaps = 8/421 (1%)

Query: 75  ANIIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFFAATKGSADEYGIAA 134
           A  +P+RYII F +D++   I  HK +I E   ESV+KL   D+FF +T   +D      
Sbjct: 64  AESLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSD------ 117

Query: 135 KSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSLVFASEFDTQNGAPW 194
               GGI   FDI  +  GY GYFT+EV+  +  +  ++FIE++S V  +    Q  APW
Sbjct: 118 -LQFGGIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPW 176

Query: 195 GLSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDFNGRAVWGKTVPQNDE 254
           GL RISHRE+   G   +YLY+D AG+GVTSYV+DTGI++NH+DF GRAVWG  +P NDE
Sbjct: 177 GLHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDE 236

Query: 255 DADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEAS 314
            +D NGHGTHCAG I S H+GV KN  +VA+KVLRSNG GT+SDV+KG+E+  + H ++S
Sbjct: 237 ASDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDSS 296

Query: 315 KKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAENA 374
           KK    FKGSTAN+SLG  KSPA+++AVNAAV++G+HFA+AAGNE++DAC +SPA AE +
Sbjct: 297 KKGGPKFKGSTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKS 356

Query: 375 ITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLT 434
           ITVGAST SDDRA+FS+WG CVD+FAPG+N+LSTYIGS  A+ +LSGTSMA+PHVAG+L+
Sbjct: 357 ITVGASTFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILS 416

Query: 435 YFLSLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVLYELPEDTPNYLIYNGGGQDLSDF 494
           YFLSLQP SDSEFF ++ ++P QLK+K+I +ST+ VL ++ EDTPN LIYNGGG+ L +F
Sbjct: 417 YFLSLQPSSDSEFFDST-VSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNF 475

Query: 495 W 495
           W
Sbjct: 476 W 476

>Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003W
           (REAL)
          Length = 478

 Score =  514 bits (1325), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 240/419 (57%), Positives = 317/419 (75%), Gaps = 6/419 (1%)

Query: 77  IIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFFAATKGSADEYGIAAKS 136
           +IP+RYI+VF +D + + I  H++++ EAH+ SV+KL   D F      S     IA   
Sbjct: 66  LIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSS-----IAPDL 120

Query: 137 SEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSLVFASEFDTQNGAPWGL 196
             GGI  SFDI  +  GY GYFTDE+++ +  +  ++FIE++S V  S    Q  APWGL
Sbjct: 121 QLGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGL 180

Query: 197 SRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDFNGRAVWGKTVPQNDEDA 256
            RISHRE+   G   +YLY+D AG+GVTSYV+DTGI+  H+DF GRAVWG  +P NDE +
Sbjct: 181 HRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEAS 240

Query: 257 DGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEASKK 316
           D NGHGTHCAG I S+HYGVAKN ++VA+KVLRSNG GT+SDV+KG+E+ A+ H E+S+K
Sbjct: 241 DLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRK 300

Query: 317 NKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAENAIT 376
             K FKGSTAN+SLG  KS A+++AV+AAV +G+HFA+AAGNEN+DAC +SPA A+ +IT
Sbjct: 301 KSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSIT 360

Query: 377 VGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYF 436
           VGAST SDDRA+FSNWG CVD+FAPG+N++STYIGS  AT +LSGTSMA+PHVAG+L+YF
Sbjct: 361 VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYF 420

Query: 437 LSLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVLYELPEDTPNYLIYNGGGQDLSDFW 495
           LSLQP  DSE+F  + ++P +LK+K++ +ST  VL ++ ++TPN LIYNGGG+ L D W
Sbjct: 421 LSLQPAPDSEYFD-NALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478

>Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003W
           (REAL)
          Length = 482

 Score =  509 bits (1312), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 241/418 (57%), Positives = 309/418 (73%), Gaps = 6/418 (1%)

Query: 78  IPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFFAATKGSADEYGIAAKSS 137
           +P+RYIIVF +D T   I  H ++I +A   SV+K+   DSF      SA     +    
Sbjct: 69  LPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASA-----SPNPQ 123

Query: 138 EGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSLVFASEFDTQNGAPWGLS 197
            GGI  SFDI  +  GY GYFTDEV++ +  +  V+FIE +S V  S    Q  APWGL 
Sbjct: 124 FGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLH 183

Query: 198 RISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDFNGRAVWGKTVPQNDEDAD 257
           RISHRER   G   +YLY+D AG GVTSYV+DTGI+  H+DF GRA WG  +P+NDE +D
Sbjct: 184 RISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASD 243

Query: 258 GNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEASKKN 317
            NGHGTHCAG I S H+GVAKN  ++A+KVLRSNG GT+SDV+KG+E+ A++H  +SKK 
Sbjct: 244 LNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIASSKKR 303

Query: 318 KKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAENAITV 377
              FKGSTAN+SLG  KSPA+++AVNAAV  G+HFA+AAGNE++DAC +SPA AE +ITV
Sbjct: 304 GSKFKGSTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITV 363

Query: 378 GASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFL 437
           GAST SDDRA+FSNWG CVD+FAPG+N++STYIGS  AT +LSGTSMA+PHVAG+L+Y L
Sbjct: 364 GASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLL 423

Query: 438 SLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVLYELPEDTPNYLIYNGGGQDLSDFW 495
           SLQP  DSEFF  + ++P QLK+K++ +ST+ VL ++ E+TPN L+YNGGG+ L +FW
Sbjct: 424 SLQPAQDSEFFYDT-VSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480

>YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putative
           precursor to the subtilisin-like protease III
          Length = 478

 Score =  498 bits (1281), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 237/418 (56%), Positives = 314/418 (75%), Gaps = 6/418 (1%)

Query: 78  IPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFFAATKGSADEYGIAAKSS 137
           +P+RY+IVF +D + ++I  H +++ + H+ SV KL   D+F+     S      ++KS 
Sbjct: 67  LPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVISSSV-----SSKSQ 121

Query: 138 EGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSLVFASEFDTQNGAPWGLS 197
            GGI   FDI  +  GY GYFTDE++  I  +  ++F+E+++ V  S    Q  APWGL 
Sbjct: 122 FGGIDNFFDINGLFRGYTGYFTDEIIKIISQDPIIKFVEQETTVKISNSSLQEEAPWGLH 181

Query: 198 RISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDFNGRAVWGKTVPQNDEDAD 257
           R+SHRE+   G   +YLY+D AGKGVTSYV+DTGI+  H+DF GRA WG  +P NDE +D
Sbjct: 182 RVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEASD 241

Query: 258 GNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEASKKN 317
            NGHGTHCAG I S+H+GVAKN ++VA+KVLRSNG GT+SDV+KG+E+  + H E+SKK 
Sbjct: 242 LNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKKK 301

Query: 318 KKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAENAITV 377
            K FKGSTAN+SLG  KS A+++AVNAAV +G+HFA+AAGNE++DAC +SPA AE +ITV
Sbjct: 302 NKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSITV 361

Query: 378 GASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFL 437
           GAST SDDRA+FSNWG CVD+FAPG+N++STYIGS  AT +LSGTSMASPHVAG+L+YFL
Sbjct: 362 GASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILSYFL 421

Query: 438 SLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVLYELPEDTPNYLIYNGGGQDLSDFW 495
           SLQP  DSEFF  +  +P +LK+K++ +ST+ VL ++ +DTPN LIYNGGG+ L  FW
Sbjct: 422 SLQPAPDSEFFNDAP-SPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGFW 478

>CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} similar
           to uniprot|P25036 Saccharomyces cerevisiae YOR003w YSP3
           or uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
          Length = 485

 Score =  451 bits (1159), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 231/422 (54%), Positives = 299/422 (70%), Gaps = 12/422 (2%)

Query: 77  IIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFFAATKGSADEYGIAAKS 136
           IIP+RYI++FK   T +EI  H   I E ++ S+   DS         G A +Y     S
Sbjct: 73  IIPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSIFLQDSD-------FGKATQYN--DIS 123

Query: 137 SEG-GIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSLVFASEFDTQNGAPWG 195
           + G G+Q  F I   + GYIGYFT+    FI  +  VE +E DS+V  + +  Q   PWG
Sbjct: 124 TRGIGLQHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWG 183

Query: 196 LSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDFNGRAVWGKTVPQNDED 255
           L RIS RE+L +     Y YDD  GK   ++VIDTGI V+H+DF GRA WGKT+ +ND D
Sbjct: 184 LGRISQREKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDND 243

Query: 256 ADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEASK 315
            D NGHGTHCAGTIAS+HYG+AK AEV+A+KVLRS+GSG+MSDV++GVE+  +++ +  K
Sbjct: 244 YDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYNDL-K 302

Query: 316 KNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAENAI 375
           K K   KG+  NMSLG  KS AL+ A++AA  AGI FAVAAGNE+ DACN+SPA+A + I
Sbjct: 303 KTKSNLKGAAGNMSLGAWKSYALNRAMDAAAAAGISFAVAAGNESDDACNSSPASAWSPI 362

Query: 376 TVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTY 435
           TVG STLSDD A+FSN+G+CVDIFAPG+N++STYIGS+ AT +LSGTSM+SPHVAG+L Y
Sbjct: 363 TVGGSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAY 422

Query: 436 FLSLQPDSDSEFF-QASGITPAQLKKKLIAYSTKDVLYELPEDTPNYLIYNGGGQDLSDF 494
           +LSLQPD  S+F+ + S I+P  LKKK++ Y+T   L  LP +T N L+YNGGG++LS F
Sbjct: 423 YLSLQPDHKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKF 482

Query: 495 WG 496
           WG
Sbjct: 483 WG 484

>KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6.14
           YOR003W
          Length = 456

 Score =  429 bits (1102), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 221/425 (52%), Positives = 279/425 (65%), Gaps = 24/425 (5%)

Query: 71  SPQPANIIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFFAATKGSADEY 130
           S +  +II  +YI++FK  A   E   H + +         + D KD             
Sbjct: 53  SAKQNDIIKDQYIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDEKDDH----------- 101

Query: 131 GIAAKSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSLVFASEFDTQN 190
               KS+       F I   L+GYI     E +  +R +  V+ IE DS V A +   Q 
Sbjct: 102 ----KSN----LNIFKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQE 153

Query: 191 GAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDFNGRAVWGKTVP 250
             PWGLSRIS R R+ +G    Y YDD     VT+YV+DTGI ++H+ FNGRA WGKT+ 
Sbjct: 154 DTPWGLSRISQRPRVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIV 213

Query: 251 QNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSH 310
            ND D D +GHGTH AG IAS+ +GVAK  EVVA+KVLRSNG G MSDV+KG+EF    H
Sbjct: 214 PNDVDEDNSGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDH 273

Query: 311 QEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAA 370
                KNK   KGS  N+SLG  KSPAL LA++AA+   IHFAVAAGNEN DAC TSPA 
Sbjct: 274 S----KNKNYSKGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPAD 329

Query: 371 AENAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVA 430
           A  AITVGAS  SD+RA+FSNWG+CVD+FAPG+NV+STYIGS+ AT +LSGTS A+P+ A
Sbjct: 330 ARRAITVGASIFSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNATLSLSGTSAAAPYTA 389

Query: 431 GLLTYFLSLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVLYELPEDTPNYLIYNGGGQD 490
           GL+ Y+LSLQPD DS +F    +TP++LK+K++A+ +KDVLYELPE+TPN +IYNG G++
Sbjct: 390 GLIAYYLSLQPDKDSGYFTGE-MTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRN 448

Query: 491 LSDFW 495
           LS FW
Sbjct: 449 LSHFW 453

>NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14
          Length = 451

 Score =  398 bits (1023), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 208/439 (47%), Positives = 277/439 (63%), Gaps = 38/439 (8%)

Query: 69  VSSPQPANII-------PHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFFA 121
           + S  P+NII       P++YI++FK D T        +I  E H      L + +S+  
Sbjct: 37  IDSDSPSNIIHHAASPIPNQYIVLFKSDTT--------DIQRETH------LATLNSWLL 82

Query: 122 ATKGSADEYGIAAKSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSLV 181
            T              +  I  SF +A+ L GY     ++++  +  +  ++ IE+DS V
Sbjct: 83  NTD------------PQYTILHSFQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYV 130

Query: 182 FASEFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDD-AGKGVTSYVIDTGINVNHKDFN 240
            A     Q  +PWGL+RIS RERL L     Y YDD  A      Y++DTGIN NH +F 
Sbjct: 131 HALGRQKQIDSPWGLARISQRERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQ 190

Query: 241 GRAVWGKT-VPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDV 299
           GRA WG    P      D NGHGTHCAG I S  YGVAKN  ++A+KVL + G G MS V
Sbjct: 191 GRAKWGAVFTPMEPNQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAV 250

Query: 300 VKGVEFAAQSH-QEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGN 358
           ++G+E+  Q H Q+  K+++ GFKGS  N+SLG GKSPAL   + AAVK G+HFAVAAGN
Sbjct: 251 IRGIEYVTQQHEQDMKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGN 310

Query: 359 ENQDACNTSPAAAENAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSE-TATA 417
           E+ DAC+TSPA + +A+TVGAS+ SDDR +FSNWG CVD+FAPG+N++STYIG     T 
Sbjct: 311 EDDDACSTSPADSPHALTVGASSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETT 370

Query: 418 TLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQA-SGITPAQLKKKLIAYSTKDVLYELPE 476
           +LSGTSM++P V GL+ YFLSLQPD+ S+F+   +  TP QLK K+I++ST+ VL+E+PE
Sbjct: 371 SLSGTSMSAPFVTGLIAYFLSLQPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLHEIPE 430

Query: 477 DTPNYLIYNGGGQDLSDFW 495
            TPN ++YNGGG  L DFW
Sbjct: 431 GTPNRIVYNGGGHSLKDFW 449

>NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {ON} 
          Length = 482

 Score =  366 bits (940), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 213/468 (45%), Positives = 287/468 (61%), Gaps = 31/468 (6%)

Query: 46  ASFAKEITRAAAEKGEEVKLAPLVSSPQPANIIPHRYIIVFKKDATPEEISFHKEIISEA 105
           AS AK   R   +K +   + P    PQ  N IP +YI++F+ D T  +IS  ++ +S  
Sbjct: 33  ASHAKLNERDTLDKNQIPFIIP-THGPQ-KNFIPDQYIVLFENDTTDLQISRFEQFLSSL 90

Query: 106 HAESVAKLDSKDSF---FAATKGSADEYGIAAKSSEGGIQESFDIANMLNGYIGYFTDEV 162
             E   K +  D++    +  + S D  G+  ++      E  D+ N +  Y        
Sbjct: 91  IEEDNQKYNVNDNYSKVLSRFQISNDTKGMIIRAPIDDFLE--DVKNNIFNY-------- 140

Query: 163 VDFIRMNQWVEFIEKDSLVFASEFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDD-AGK 221
                  + ++ IE+DS V  ++F TQ  + WGLSRIS R  L L     Y YDD+ +GK
Sbjct: 141 ------QKIIKIIERDSYVHMNKFTTQIDSSWGLSRISQRNHLKLLQDQFYFYDDNGSGK 194

Query: 222 GVTSYVIDTGINVNHKDFNGRAVWGKTVPQNDEDA-DGNGHGTHCAGTIASEHYGVAKNA 280
           GV  Y++DTGIN NH +F GRA WG ++P  +    D NGHGTHCAG I S+ YGVAK  
Sbjct: 195 GVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKET 254

Query: 281 EVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEASKKNKKG------FKGSTANMSLGGGK 334
            ++A+KVL   G G+MSDV+ G+EF A SH   +            FKGS  N+SLG  K
Sbjct: 255 NLIAVKVLDFKGDGSMSDVILGLEFVANSHTNKTNNISSSSSVHSEFKGSVVNLSLGAPK 314

Query: 335 SPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAENAITVGASTLSDDRAYFSNWGK 394
           SP+LD+A+ +A K GIH  VAAGNE++DAC TSPA +   ITVGAS+ SDDRA+FSNWG 
Sbjct: 315 SPSLDIALESAKKIGIHITVAAGNEDEDACMTSPADSPAVITVGASSFSDDRAFFSNWGP 374

Query: 395 CVDIFAPGLNVLSTYIG-SETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQASGI 453
           CVD+FAPG+N+ STYIG +   T +LSG+SM+SP V+GL  Y+LSLQPD  S+ F  S +
Sbjct: 375 CVDVFAPGINIKSTYIGPNNNETLSLSGSSMSSPFVSGLTAYYLSLQPDVSSQ-FHDSLM 433

Query: 454 TPAQLKKKLIAYSTKDVLYELPEDTPNYLIYNGGGQDLSDFWGKSEEQ 501
           TP QLK+K+I +ST  +L ELP DT N L+YNGGG+DLS FW  + ++
Sbjct: 434 TPDQLKRKIIDFSTNGMLKELPLDTANKLVYNGGGKDLSGFWNATRKE 481

>KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON} 
          Length = 420

 Score =  353 bits (907), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 174/350 (49%), Positives = 238/350 (68%), Gaps = 7/350 (2%)

Query: 143 ESFDIANMLNGY-IGYFTDEVVDFIRMNQWVEFIEKDSLVFASEFDTQNGAPWGLSRISH 201
           E F IA+ L G+ +  F    V F+    +VE +E +S V+A     Q   PWGL R+S 
Sbjct: 75  EQFHIADELIGFTVKNFPFHNVYFLLQIPFVEMVETNSKVYALNVTVQEDVPWGLMRLSQ 134

Query: 202 RERLNLGSFNKYLYDDD-AGKGVTSYVIDTGINVNHKDFNGRAVWGKTVPQNDEDADGNG 260
           R+R+ +G    Y YD   + K V  Y++DTGI V+H++F GRA WGKT+  ND D D NG
Sbjct: 135 RDRVRIGDEQVYRYDTRGSAKDVNVYILDTGIQVDHEEFEGRARWGKTIAWNDPDRDDNG 194

Query: 261 HGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEASKKNKKG 320
           HGTHCAG +    YGVAK A ++A+KVL + G G MSDV++G+EFA   H     +N+  
Sbjct: 195 HGTHCAGIVGGATYGVAKEANLIAVKVLHATGDGEMSDVIRGIEFAVNEHL---TRNQDE 251

Query: 321 FKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAENAITVGAS 380
            +GS  N+SLG G+SPAL   V AA+  G+HFAVAAGNE+ +AC +SPA  +  +TVG S
Sbjct: 252 VRGSIINLSLGAGESPALQRVVTAALNKGVHFAVAAGNEDDNACYSSPANIDGVVTVGGS 311

Query: 381 TLSDDRAYFSNWGKCVDIFAPGLNVLSTYIG-SETATATLSGTSMASPHVAGLLTYFLSL 439
           T SDDRA+FSNWG C+D+FAPG+NV S+Y+G ++  T +LSGTS ++PHVAGL+ Y LSL
Sbjct: 312 TFSDDRAFFSNWGPCIDVFAPGVNVKSSYVGAAKNKTLSLSGTSTSAPHVAGLMAYLLSL 371

Query: 440 QPDSDSEFFQASGITPAQLKKKLIAYSTKDVLYELPEDTPNYLIYNGGGQ 489
           +PD+ S+F  A    PAQLK+KL++ +T+  L+E+P+DT N +I+NG  Q
Sbjct: 372 EPDTKSQFHTAWS-NPAQLKQKLVSLATEGKLFEVPDDTANLMIFNGVKQ 420

>CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} some
           similarities with uniprot|P09232 Saccharomyces
           cerevisiae YEL060c or uniprot|P25036 Saccharomyces
           cerevisiae YOR003w YSP3
          Length = 579

 Score =  310 bits (795), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 175/477 (36%), Positives = 270/477 (56%), Gaps = 17/477 (3%)

Query: 31  DVSVKEINSDSQEVLASFAKEITRAAAEKGEEVKLAPLVSSPQ-PANIIPHRYIIVFKKD 89
           D++  E  S+SQE   +F K+  R    K   V  APL  + +   NI+P+RYI++FK  
Sbjct: 24  DINTLEQTSESQE-YDNFFKQSKRPGNVKAPLV--APLGENDEIQNNIVPYRYIVMFKNF 80

Query: 90  ATPEEISFHKEIISEAHAESVAKLDSKDSFFAATKGSADEYGIAAKSSEGGIQESFDIAN 149
           A   EI  H + +++        L   D FF  T+    E+   +    GG+  +FDI +
Sbjct: 81  AYTNEIKLHIQTVAKLQLRGSISLAPNDPFFHHTRDK--EF---STEELGGVLYTFDIGS 135

Query: 150 MLNGYIGYFTDEVVDFIRMNQWVEFIEKDSLVFASEFDTQNGAPWGLSRISHRERLNLGS 209
             NGY+GYFTDEVV+FIR    V+++E DS++   + +T + + W L+RISHR +L L +
Sbjct: 136 GFNGYVGYFTDEVVEFIRKQSIVDYVEMDSILTIDDKETDSNSHWHLARISHRPKLGLSN 195

Query: 210 FNKYLYDDDAGKGVTSYVIDTGINVNHKDFNGRAVWGKTVPQNDEDADGNGHGTHCAGTI 269
           FN+Y +D + G+ + +Y++DTG+   H  +  R + G  +  N+++ D NGHGT  AG +
Sbjct: 196 FNEYKFDPNGGQNIDAYILDTGVYQTHAYYIERTIRGIVITPNEDERDMNGHGTEMAGLV 255

Query: 270 ASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEASKKNKKGFKGSTANMS 329
                GVA+ A ++ +KVL   G GT+S+++KG+ F    H +  +KN  G  G+    S
Sbjct: 256 GGREVGVARKATLIDVKVLNWQGRGTVSNIIKGLSFVNHHHPQRIEKN--GVLGAVVLFS 313

Query: 330 LGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAENAITVGASTLSDDRAYF 389
           + G KS +L+ A +  V +GIH  V AG +  +ACN+SPA++   ITV   +++D+    
Sbjct: 314 ISGAKSRSLNTAFDKMVSSGIHVVVGAGTKGINACNSSPASSSKPITVAGMSITDEPIDR 373

Query: 390 SNWGKCVDIFAPGLNVLSTYIGSE----TATATLSGTSMASPHVAGLLTYFLSLQPDSDS 445
            NWG CVDI+ PG  V +TY   E    T   +++G+S A+  VAGLL YF SLQP   +
Sbjct: 374 GNWGSCVDIYGPGDRVRTTYPNLERNQFTNEISVTGSSAAAAQVAGLLAYFASLQPGLGT 433

Query: 446 EFFQASGITPAQLKKKLIAYSTKDVLYELPEDTPNYLIYNGGGQDLSDFWGKSEEQV 502
                  +TP +LK++LI + TK  L  L   +PN + +NG G +L  F+    E V
Sbjct: 434 P--DVIPLTPEELKERLIDFGTKGKLTNLERMSPNIIAFNGAGGNLDSFFNDGSEIV 488

>NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {ON}
           Anc_6.313
          Length = 492

 Score =  210 bits (535), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 158/438 (36%), Positives = 225/438 (51%), Gaps = 75/438 (17%)

Query: 95  ISFHKE-IISEAHAESVAKLDSKDSFF--AATKG-SADEYGIAAKSSEGGIQESFDIANM 150
           I+F +E I    +  S+ + DS  SF     T+G S  EY          I ++F I + 
Sbjct: 14  ITFLQEPIYGREYLVSLKQNDSIQSFMDSTITRGRSVKEY------LRDKIGKTFSIGS- 66

Query: 151 LNGYIGYFTDEVVDFIRMNQWVEFIEKDSLVFASE-------------FD---------- 187
             G+    TD++++ I+ N  V  +  +  V A E             FD          
Sbjct: 67  FKGFTVDLTDDLLEAIKKNPLVSDVVPNLRVHAFEDVKDEEGDDDGGQFDNKMQKGKCSV 126

Query: 188 -TQNGAPWGLSRISHRERLN---------LGSFNKYLYDDDA-GKGVTSYVIDTGINVNH 236
             Q GAP  L+R+S R++L          L S  KY YD  + G  V +Y+ID+GI + H
Sbjct: 127 KVQYGAPRHLARLSRRKQLPYDFEDKEAYLDSL-KYFYDKRSQGASVNAYIIDSGIYLEH 185

Query: 237 KDFNGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTM 296
           ++FNGRA+ G  +   +   D NGHGTH AG + S+ YGVAK  +++ IKVL   G G++
Sbjct: 186 EEFNGRAIPGIDL-TGEGSGDYNGHGTHVAGIVGSKSYGVAKKVKLIEIKVLNRLGQGSL 244

Query: 297 SDVVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAA 356
           + V+ G+EFA +  QE SKK +       AN+SLG  ++  L+ A+ AA+ AG+   VAA
Sbjct: 245 AMVLGGIEFAVKHCQETSKKGR-----CVANLSLGSMRTAILNKAIKAAIDAGLVVVVAA 299

Query: 357 GNENQDACNTSPAAAENAITVGASTLSDDR----AYFSNWGKCVDIFAPGLNVLSTYIGS 412
           GN N +AC  SPA+A  AITVGA    DDR    A FSNWG+C+DIFAPG+ + S  I  
Sbjct: 300 GNNNLNACWYSPASAPEAITVGA---FDDRIDAIAKFSNWGQCLDIFAPGVVIKSLSIFK 356

Query: 413 ETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVLY 472
           +    T SGTSMASP VAGL    L              G++  ++K  ++   T +V +
Sbjct: 357 DKEDVTYSGTSMASPTVAGLAALTLD------------QGVSAEEVKDYILEMGTDNVFH 404

Query: 473 E----LPEDTPNYLIYNG 486
                    TPN + +NG
Sbjct: 405 RRSLLFKPGTPNKICFNG 422

>Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON}
           (138312..139868) [1557 nt, 519 aa]
          Length = 518

 Score =  210 bits (535), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 136/319 (42%), Positives = 175/319 (54%), Gaps = 38/319 (11%)

Query: 187 DTQNGAPWGLSRISHRERL--------NLGSFNKYLYDDD-AGKGVTSYVIDTGINVNHK 237
           + Q GAP  L RIS R +L            F  Y Y+D   G  + +Y++DTGI   H 
Sbjct: 152 NVQYGAPRHLGRISSRGQLPFDIRNENEFKEFIHYYYEDQFKGSNIAAYILDTGIYAEHP 211

Query: 238 DFNGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMS 297
           DF  R + G  +   +   D NGHGTH AG + S+ +GVAKN  +V +KVL   GSG ++
Sbjct: 212 DFENRVIVGADM-TGEGPGDSNGHGTHVAGILGSKTFGVAKNVTLVEVKVLTGRGSGNLT 270

Query: 298 DVVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAG 357
            V+ G++FA   H    ++ +   K   ANMSLG  ++  ++ A++ A KAG+   VAAG
Sbjct: 271 TVLSGIQFAVD-HCRLMRETQG--KQCVANMSLGTVRNNIINAAIHEAFKAGLIMVVAAG 327

Query: 358 NENQDACNTSPAAAENAITVGASTLSDDR----AYFSNWGKCVDIFAPGLNV--LSTYIG 411
           N N  AC TSPA+A+NAITVGA    DDR    AYFSNWG CVDIFAPG+ +  LS    
Sbjct: 328 NSNVSACWTSPASAKNAITVGA---FDDRTETIAYFSNWGACVDIFAPGVKIRSLSNSPE 384

Query: 412 SETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVL 471
           S     T SGTSMASP VAGL    L              G+ P  +K KL+  STKDV 
Sbjct: 385 SHHKHVTHSGTSMASPVVAGLAAILLD------------KGVEPFDVKDKLLHLSTKDVF 432

Query: 472 YELP----EDTPNYLIYNG 486
            +L       TPN + YNG
Sbjct: 433 NKLTLFFKYGTPNKIAYNG 451

>TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa]
           {ON} Anc_6.313 YCR045C
          Length = 436

 Score =  207 bits (526), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 139/362 (38%), Positives = 187/362 (51%), Gaps = 37/362 (10%)

Query: 170 QWVEFIEKD--SLVFASEF-DTQNGAPWGLSRISHRERLNL----------GSFNKYLYD 216
           Q+V + E D     F S F   Q GAP  LSR+S R +L            GSFN Y  +
Sbjct: 92  QFVAYDEHDFEGWNFNSRFIRRQRGAPRHLSRLSRRSQLPYDFEEEDDNYEGSFNYYYDN 151

Query: 217 DDAGKGVTSYVIDTGINVNHKDFNGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGV 276
              G G+ +Y+IDTGI   H +F GRAV+G+ +   +   DGNGHGTH AG + S  YGV
Sbjct: 152 KHRGDGINAYIIDTGIYKEHAEFGGRAVFGEDL-TGEGPGDGNGHGTHVAGIVGSSKYGV 210

Query: 277 AKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSP 336
           AK+  +V +K L + G G ++ V+  +EFA  +H  +S+      KG   N+SLG  ++ 
Sbjct: 211 AKDITLVEVKALTAKGQGNLTTVISAMEFAV-NHCRSSEG-----KGCVINLSLGAIRNS 264

Query: 337 ALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAENAITVGA-STLSDDRAYFSNWGKC 395
            ++ AV AA +AGI   VAAGN N +AC  SPA+A  AITVGA    +D  A FSNWG C
Sbjct: 265 VINQAVKAAHEAGIVVVVAAGNSNINACLNSPASAPEAITVGAFDDRTDSIAKFSNWGSC 324

Query: 396 VDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQASGITP 455
           VDIFAPG+ V S            SGTSMASP + GL    L              G+  
Sbjct: 325 VDIFAPGVRVKSLASAPHLKPILFSGTSMASPSITGLAAILLD------------EGVPY 372

Query: 456 AQLKKKLIAYSTKDVLYE----LPEDTPNYLIYNGGGQDLSDFWGKSEEQVKEEGSIQDF 511
            ++K  ++  +T DV           TPN + +NG  ++   F       V  +  I+D 
Sbjct: 373 DKIKDYILKMATNDVFQRRTLVFKPGTPNRVAFNGVKKNDDKFSNAVYPVVDLDLLIEDL 432

Query: 512 KD 513
           KD
Sbjct: 433 KD 434

>ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 490

 Score =  207 bits (526), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 132/358 (36%), Positives = 189/358 (52%), Gaps = 34/358 (9%)

Query: 188 TQNGAPWGLSRISHRERLNLG---------SFNKYLYDDDAGKGVTSYVIDTGINVNHKD 238
            Q  AP  L+R+S R  L            SFN Y Y    G+ + +Y+IDTGI   HKD
Sbjct: 125 VQGEAPRHLARLSRRAPLPYEFDDELRYEESFNYYYYKWHKGRNINAYIIDTGIYKEHKD 184

Query: 239 FNGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSD 298
           F GRA++G+     +   D NGHGTH AG + S ++GVAK   ++ +K L + G G ++ 
Sbjct: 185 FCGRAIFGRDF-TGEGPGDRNGHGTHVAGIVGSSNFGVAKKVNLIEVKALNNRGQGNLTT 243

Query: 299 VVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGN 358
           V+  VEFA  +H ++S K     KG  AN+SLG  ++  ++ A+ AA +AG+   VAAGN
Sbjct: 244 VISAVEFAV-NHCKSSGK-----KGCVANLSLGAVRNSVINQAIKAAHEAGLIIVVAAGN 297

Query: 359 ENQDACNTSPAAAENAITVGA-STLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATA 417
            N +AC  SPA+A  AITVGA    +D  A FSNWG CVDIFA G+ V S          
Sbjct: 298 SNINACWNSPASAPEAITVGAFDDRTDTIAKFSNWGPCVDIFASGVKVKSLSAFPPHKPI 357

Query: 418 TLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVLYE---- 473
             SGTSMASP V GL+   L              G+ P  +K KL+  +T D+L      
Sbjct: 358 AFSGTSMASPSVTGLVAILLD------------KGVEPENIKAKLVELATHDLLQRRTLF 405

Query: 474 LPEDTPNYLIYNGGGQDLSDFWGKSEEQVKEEGSIQDFKDFKLSEL-IESFDTKTDLL 530
               TPN + +NG  ++  ++       V  E  +Q+ ++++   L + + D K D++
Sbjct: 406 FKPGTPNRIAFNGMEREDDEYDDAVYPIVDLESLVQELQNYQPPPLEVNNKDGKFDII 463

>Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON}
           (14365..15762) [1398 nt, 466 aa]
          Length = 465

 Score =  204 bits (518), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 130/357 (36%), Positives = 191/357 (53%), Gaps = 39/357 (10%)

Query: 180 LVFASEFDTQNGAPWGLSRISHRERL-----NLGSF-NKYLYDDDA---GKGVTSYVIDT 230
           L ++ +   Q  AP  LSR+S R +L     N+  + N + Y  DA   G  V +Y+IDT
Sbjct: 106 LTYSDKIIIQREAPRHLSRLSRRGQLPYDINNIDRYDNAFDYYFDAKYQGSSVNAYIIDT 165

Query: 231 GINVNHKDFNGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRS 290
           GI   H +F GR  +   + Q +   D NGHGTH AG + S+ +GVAK   ++ +K L  
Sbjct: 166 GIYKEHPEFEGRVKFAIDLTQ-EGPGDENGHGTHIAGIVGSKTFGVAKKVNIIDVKALDK 224

Query: 291 NGSGTMSDVVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGI 350
            G G +S ++K +EF  +  +E+  K         AN+S G  ++  +D A+  A  AGI
Sbjct: 225 KGQGQLSTILKALEFTIRHCKESVDKK------CVANLSFGAIRTAIIDEAIKEAHNAGI 278

Query: 351 HFAVAAGNENQDACNTSPAAAENAITVGASTLSDDR----AYFSNWGKCVDIFAPGLNVL 406
              VAAGN N DAC  SPA++++ ITVGA    DDR    A FSNWG CVD+FAPG+ V 
Sbjct: 279 VLVVAAGNSNIDACWNSPASSKDVITVGA---FDDRTETIARFSNWGSCVDVFAPGVKVK 335

Query: 407 STYIGSETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQASGITPAQLKKKLIAYS 466
           S    + +    LSGTSMASP V+G+    L              G+ P  +K K+I  S
Sbjct: 336 SLSHINGSDVLLLSGTSMASPSVSGIAAILLD------------KGLNPKFVKSKIIESS 383

Query: 467 TKDVLYE----LPEDTPNYLIYNGGGQDLSDFWGKSEEQVKEEGSIQDFKDFKLSEL 519
           TK++ ++    +  +TPN +++NG  +    F G    ++  EG I + K +++S L
Sbjct: 384 TKNIFHQGTIMIKPNTPNLIVFNGIEKMDDSFEGARFPRIDFEGLINELKSYRVSVL 440

>KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {ON}
           Anc_6.313 YCR045C
          Length = 475

 Score =  197 bits (501), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 140/375 (37%), Positives = 193/375 (51%), Gaps = 48/375 (12%)

Query: 139 GGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSLVFASEFDT---------- 188
           G I + F I   L G     + +V+D I+ + +V+ +  + +V A E D           
Sbjct: 50  GKINKRFQIGE-LKGLTMNLSHDVLDKIKRHPFVKEVVPNIMVKAFEGDAVEDESWLPKM 108

Query: 189 --QNGAPWGLSRISHRERLNLGSFNK--------YLYDDDA-GKGVTSYVIDTGINVNHK 237
             Q GAP  L+RIS R +L     NK        Y YD  A G    +Y++DTG+  +HK
Sbjct: 109 KRQRGAPRHLARISRRMQLPYDMNNKTRYRDSFNYYYDRWAQGATTRAYILDTGVMRDHK 168

Query: 238 DFNGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMS 297
           +F  R  +G T    + + D NGHGTH AG + S+ +GVAK+ ++V +K L + G+GT+ 
Sbjct: 169 EFEDRVEFG-TDCTGEGEGDLNGHGTHVAGLVGSKTFGVAKHVQLVDVKCLDALGAGTLV 227

Query: 298 DVVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAG 357
            ++  +EFA Q  QE              NMSLG  KS  L+ A+N   K GI   VAAG
Sbjct: 228 SILSALEFAVQDCQEHEDSQ------CVLNMSLGSVKSNILNQAINEVEKKGIVVVVAAG 281

Query: 358 NENQDACNTSPAAAENAITVGASTLSDDR----AYFSNWGKCVDIFAPGLNVLSTYIGSE 413
           N N +AC TSP++A  AITVGA    DDR    A FSNWG CVDIFAPG+NV S      
Sbjct: 282 NFNMNACWTSPSSATGAITVGA---FDDRFDTIAKFSNWGPCVDIFAPGVNVASLVNRDW 338

Query: 414 TATATLSGTSMASPHVAGLLTYFL--SLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVL 471
            +    SGTSMASP V G++   L   + P+   ++ Q    T    KK+ + +      
Sbjct: 339 PSFVKYSGTSMASPIVCGMVALLLDDGVPPEDIRDYLQELA-TDGVFKKRTLVFKPG--- 394

Query: 472 YELPEDTPNYLIYNG 486
                 TPN ++YNG
Sbjct: 395 ------TPNSVLYNG 403

>CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa]
           {ON} similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045c
          Length = 517

 Score =  197 bits (502), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 129/362 (35%), Positives = 180/362 (49%), Gaps = 50/362 (13%)

Query: 188 TQNGAPWGLSRISHRERLNL---------GSFNKYLYDDDAGKGVTSYVIDTGINVNHKD 238
           TQ+ AP  L+R+S R +L             FN Y Y    G+ V +YV+D+G+ ++H D
Sbjct: 159 TQSEAPRHLARLSRRSQLPYDFNDPTRYESDFNYYYYGWHQGRSVNAYVLDSGVMIDHCD 218

Query: 239 FNGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSD 298
           F GRA +G    ++    D NGHGTH AG I S+ YGV+K   ++ +KVL S GSGT+  
Sbjct: 219 FEGRAYYGADFIRSGNSGDQNGHGTHVAGLIGSKTYGVSKKVNIIDVKVLDSVGSGTLDT 278

Query: 299 VVKGVEFAAQSHQ------------------EASKKNKKGFKGSTANMSLGGGKSPALDL 340
           V+ G+EF +                      E S  +    K    N+SLG  +S  ++ 
Sbjct: 279 VMSGLEFVSNHCNYKGKQGKQGKQGKPVWGSEDSHDDDVESKRCVINLSLGTFRSTIINE 338

Query: 341 AVNAAVKAGIHFAVAAGNENQDACNTSPAAAENAITVGASTLSDDR----AYFSNWGKCV 396
           A+   +K GI   VAAGN N +AC TSPA+  + ITVGA    DDR    A FSNWG CV
Sbjct: 339 AIEELIKQGIVVVVAAGNSNMNACWTSPASVADVITVGA---FDDRIDSIAKFSNWGNCV 395

Query: 397 DIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQASGITPA 456
           DIFAPG+ V S            +GTSMA+P V GL+   L             SGI P 
Sbjct: 396 DIFAPGVLVKSLSNKFPYYPIEQTGTSMATPIVTGLVALLLD------------SGIKPT 443

Query: 457 QLKKKLIAYSTKDVLYE----LPEDTPNYLIYNGGGQDLSDFWGKSEEQVKEEGSIQDFK 512
           Q+KK+L   +T ++           TPN + +NG  +D  D+   S   +  E  +++  
Sbjct: 444 QIKKRLNELATDNIFPRRTLLFKPGTPNRIAFNGVKRDDDDYHHYSYPNITIEHILKELD 503

Query: 513 DF 514
            +
Sbjct: 504 SY 505

>Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON}
           YCR045C (REAL)
          Length = 491

 Score =  197 bits (501), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 123/312 (39%), Positives = 169/312 (54%), Gaps = 30/312 (9%)

Query: 189 QNGAPWGLSRISHRERLNL---------GSFNKYLYDDDAGKGVTSYVIDTGINVNHKDF 239
           Q+ AP  L+RIS   +L             FN Y  DD  G+ V +Y++DTGI  +H +F
Sbjct: 125 QSDAPRHLARISRHYQLPFDIEDKERYKSWFNYYYEDDYQGQDVNAYIMDTGIFADHPEF 184

Query: 240 NGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDV 299
             R + G  + + +   D NGHGTH AG + S+ YG AK   +V +KVL  +GSG  S+V
Sbjct: 185 EDRVIQGIDLTK-EGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKDGSGEASNV 243

Query: 300 VKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNE 359
           + G+EF  +     S+   K      AN+SLG  +SP +++AV  A++ GI F  AAGN 
Sbjct: 244 LSGLEFIVEHCTRVSRPQGKK---CVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGNF 300

Query: 360 NQDACNTSPAAAENAITVGA-STLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATAT 418
           N DA   SPA+AEN ITVGA     D  A FSNWG CV+IFAPG+ + S    +   T  
Sbjct: 301 NLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNFNDTLV 360

Query: 419 LSGTSMASPHVAGLLTYFLSLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVLYE----L 474
           LSGTSM++P V G+    LS             GI P  + ++L   ST++V +      
Sbjct: 361 LSGTSMSTPIVTGVAAVLLS------------KGIEPEMIAQELEYLSTRNVFHRRTLFF 408

Query: 475 PEDTPNYLIYNG 486
              TPN ++YNG
Sbjct: 409 KPSTPNQILYNG 420

>Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}
           YCR045C (REAL)
          Length = 527

 Score =  196 bits (498), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 120/312 (38%), Positives = 171/312 (54%), Gaps = 30/312 (9%)

Query: 189 QNGAPWGLSRISHRERLNL---------GSFNKYLYDDDAGKGVTSYVIDTGINVNHKDF 239
           Q  AP  L+RIS   +L             FN Y  D+  G+GV +Y++DTGI+  H +F
Sbjct: 161 QPDAPRHLARISRHHQLPFDLEDKDRYKSWFNYYYEDEYQGQGVNAYIMDTGIHAEHPEF 220

Query: 240 NGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDV 299
             R + G  + + +   D NGHGTH AG + S  +G AK   +V +KVL  +GSG  S+V
Sbjct: 221 EDRVIQGVDLTK-EGFGDENGHGTHVAGLVGSRTFGAAKKVSLVEVKVLGKDGSGEASNV 279

Query: 300 VKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNE 359
           + G+EF  +     +K ++   K   AN+SLG  +SP +++AV  A++ GI F  AAGN 
Sbjct: 280 LSGLEFIVE---HCTKVSRPQGKKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGNF 336

Query: 360 NQDACNTSPAAAENAITVGA-STLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATAT 418
           N DA   SPA+AEN ITVGA     D  A FSNWG CV+IFAPG+ + S    ++  +  
Sbjct: 337 NLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNDNESLV 396

Query: 419 LSGTSMASPHVAGLLTYFLSLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVLYE----L 474
           LSGTSM++P V G+    LS             GI P  + +++   ST++V +      
Sbjct: 397 LSGTSMSTPIVTGVAAVLLS------------KGIEPELIAQEIEYLSTRNVFHRRTLFF 444

Query: 475 PEDTPNYLIYNG 486
              TPN ++YNG
Sbjct: 445 KPSTPNQILYNG 456

>YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}
           RRT12Probable subtilisin-family protease with a role in
           formation of the dityrosine layer of spore walls;
           localizes to the spore wall and also the nuclear
           envelope and ER region in mature spores
          Length = 491

 Score =  193 bits (490), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 122/312 (39%), Positives = 172/312 (55%), Gaps = 30/312 (9%)

Query: 189 QNGAPWGLSRISHRERL--NLGS-------FNKYLYDDDAGKGVTSYVIDTGINVNHKDF 239
           Q  AP  L+RIS   +L  ++G        FN Y   D  G+ V +Y++DTGI  +H +F
Sbjct: 125 QPDAPRHLARISRHYQLPFDVGDKDRYKSWFNYYYEHDYQGQDVNAYIMDTGIFADHPEF 184

Query: 240 NGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDV 299
             R + G  + + +   D NGHGTH AG + S+ YG AK   +V +KVL  +GSG  S+V
Sbjct: 185 EDRVIQGIDLTK-EGFGDQNGHGTHVAGLVGSKTYGAAKRVNLVEVKVLGKDGSGEASNV 243

Query: 300 VKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNE 359
           + G+EF  +     +K ++   K   AN+SLG  +SP +++AV  A++ GI F  AAGN 
Sbjct: 244 LSGLEFIVE---HCTKVSRPQGKKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGNF 300

Query: 360 NQDACNTSPAAAENAITVGA-STLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATAT 418
           N DA   SPA+AEN ITVGA     D  A FSNWG CV+IFAPG+ + S    +   T  
Sbjct: 301 NLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNYNDTLI 360

Query: 419 LSGTSMASPHVAGLLTYFLSLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVLYE----L 474
           LSGTSM++P V G+    LS             GI P  + +++   ST++V +      
Sbjct: 361 LSGTSMSTPIVTGVAAILLS------------KGIEPEMIAQEIEYLSTRNVFHRRTLFF 408

Query: 475 PEDTPNYLIYNG 486
              TPN ++YNG
Sbjct: 409 KPSTPNQILYNG 420

>SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 479

 Score =  192 bits (489), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 122/317 (38%), Positives = 165/317 (52%), Gaps = 32/317 (10%)

Query: 182 FASEFDTQNGAPWGLSRISHRERLNLGS-------FNKYLYDDDAGKGVTSYVIDTGINV 234
           ++  +  Q  AP  L+R+S R  L           FN Y      G  V +Y+IDTGI  
Sbjct: 104 YSRRYKVQEDAPRHLARLSRRGPLPYSEEDGWYQEFNYYYDRKHRGDSVNAYIIDTGIYK 163

Query: 235 NHKDFNGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSG 294
            HKD  GRA +G  +   +   D NGHGTH AG + S  +GVAK   +V +K L + G G
Sbjct: 164 QHKDLGGRAYFGADM-VGEGPGDYNGHGTHVAGIVGSRTFGVAKKVNLVEVKALNAKGQG 222

Query: 295 TMSDVVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAV 354
            ++ V+  +EF+           KK      AN+SLG  ++  L+ AV AAV++G+   V
Sbjct: 223 NLTSVISSIEFSVNHC-------KKSGMLCVANLSLGSLRNTVLNQAVEAAVESGLVVVV 275

Query: 355 AAGNENQDACNTSPAAAENAITVGA-STLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSE 413
           AAGN N +AC  SPA+A +AITVGA    +D  A FSNWG CVD+FA G+ V+S      
Sbjct: 276 AAGNSNVNACWNSPASAISAITVGAFDDRTDTIAKFSNWGMCVDVFASGVKVMSLSNMPP 335

Query: 414 TATATLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVLYE 473
                 SGTSMASP VAGL    L             SGI P  +K+K+I  +T++V  +
Sbjct: 336 FKPVAYSGTSMASPSVAGLAAVLLD------------SGIDPPDIKQKIIDLATENVFQK 383

Query: 474 ----LPEDTPNYLIYNG 486
                   TPN + +NG
Sbjct: 384 RTLVFKPGTPNRIAFNG 400

>Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar to
           Ashbya gossypii AAR069W
          Length = 610

 Score =  194 bits (494), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 134/343 (39%), Positives = 186/343 (54%), Gaps = 38/343 (11%)

Query: 189 QNGAPWGLSRISHRERLNLGS-------FNKYLYDDDAGKGVTSYVIDTGINVNHKDFNG 241
           Q+GAP  L+R   R  L   +       FN Y   +  G+ V  Y++D+GI+ +H +F G
Sbjct: 270 QSGAPRHLARNCRRSGLPFDTSGSKDYEFNYYYDAEHLGETVNVYILDSGIHKSHPEFEG 329

Query: 242 RAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVK 301
           RAV+G     N+   D NGHGTH AG + S+ YG AK A +  +KV+  +G G+ S+++ 
Sbjct: 330 RAVFGIDT-TNEGPGDLNGHGTHVAGLVGSKTYGAAKKATIYEVKVMTVDGRGSTSNIIA 388

Query: 302 GVEFAAQSHQEASKKNKKGFKGSTANMSLGG---GKSPALDLAVNAAVKAGIHFAVAAGN 358
           GVEFA +  Q++ KK         ANMSLGG   G S ALD AV AA++ G+ F VAAGN
Sbjct: 389 GVEFAVKHCQQSGKK-------CVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFVVAAGN 440

Query: 359 ENQDACNTSPAAAENAITVGA-STLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATA 417
             + AC  SPA  + AITVGA    SD  A FSN+GKCVDIFAPG+ V S          
Sbjct: 441 SKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVSSLSNSPYNTVR 500

Query: 418 TLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVLYE---L 474
            L+GTSM++P  AG++   L              G+    +K++LI  STK V +    +
Sbjct: 501 VLNGTSMSAPITAGVVAVLLD------------QGVKHEDVKERLIDLSTKGVFHRRRLV 548

Query: 475 PEDTPNYLIYNGGGQDLSDFWGKSEEQVKEEGSIQDF--KDFK 515
              TP+  ++NG  Q+  D +   E   ++E +   F   DFK
Sbjct: 549 SSRTPDRTLFNGVPQE-DDVFNAIEYPFEDEDTYIKFIGDDFK 590

>Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON}
           YCR045C (REAL)
          Length = 540

 Score =  192 bits (488), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 123/318 (38%), Positives = 170/318 (53%), Gaps = 30/318 (9%)

Query: 183 ASEFDTQNGAPWGLSRISHRERLNL---------GSFNKYLYDDDAGKGVTSYVIDTGIN 233
           A     Q+ AP  L+RIS   +L             FN Y  DD  G+ V +Y++DTGI 
Sbjct: 168 AQNITYQSDAPRHLARISRHYQLPFDIEDKNRYKSWFNYYYEDDYLGQDVNAYIMDTGIF 227

Query: 234 VNHKDFNGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGS 293
            +H +F  R + G  + + +   D NGHGTH AG + S+ YG AK   +V +KVL  +GS
Sbjct: 228 SDHPEFEDRVIQGIDLTK-EGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKDGS 286

Query: 294 GTMSDVVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFA 353
           G  S+V+ G+EF  +     S+   K      AN+SLG  +SP +++AV  A++ GI F 
Sbjct: 287 GEASNVLSGLEFIVEHCTRVSRPQGKK---CVANLSLGSFRSPIINMAVEGAIEEGIVFV 343

Query: 354 VAAGNENQDACNTSPAAAENAITVGA-STLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGS 412
            AAGN N DA   SPA+AEN ITVGA     D  A FSNWG CV+IFAPG+ + S    +
Sbjct: 344 AAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLN 403

Query: 413 ETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVLY 472
              T  LSGTSM++P V G+    LS             GI PA + +++   ST++V +
Sbjct: 404 YEDTLILSGTSMSTPIVTGVAAVLLS------------KGIEPALIAQEIEYLSTRNVFH 451

Query: 473 E----LPEDTPNYLIYNG 486
                    T N ++YNG
Sbjct: 452 RRTLFFKPSTANQILYNG 469

>KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {ON}
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 496

 Score =  191 bits (484), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 123/315 (39%), Positives = 170/315 (53%), Gaps = 40/315 (12%)

Query: 189 QNGAPWGLSRISHR-------ERLNLGSFN-KYLYDDD-AGKGVTSYVIDTGINVNHKDF 239
           Q  AP  L+RIS R       E +++ + N  Y YDD+ +G  V +YVIDTGI   H   
Sbjct: 135 QKKAPRHLARISRRTALPYDPENISVPATNFSYYYDDEFSGTCVNAYVIDTGIYKEHPQL 194

Query: 240 NGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDV 299
            GRA +G  +   +   D NGHGTH AG I S  +GVAK+  ++ +K L + G G ++ V
Sbjct: 195 EGRAKFGADL-VGEGPGDFNGHGTHVAGLIGSRKFGVAKDVSLIEVKALNAKGQGNLTSV 253

Query: 300 VKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNE 359
           +  +EF            +K  +G  AN+SLG  ++  L+ AV AA++AG+   VAAGN 
Sbjct: 254 ISAIEFTVN-------HCRKSRRGCVANLSLGSFRNTVLNQAVEAALEAGVVIVVAAGNS 306

Query: 360 NQDACNTSPAAAENAITVGASTLSDDR----AYFSNWGKCVDIFAPGLNVLSTYIGSETA 415
           N +AC +SPA++ +AITVGA    DDR    A FSNWG CVDIFAPG+ + S        
Sbjct: 307 NANACWSSPASSLSAITVGA---FDDRTDTIARFSNWGNCVDIFAPGVKIESLSNVPPFK 363

Query: 416 TATLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVLYE-- 473
               SGTSMASP V+G++   L             SGI P  +K +LI  +T  V ++  
Sbjct: 364 PVAFSGTSMASPIVSGMVANLLD------------SGIHPFDIKTELIDLATDSVFHKRT 411

Query: 474 --LPEDTPNYLIYNG 486
                 TPN + + G
Sbjct: 412 LLFKPGTPNRVAFTG 426

>AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR045C
          Length = 768

 Score =  193 bits (491), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 123/316 (38%), Positives = 174/316 (55%), Gaps = 35/316 (11%)

Query: 185 EFDTQNGAPWGLSRISHRERLNLG-------SFNKYLYDDDAGKGVTSYVIDTGINVNHK 237
           ++  Q  AP  L+R   R  L          +FN Y  ++  G+GV  YV+D+GI  +H 
Sbjct: 424 QYAIQVDAPRHLARTCRRTGLPFDPSGDKEYTFNYYYDEEHLGEGVNVYVLDSGIYKSHP 483

Query: 238 DFNGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMS 297
           +F+GRA +G      +   D NGHGTH AG + S  +G+AK A +  IKV+  +G G+ S
Sbjct: 484 EFDGRAHFGIDT-TKEGPGDLNGHGTHVAGLVGSRTFGIAKKANIYEIKVMTVDGRGSTS 542

Query: 298 DVVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGG---GKSPALDLAVNAAVKAGIHFAV 354
           +++ GVEFA +  Q++ K+         ANMSLGG   G S ALD AV AA++ G+ F V
Sbjct: 543 NIIAGVEFAVKHCQQSGKR-------CVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFVV 594

Query: 355 AAGNENQDACNTSPAAAENAITVGA-STLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSE 413
           AAGN  + AC  SPA  + AITVGA    SD  A FSN+GKCVDIFAPG+ V S      
Sbjct: 595 AAGNSKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVASLSNSPS 654

Query: 414 TATATLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVLYE 473
                L+GTSM++P  AG++   L              GI P ++K  L++ STK + ++
Sbjct: 655 NTMRVLNGTSMSAPITAGVVAVLLD------------QGIEPHEVKDHLLSISTKGLFHK 702

Query: 474 ---LPEDTPNYLIYNG 486
              +   TP+  ++ G
Sbjct: 703 RRLVSSRTPDRALFTG 718

>TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {ON}
           Anc_6.313 YCR045C
          Length = 734

 Score =  192 bits (488), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 121/298 (40%), Positives = 162/298 (54%), Gaps = 34/298 (11%)

Query: 184 SEFDTQNGAPWGLSRISHRERL-----NLGSFNK---YLYDD-DAGKGVTSYVIDTGINV 234
           S+F  Q GAP  L+RIS R++L     N   F +   Y YDD D G+GV +YVIDTGI  
Sbjct: 282 SKFKVQRGAPRHLARISTRDKLPFNFRNANQFEEQLNYYYDDNDKGEGVLAYVIDTGILK 341

Query: 235 NHKDFNGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSG 294
            HKDF  R  +G T    +   D NGHGTH AG I S+ YGV K  +++ +K +   GS 
Sbjct: 342 EHKDFEDRVEFG-TDLTGEGAGDLNGHGTHVAGLIGSKTYGVDKKVKIIDVKAVSLTGST 400

Query: 295 TMSDVVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAV 354
            +S +++ +E+          K     K    NMSLG      ++ AV +A+  G+ F V
Sbjct: 401 QLSHIIEAIEYTVNDCNSRVDK-----KACVVNMSLGSFYVKVINEAVESAIAEGVVFVV 455

Query: 355 AAGNENQDACNTSPAAAENAITVGASTLSDDR----AYFSNWGKCVDIFAPGLNVLSTYI 410
           AAGN N DAC +SP +++NAITVGA    DDR    A FSNWG+CVDIFA G+ V S   
Sbjct: 456 AAGNNNIDACWSSPGSSKNAITVGA---FDDRLDVIAKFSNWGECVDIFASGVEVKSLSS 512

Query: 411 GSETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQASGITPAQLKKKLIAYSTK 468
                    SGTSMASP V G ++  LS             G+ P  ++++++  STK
Sbjct: 513 QVPYKYIKYSGTSMASPIVCGFVSILLS------------QGVKPNDVQEEMVKLSTK 558

>KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {ON}
           Anc_6.313 YCR045C
          Length = 478

 Score =  187 bits (475), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 125/316 (39%), Positives = 167/316 (52%), Gaps = 39/316 (12%)

Query: 188 TQNGAPWGLSRISHRERL-----NLGS----FNKYLYDDDAGKGVTSYVIDTGINVNHKD 238
            Q+ AP  L+RIS R++L     N+ S    FN Y   +  G  V +Y++D+G++ N  D
Sbjct: 118 VQSEAPRHLARISRRDKLPYDFTNVSSYKKSFNYYYGKEHKGADVRAYILDSGVSRNLTD 177

Query: 239 FNGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSD 298
           F GR  +G      D + D NGHGTH AG + S+ YGVAK   +V +K L   G GT+  
Sbjct: 178 FEGRVEFGFDF-TGDGEGDSNGHGTHVAGLVGSKTYGVAKGVTMVDVKCLDEIGFGTLIT 236

Query: 299 VVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGN 358
           V+  +EFA     E  +K         AN+SLG  K+  ++ A+ AA + G+   VAAGN
Sbjct: 237 VLSAIEFAVNDCHEHPEKR------CVANLSLGSFKNAIINKAIQAATEDGVVMVVAAGN 290

Query: 359 ENQDACNTSPAAAENAITVGASTLSDDR----AYFSNWGKCVDIFAPGLNVLSTYIGSET 414
            N +AC TSPA+AE AITVGA    DDR    A FSNWG CVDI+APG+ V S       
Sbjct: 291 FNINACWTSPASAEEAITVGA---FDDRIDTIAKFSNWGPCVDIYAPGVAVESLANFPMV 347

Query: 415 ATATLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVLYE- 473
              + SGTSMASP V G +   L              GI    +K  LI  +T DV  + 
Sbjct: 348 KNISYSGTSMASPIVCGQVAILLD------------KGIPNDDIKSTLIKMATDDVFQKR 395

Query: 474 ---LPEDTPNYLIYNG 486
                 +TPN +++NG
Sbjct: 396 TLLFKPNTPNRVLFNG 411

>NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313
          Length = 483

 Score =  181 bits (460), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 131/344 (38%), Positives = 179/344 (52%), Gaps = 43/344 (12%)

Query: 168 MNQWVEFIEKDSLVFASEFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDD--------- 218
           + Q  E  +K+S +       QNGAP  L+R+S R  L     +K  Y+D          
Sbjct: 112 IKQPEELFDKNSYLVK----VQNGAPRHLARLSRRMPLPYDFDDKDAYNDSLSYYYSKWH 167

Query: 219 AGKGVTSYVIDTGINVNHKDFNGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAK 278
            G  V +Y+ID+GI++N ++F GRA  G  +   +   D NGHGTH AG + S+ YGVAK
Sbjct: 168 QGTDVNAYIIDSGIDINQEEFEGRATHGLDL-TGEGPGDRNGHGTHVAGLVGSKTYGVAK 226

Query: 279 NAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPAL 338
           N  +V +K L   GSG++  V+  +EF   +H   SK  K       AN+SLG    P L
Sbjct: 227 NVTLVEVKALDRQGSGSLITVISALEFVV-NHCGKSKSKK-----CVANLSLGAFMMPLL 280

Query: 339 DLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAENAITVGASTLSDDR----AYFSNWGK 394
           + A+ A V +G+   VAAGN N DAC  SPA+ ++AITVGA    DDR    A FSNWG 
Sbjct: 281 NEAIKATVDSGVVVVVAAGNGNIDACWCSPASEKSAITVGAF---DDRIDTIAKFSNWGS 337

Query: 395 CVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQASGIT 454
           CVDIFAPG+ + S  I     +   SGTSMASP VAG+++  L              G+ 
Sbjct: 338 CVDIFAPGVAISSLSIKDNQKSVEFSGTSMASPQVAGIVSILLD------------QGVE 385

Query: 455 PAQLKKKLIAYSTKDVLYE----LPEDTPNYLIYNGGGQDLSDF 494
              ++  L   +T DV  +        TPN + +NG  +   DF
Sbjct: 386 NEDIRDYLFELATDDVFQKRTLLFKPRTPNRITFNGISKKDEDF 429

>TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {ON}
           Anc_6.313 YCR045C
          Length = 607

 Score =  183 bits (465), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 125/317 (39%), Positives = 164/317 (51%), Gaps = 36/317 (11%)

Query: 187 DTQNGAPWGLSRISHRERL--------NLGSFNKYLYDDD-AGKGVTSYVIDTGINVNHK 237
           D Q GAP  L ++S R +L            F  Y YD    G     Y+IDTG+   HK
Sbjct: 148 DIQFGAPRHLGKLSSRHQLPYNVKDEKEFKEFIHYYYDRYYQGTNSVVYIIDTGVYKEHK 207

Query: 238 DFNGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMS 297
           +F  R  +G      +   D NGHGTH AG I S+ +GVAKN  +  +KVL   G G ++
Sbjct: 208 EFGNRVHFGGDFI-GEGKGDYNGHGTHVAGLIGSKTFGVAKNVTLFDVKVLDQKGFGNLT 266

Query: 298 DVVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAG 357
            V++G+EFA  +      K +   K    NMSLG  ++P ++ A+  A  +GI   VAAG
Sbjct: 267 SVLEGIEFAVNN---CKLKQQPMGKNCVINMSLGTIRNPIINEAIKEAFLSGITPVVAAG 323

Query: 358 NENQDACNTSPAAAENAITVGASTLSDDR----AYFSNWGKCVDIFAPGLNVLSTYIGSE 413
           N N  AC TSPA++  AITVGA    DDR    A FSNWG+CVDIFAPG+ + S      
Sbjct: 324 NNNFSACWTSPASSNFAITVGA---MDDRTDTIAVFSNWGQCVDIFAPGVRIKSLSNRML 380

Query: 414 TATATLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVLYE 473
                 SGTSMASP VAGL+   +              G    ++K+KLI  S+K +  +
Sbjct: 381 ENGVIHSGTSMASPIVAGLVAILME------------KGYKCDEIKQKLIDDSSKSIFSK 428

Query: 474 L----PEDTPNYLIYNG 486
           L       TPN +IYNG
Sbjct: 429 LTLFFKYGTPNRVIYNG 445

>Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa]
           {ON} YCR045C - Hypothetical ORF [contig 15] FULL
          Length = 493

 Score =  180 bits (456), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 126/319 (39%), Positives = 172/319 (53%), Gaps = 40/319 (12%)

Query: 185 EFDTQNGAPWGLSRISHRERLNLGSFN--------KYLYDDD-AGKGVTSYVIDTGINVN 235
           +F  Q  AP  L+RIS R  L     N         Y YDD   G  V +YVIDTGI   
Sbjct: 129 DFVAQKNAPRHLARISRRSALPYNPENIAPKTSNFSYYYDDSFPGTCVNAYVIDTGIFKE 188

Query: 236 HKDFNGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGT 295
           H+ F GRA +G  +   +   D NGHGTH AG I S+ YGVAK+  ++ +K L + G G 
Sbjct: 189 HRQFQGRAKFGADL-VGEGPGDLNGHGTHVAGLIGSQKYGVAKDVSLIEVKALNAKGQGN 247

Query: 296 MSDVVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVA 355
           ++ V+  +EF   +H   SK+      G  AN+SLG  ++  L+ AV AA++AG+   VA
Sbjct: 248 LTSVISAIEFTV-NHCRKSKR------GCVANLSLGSFRNSVLNQAVEAALEAGVVVVVA 300

Query: 356 AGNENQDACNTSPAAAENAITVGASTLSDDR----AYFSNWGKCVDIFAPGLNVLSTYIG 411
           AGN N +AC +SPA++ +AI+VGA    DDR    A FSNWG CVD+FAPG+ + S    
Sbjct: 301 AGNSNANACWSSPASSLSAISVGA---FDDRTDTIARFSNWGNCVDLFAPGVKIASLSNI 357

Query: 412 SETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVL 471
               +   SGTSMASP V G++   L             SGI P  +K++LI  +T  V 
Sbjct: 358 PPFKSVAYSGTSMASPLVTGMVAVLLD------------SGIHPFDIKEELINTATDSVF 405

Query: 472 YE----LPEDTPNYLIYNG 486
           ++        TPN + + G
Sbjct: 406 HKRALLFKPGTPNRVAFTG 424

>KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some
           similarities with uniprot|P25036 Saccharomyces
           cerevisiae YOR003W YSP3 subtilisin-like protease III
          Length = 508

 Score =  175 bits (444), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 131/329 (39%), Positives = 179/329 (54%), Gaps = 40/329 (12%)

Query: 182 FASEFDTQNGAPWGLSRISHRERLNL------GSFNKYLYDDD-AGKGVTSYVIDTGINV 234
           F+ +F +Q+ AP  L+RIS R +L +       S  KY Y ++  G+GV  YV+D+G+N 
Sbjct: 147 FSDDFISQSRAPRHLARISRRAQLPVIEKDDTSSGLKYHYHEEHQGEGVFVYVLDSGVNH 206

Query: 235 NHKDFNGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSG 294
           +H DF GRA+ G      +   D  GHGTH AG I S+ YGVAK   +V +KVL S G G
Sbjct: 207 DHPDFEGRAMKGIDT-TGEGSGDLVGHGTHVAGLIGSKTYGVAKKVNIVEVKVLDSMGKG 265

Query: 295 TMSDVVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGG-GKSPALDLAVNAAVKAGIHFA 353
           T++++++G+E+    +Q   KK K        NMSLG  G    LD AV+A ++ G+   
Sbjct: 266 TVTNIIEGLEYVV--NQCIGKKRK-----CVINMSLGAPGTHSILDKAVSAVIEEGVVVV 318

Query: 354 VAAGNENQDACNTSPAAAENAITVGASTLSDDR----AYFSNWGKCVDIFAPGLNVLSTY 409
           VA GN   +AC  SPA    AITV A    DDR    A FSNWG C+DI+APG+NV S  
Sbjct: 319 VAGGNSGLNACWYSPAKVRKAITVAA---MDDRTDLMAPFSNWGACIDIWAPGVNVKSLS 375

Query: 410 IGSETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQASGITPAQLKKKLIAYSTKD 469
                 T  LSGTSMASP VAG    +L              G  PA+++K L   +T+ 
Sbjct: 376 -NKGRGTFVLSGTSMASPIVAGAAAIYLD------------QGADPAEVRKILSKTATRG 422

Query: 470 VLYE----LPEDTPNYLIYNGGGQDLSDF 494
           V  +    +   TPN ++Y G  Q+  +F
Sbjct: 423 VFKKRAIAVRPRTPNKVLYTGNNQEDDEF 451

>TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON}
           Anc_6.313 YCR045C
          Length = 497

 Score =  152 bits (384), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 110/320 (34%), Positives = 157/320 (49%), Gaps = 30/320 (9%)

Query: 185 EFDTQNGAPWGLSRISHRERLNLGS---FNKYLYDDDAGKGVTSYVIDTGINVNHKDFNG 241
           ++ TQ  AP  LSR S   +L   S   +N Y   D  G  VT YV+D+GI ++H +F G
Sbjct: 141 KYSTQFNAPRHLSRASRITKLPTASNFTYNYYYPRDYQGANVTVYVLDSGIRMDHPEFEG 200

Query: 242 RAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVK 301
           R +       +    D  GHGT  AG I S+ YGVAKN  ++ IKVL + G G +  +++
Sbjct: 201 RILEAYDFTDSGV-GDNYGHGTSVAGIIGSKTYGVAKNVNLIDIKVLNNKGKGNVFSILQ 259

Query: 302 GVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQ 361
           G++F  +  +E +  N         N SLG      L+ A      AGI    AAGN   
Sbjct: 260 GLQFITKHCEENTNGN------CIINASLGAINIQILNKAFEEVHNAGIPVICAAGNNAV 313

Query: 362 DACNTSPAAAENAITVGASTLSDDR-AYFSNWGKCVDIFAPGLNVLSTYIGSETATATLS 420
           +AC  +PA ++   TVG+    DD  A FSNWG+CVD+ APG+ V +    ++  +   S
Sbjct: 314 NACWITPAGSKGVFTVGSFDDRDDTIATFSNWGRCVDMMAPGVYVRTLLYTNQKGSRESS 373

Query: 421 GTSMASPHVAGLLTYFLSLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVLY-----ELP 475
           GTS+++P V GL    LS             G+    L  ++    ++D+L       LP
Sbjct: 374 GTSVSTPIVTGLAAILLS------------KGVPKENLYDEIRKMGSRDLLRNKEFSRLP 421

Query: 476 EDTPNYLIYNGGGQDLSDFW 495
             TPN LI N G Q   D +
Sbjct: 422 -GTPN-LIVNIGPQKEDDVY 439

>Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045C -
           Hypothetical ORF [contig 118] FULL
          Length = 377

 Score =  141 bits (355), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 94/310 (30%), Positives = 158/310 (50%), Gaps = 12/310 (3%)

Query: 134 AKSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSLVFASEFDTQNGAP 193
           A+ S+ G   +  + N      G F   +++ +  +  +  +  D ++  +E+  Q  AP
Sbjct: 38  AQMSDNGGVGAISLGNSFRAIYGDFPQRLLENLYYDGRITAMSMDHILTPAEYIVQEHAP 97

Query: 194 WGLSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDFNGRAVWGKTVPQND 253
             L+R+S +  L  GS   Y+Y  + G GV  Y++DTGI+  H +  GR      +  N 
Sbjct: 98  AHLARLSQKSTLR-GSDGTYIYHSNGGNGVDVYLLDTGIDDLHPELEGRVQKIADLTSNP 156

Query: 254 -EDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQE 312
               D +GHGT  AG I S  +G AK   +  ++V  S G+ T+  V++ +E        
Sbjct: 157 VSHGDPHGHGTAVAGVIGSATFGSAKKCNLFDVRVADSTGNATLIGVIRALE-------H 209

Query: 313 ASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVK-AGIHFAVAAGNENQDACNTSPAAA 371
           ASK      + S   +     K+  L+ A+ A ++   +   VA GN NQ+AC++SPA+A
Sbjct: 210 ASKLASVTQRPSVVVIPFTMRKNVILNSAIEAVIRDQSLPVVVAGGNFNQNACDSSPASA 269

Query: 372 ENAITVGA--STLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHV 429
             A+T+G+   T  D  A F+N+G C+D FA G+N+ S   G   +    SGTS+++   
Sbjct: 270 YGALTIGSIDVTKGDSLAPFTNYGDCIDTFAAGVNITSLTTGDYESNTQYSGTSISAGIA 329

Query: 430 AGLLTYFLSL 439
           +G++ Y++SL
Sbjct: 330 SGVVAYYMSL 339

>KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 380

 Score =  136 bits (343), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 100/314 (31%), Positives = 162/314 (51%), Gaps = 17/314 (5%)

Query: 134 AKSSEGGIQESFDIANMLNGYIGYFTDEVV-DFIRMNQWVEFIEKDSLVFASEFDTQNGA 192
           A +  GG   +  + N      G F  +++ DF R  Q V  +  D  +  +E+  Q  A
Sbjct: 38  AATVAGGGVGAITLGNSFRAIYGEFPQQLLEDFYRSGQIVA-MSMDRPLGVAEYMVQQHA 96

Query: 193 PWGLSRISHRERLNLGSFN---KYLYDDDAGKGVTSYVIDTGINVNHKDFNGRAVWGKTV 249
           P  L+R+S +  L  G+ +    Y+Y  +AG GV  Y++DTGI+  H  F GR       
Sbjct: 97  PNHLARLSQKSSLRGGNGSDNGAYIYHSNAGNGVDVYLLDTGIDGTHPAFEGRVQKAADF 156

Query: 250 PQND-EDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQ 308
             +     D +GHGT  AG I S  +GVAK   +  ++V  S G  ++  V++ +E    
Sbjct: 157 SSDPVATGDPHGHGTAVAGVIGSSVFGVAKKCNLFDVRVANSTGHASLIGVLRALE---- 212

Query: 309 SHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVK-AGIHFAVAAGNENQDACNTS 367
               ASK      + S   + L   ++  L+ AV A V+   I   VAAGNEN+ AC+ S
Sbjct: 213 ---HASKLAAVTKRPSLITIPLEMPRNTILNSAVEAVVRDLSIPVVVAAGNENRSACSVS 269

Query: 368 PAAAENAITVGASTLS--DDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMA 425
           PA A  A+T+G+  ++  D  A F+N+ +CVD+F  G++V +  +   ++   LSGTS++
Sbjct: 270 PAGAYGALTIGSIDVARNDALAPFTNFAECVDLFTAGVDVATLGL-DHSSEHHLSGTSIS 328

Query: 426 SPHVAGLLTYFLSL 439
           +   +GL+ Y++S+
Sbjct: 329 AGVASGLVAYYMSI 342

>Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa]
           {ON} complement(151054..152214) [1161 nt, 387 aa]
          Length = 386

 Score =  133 bits (335), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 93/304 (30%), Positives = 162/304 (53%), Gaps = 24/304 (7%)

Query: 151 LNGYIGYFTDEVVDFIRMNQWVEFIEKDSLVFASEFDTQNGAPWGLSRISH---RERLNL 207
            +G+ G F DEV+  +  +  V  I  D +++  E+  QN AP  L+R+S+     R++ 
Sbjct: 61  FHGFSGEFEDEVMSELYGDPRVASISIDRMLYLQEYLRQNDAPEHLARLSNGVSNSRVSA 120

Query: 208 GSFNKYLYDDDAGKGVTSYVIDTGINVNHKDFNGRAVWGKTVPQNDED---ADGNGHGTH 264
            + N +++   AG GV  Y++D+GI+  H  F  R +  K +   D      D +GHGT 
Sbjct: 121 KNENAFIFHSHAGIGVDVYIVDSGIDSQHPAFMNRHI-SKLIDLTDNPIPVGDPHGHGTA 179

Query: 265 CAGTIASEHYGVAKNAEVVAIKVLRSNGSGT-MSDVVKGVEFAAQSHQEASKKNKKGFKG 323
            AG + S+ +GV K A +  ++V+ +  +G  +S ++K +EF  ++H  A+       + 
Sbjct: 180 IAGLVTSDTFGVMKKANLFDVRVVDAESNGVKLSKLLKSLEF-IENHSRAT------MRP 232

Query: 324 STANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAENAITVGASTLS 383
           S A +     K+  L+ A+  ++   I   V AGN++  ACN SPA+A N+ ++ +    
Sbjct: 233 SVAVLPFSMSKNAILNSAIE-SMPNSIAIVVPAGNQHHMACNFSPASARNSQSILSVGSL 291

Query: 384 DDR-----AYFSNWGKCVDIFAPGLNVLSTYIGS---ETATATLSGTSMASPHVAGLLTY 435
           D R     A FSN+G+CVD+F  G+ + + +  +   E   + +SGTSM+    AG + Y
Sbjct: 292 DYRSSIEIASFSNYGECVDVFTSGVQMDTLHATTNSDENYISKVSGTSMSCAIAAGTVGY 351

Query: 436 FLSL 439
           ++SL
Sbjct: 352 YMSL 355

>ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]
           {ON} conserved hypothetical protein
          Length = 386

 Score =  120 bits (300), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 102/361 (28%), Positives = 169/361 (46%), Gaps = 35/361 (9%)

Query: 97  FHKEIISEA-HAESVAKLDSKDSFFAATKGSADEYGIAAKSSEGGIQESFDIANMLNGYI 155
           F   I+S A  A+ V +L  K +  A      + Y +++      I + F++ +    + 
Sbjct: 4   FLTAILSTALAAQFVVQLQDKTALNAV----LNSYALSSDQQGPEITDIFELGS-FRAFT 58

Query: 156 GYFTDEVVDFIRMNQWVEFIEKDSLVFASEFDTQNGAPWGLSRISHRERLNLGSFNKYLY 215
           G F+  ++  +  +  V  I +D  +   E   QN AP  L  +S    L   S   ++Y
Sbjct: 59  GDFSGPILQKLYNDPNVLAISRDGSLKLQEIVLQNNAPSHLVGLSSISPL---SHQPFIY 115

Query: 216 DDDAGKGVTSYVIDTGINVNHKDFNGRAVW------GKTVPQNDEDADGNGHGTHCAGTI 269
             + G GV  Y++DTGI++ H + +   +          VPQ     D  GHGT  AG I
Sbjct: 116 RSNGGNGVDVYLLDTGIDIKHPNLSKLNILRMADLTQSPVPQG---TDPQGHGTAMAGII 172

Query: 270 ASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEASKKNKKGFKGSTANMS 329
           ASE +GV K   +V ++V  SNG   +S +++ +    Q H E +K+           + 
Sbjct: 173 ASETFGVLKKCNLVDVRVADSNGDVKLSTILQALTL-TQRHIEGTKRPSV----VVIPLE 227

Query: 330 LGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPA----AAENAITVGASTLSDD 385
           +  G +P L  A+ A+    +   + AGN  QDA N SPA      +N I VG+  ++++
Sbjct: 228 VEDGNNPILTEAI-ASFDQSVPIIIPAGNNAQDALNFSPANVNPKPKNIIVVGSVDVNNN 286

Query: 386 RAYFSNWGKCVDIFAPGLNV-------LSTYIGSETATATLSGTSMASPHVAGLLTYFLS 438
              F+N+G  VD+F  G  +       L +   S + T  +SGTS +S   AG++ Y++S
Sbjct: 287 PTKFTNYGSNVDVFTVGEQITTLQSTDLDSQGLSNSLTRQVSGTSASSAITAGVIGYYMS 346

Query: 439 L 439
           L
Sbjct: 347 L 347

>TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa]
           {ON} Anc_1.78
          Length = 364

 Score =  119 bits (297), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 92/303 (30%), Positives = 151/303 (49%), Gaps = 21/303 (6%)

Query: 143 ESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSLVFASEFDTQNGAPWGLSRISHR 202
           E   + +      G F+ E ++++  ++ V  I +D  +   E+  Q G+P  LS++S  
Sbjct: 45  EMITVGDQFKALAGEFSVEDLEYLYHDERVVAISRDRDLKLQEYKVQYGSPRHLSQLS-- 102

Query: 203 ERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNH---KDFNGRAVWGKTVPQNDEDADGN 259
              + GSF    +D  +G  V  YV DTGI+  H   ++ N   +   T       AD +
Sbjct: 103 ---SGGSFT---FDPVSGNLVDVYVFDTGIDFKHPGLQNVNPHKLADFTSSPVPRGADPH 156

Query: 260 GHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEASKKNKK 319
           GHGT  AG IASE +GV K+  +V ++V   +G   +S ++KG+  A+ +H   +K+   
Sbjct: 157 GHGTMMAGLIASETFGVLKSCSLVDVRVADKDGEVKLSTLMKGIS-ASVAHARFTKRPSV 215

Query: 320 GFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAENAITVGA 379
                T      G K+  LD  + A  K  I   + AGN+  DAC+ SP    N + +G+
Sbjct: 216 FVLPMTI-----GKKNHILDNFLQAIPK-DIAIVLPAGNQQTDACDLSPPNDHNILVIGS 269

Query: 380 STLSDDRAYFSNWGKCVDIFAPGLNVL---STYIGSETATATLSGTSMASPHVAGLLTYF 436
               +  A FSN+G CVD++  G ++L   ST  G+E    + +GTS +    AG++ Y 
Sbjct: 270 LDRDNRLADFSNYGNCVDVYTSGTDILTLRSTDSGNEVLLQSSNGTSASCAIGAGIVGYH 329

Query: 437 LSL 439
           +S+
Sbjct: 330 MSM 332

>TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa]
           {ON} Anc_1.78
          Length = 388

 Score =  106 bits (264), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 80/272 (29%), Positives = 137/272 (50%), Gaps = 35/272 (12%)

Query: 189 QNGAPWGLSRISHRERLNLGSF----NKYLYDDDAGKGVTSYVIDTGINVNHKDF---NG 241
           Q  AP  L R++ ++ +    +    N+Y++ D +G GV  Y++DTGI++ H  +   N 
Sbjct: 97  QTDAPKHLGRLT-KDSIKSSQYHYANNQYIFSDTSGNGVDIYIVDTGIDIQHPIYLQNNI 155

Query: 242 RAVWGKT---VPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGS-GTMS 297
             +   T   +P      D NGHGT  AG I S+ +GV K+A +V ++V+ +N    TMS
Sbjct: 156 HKLIDLTTSPIPS----GDFNGHGTAMAGIINSDPFGVLKSANLVDVRVVDANTKHATMS 211

Query: 298 DVVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAG 357
            V+  +    +  Q       K  + S   +     K+  L+ A+    K  I   + AG
Sbjct: 212 RVLSALSLIEKHEQ-------KTMRPSIIVLPFQTEKNTILESAIENISKK-IPVIIPAG 263

Query: 358 NENQDACNTSPAAAE---NAITVGASTLSDDRAY-----FSNWGKCVDIFAPGLNVLSTY 409
           N++Q+AC  SP   +   N + VG+   S+++ Y     FSN+G CVDI+  G+++ +  
Sbjct: 264 NKHQNACKLSPMGIKKLSNVLVVGSLEYSEEQNYLDIAKFSNYGSCVDIYTSGVDISTLK 323

Query: 410 I---GSETATATLSGTSMASPHVAGLLTYFLS 438
               G +     ++GTS +   VAG++ Y++S
Sbjct: 324 TSSNGGKELIHNVTGTSYSCGIVAGVVGYYMS 355

>TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1.78
          Length = 382

 Score = 92.4 bits (228), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 81/279 (29%), Positives = 126/279 (45%), Gaps = 28/279 (10%)

Query: 175 IEKDSLVFASEFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINV 234
           I  D  +   E   Q  AP  L+++   E       N+++YD  AG GV  Y+ DTGI  
Sbjct: 83  ISIDRQLEPQEMIVQKDAPRHLTKLLETE----AGDNEFVYDSTAGNGVDIYIFDTGIAR 138

Query: 235 NHKDFNGRAVW---GKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSN 291
           N    +   +    G   P    D +   HGT  +G I S  +GV K   ++ + V   N
Sbjct: 139 NSPGLSASRIHDMPGMPGPP-IRDQEILEHGTAMSGLIGSPAFGVLKKCNLIDVNVGDEN 197

Query: 292 GSGTMSDVVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIH 351
           G   MS V+KG+    Q  +  ++        S  N S    K+  L+ A +   +  + 
Sbjct: 198 GKVFMSKVLKGLNLVQQHVKHTNRP-------SVINFSYCTLKNAILNSAFDNFPR-DVP 249

Query: 352 FAVAAGNENQDACNTSPAAAE---NAITVGASTLSDD---RAYFSNWGKCVDIFAPGLNV 405
            AVAAGN  Q  C+ SP   +   + +  G+  ++DD    + FSN+G CV  +APG  +
Sbjct: 250 IAVAAGNYKQPGCSFSPVGCQRNKSLLAFGSLLMNDDGITLSDFSNYGSCVGSYAPGEGL 309

Query: 406 LSTYI------GSETATATLSGTSMASPHVAGLLTYFLS 438
           L+  I       S      +SGTS +S   AG++ Y+++
Sbjct: 310 LTFGIPDTSRPNSRDTVIIISGTSGSSALGAGVIGYYMA 348

>SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 836

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 40/85 (47%), Gaps = 11/85 (12%)

Query: 215 YDDDAGKGVTSYVIDTGINVNHKD----FNGRAVW--GKTVPQNDEDADGNGHGTHCAGT 268
           Y++  G GV + ++D G++  ++D    F     W      P        + HGT CAG 
Sbjct: 185 YENITGHGVVAAIVDDGLDYENRDLKDNFCAEGSWDFNDNTPLPKPRLRDDYHGTRCAGE 244

Query: 269 IASEH-----YGVAKNAEVVAIKVL 288
           IA+        GVA NA+V  I++L
Sbjct: 245 IAAVKNDACGVGVAYNAKVAGIRIL 269

>NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {ON}
           Anc_2.6 YNL238W
          Length = 833

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 68/260 (26%), Positives = 104/260 (40%), Gaps = 42/260 (16%)

Query: 212 KYLYDDDAGKGVTSYVIDTGINVNHKD----FNGRAVWG---KTVPQNDEDADGNGHGTH 264
           K  Y++  G+G+   ++D G++  + D    F+    W     T       AD + HGT 
Sbjct: 172 KLWYENITGEGIVVAIVDDGLDYENPDLKDNFSAEGSWDFNDNTQLPKPRLAD-DYHGTR 230

Query: 265 CAGTIASEH------YGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQ-----SHQEA 313
           CAG IA+         GVA NA+V  I++L  +G  T  D    +  A       S    
Sbjct: 231 CAGEIAATKDNGFCGIGVAYNAKVAGIRIL--SGELTAEDEAASLVHALDVNDIYSCSWG 288

Query: 314 SKKNKKGFKGST--ANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQ--DACNTSPA 369
            K +    +G T     ++  G S   D       K G  +  A+GN     D CN    
Sbjct: 289 PKDDGTHLQGPTDLVKKAMIRGTSDGRD-------KKGAIYVFASGNGGAFGDNCNYDGY 341

Query: 370 AAE-NAITVGASTLSDDRAYFSNWGKCVDIFA------PGLNVLSTYIGSETATATLSGT 422
                +IT+GA         +S    C  + A       G  + ST IG++ +     GT
Sbjct: 342 TNSIYSITIGALDHKGLHPPYSE--SCSAVMAVTYSSGSGEYIHSTDIGNKCSDHH-GGT 398

Query: 423 SMASPHVAGLLTYFLSLQPD 442
           S A+P  AG+ +  L + P+
Sbjct: 399 SAAAPLAAGIFSLVLQVNPN 418

>Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238W
           (REAL)
          Length = 809

 Score = 37.7 bits (86), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 66/257 (25%), Positives = 99/257 (38%), Gaps = 44/257 (17%)

Query: 215 YDDDAGKGVTSYVIDTGINVNHKD----FNGRAVW----GKTVPQNDEDADGNGHGTHCA 266
           Y++  G GV + ++D G++  ++D    F     W       +P+     D   HGT CA
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDD--YHGTRCA 218

Query: 267 GTIASEH------YGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEASKKNKKG 320
           G IA++        GV  NA++  I++L  +G  T  D    + +   ++   S      
Sbjct: 219 GEIAAKKGNDFCGVGVGYNAKISGIRIL--SGEITTEDEAASLIYGLDTNDIYSCSWGPA 276

Query: 321 FKGSTANMSLGGGKSPALDLAVNAAVKA--------GIHFAVAAGN--ENQDACNTSPAA 370
             G          + P+ DL   A VK         G  +  A+GN     D CN     
Sbjct: 277 DDGRHL-------QGPS-DLVKKALVKGVTEGRDSKGAIYVFASGNGGARGDNCNYDGYT 328

Query: 371 AE-NAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLS-TYIGSETATATLS----GTSM 424
               +IT+GA    D    +S    C  + A   +  S  YI S       S    GTS 
Sbjct: 329 NSIYSITIGAIDHKDLHPPYSE--SCSAVMAVTYSSGSGEYIHSSDINGKCSDSHGGTSA 386

Query: 425 ASPHVAGLLTYFLSLQP 441
           A+P  AG+ T  L   P
Sbjct: 387 AAPLAAGVYTLLLEANP 403

>Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238W
           (REAL)
          Length = 819

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 66/259 (25%), Positives = 99/259 (38%), Gaps = 42/259 (16%)

Query: 212 KYLYDDDAGKGVTSYVIDTGINVNHKD----FNGRAVW----GKTVPQNDEDADGNGHGT 263
           K  Y++  G GV + ++D G++  ++D    F     W       +P+     D   HGT
Sbjct: 158 KLWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDD--YHGT 215

Query: 264 HCAGTIASEH------YGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEASKKN 317
            CAG IA++        GV  NA++  I++L  +G  T  D    + +   ++   S   
Sbjct: 216 RCAGEIAAKKGNNFCGVGVGYNAKISGIRIL--SGDITTEDEAASLIYGLDTNDIYSCSW 273

Query: 318 KKGFKGSTANMSLGGGKSPALDLAVNAAVKA--------GIHFAVAAGN--ENQDACNTS 367
                G      L G      DL   A VK         G  +  A+GN     D CN  
Sbjct: 274 GPADDGR----HLQGPN----DLVKKALVKGVTQGRDSKGAIYVFASGNGGARGDNCNYD 325

Query: 368 PAAAE-NAITVGASTLSDDRAYFSNWGKCVDIF----APGLNVLSTYIGSETATATLSGT 422
                  +IT+GA    D    +S     V +       G  + S+ I    +  T  GT
Sbjct: 326 GYTNSIYSITIGAIDHKDLHPPYSEGCSAVMVVTYSSGSGEYIHSSDINGGCSN-THGGT 384

Query: 423 SMASPHVAGLLTYFLSLQP 441
           S A+P  AG+ T  L   P
Sbjct: 385 SAAAPLAAGVYTLLLEANP 403

>YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}
           KEX2Subtilisin-like protease (proprotein convertase), a
           calcium-dependent serine protease involved in the
           activation of proproteins of the secretory pathway
          Length = 814

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 65/256 (25%), Positives = 102/256 (39%), Gaps = 40/256 (15%)

Query: 215 YDDDAGKGVTSYVIDTGINVNHKD----FNGRAVW----GKTVPQNDEDADGNGHGTHCA 266
           Y++  G GV + ++D G++  ++D    F     W       +P+     D   HGT CA
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDY--HGTRCA 218

Query: 267 GTIASEH------YGVAKNAEVVAIKVLRSNGSGTMSD----VVKGVEFA-AQSHQEASK 315
           G IA++        GV  NA++  I++L  +G  T  D    ++ G++     S      
Sbjct: 219 GEIAAKKGNNFCGVGVGYNAKISGIRIL--SGDITTEDEAASLIYGLDVNDIYSCSWGPA 276

Query: 316 KNKKGFKGST--ANMSLGGGKSPALDLAVNAAVKAGIH-FAVAAGNENQDACNTSPAAAE 372
            + +  +G +     +L  G +   D       K  I+ FA   G    D CN       
Sbjct: 277 DDGRHLQGPSDLVKKALVKGVTEGRD------SKGAIYVFASGNGGTRGDNCNYDGYTNS 330

Query: 373 -NAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLS-TYIGSETATATLS----GTSMAS 426
             +IT+GA    D    +S    C  + A   +  S  YI S       S    GTS A+
Sbjct: 331 IYSITIGAIDHKDLHPPYSE--GCSAVMAVTYSSGSGEYIHSSDINGRCSNSHGGTSAAA 388

Query: 427 PHVAGLLTYFLSLQPD 442
           P  AG+ T  L   P+
Sbjct: 389 PLAAGVYTLLLEANPN 404

>Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W
           (REAL)
          Length = 814

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 66/257 (25%), Positives = 100/257 (38%), Gaps = 44/257 (17%)

Query: 215 YDDDAGKGVTSYVIDTGINVNHKD----FNGRAVW----GKTVPQNDEDADGNGHGTHCA 266
           Y++  G GV + ++D G++  ++D    F     W       +P+     D   HGT CA
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLLDD--YHGTRCA 218

Query: 267 GTIASEH------YGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEASKKNKKG 320
           G IA++        GV  NA++  I++L  +G  T  D    + +   ++   S      
Sbjct: 219 GEIAAKKGNNFCGIGVGYNAKISGIRIL--SGELTTEDEAASLIYGLDTNDIYSCSWGPA 276

Query: 321 FKGSTANMSLGGGKSPALDLAVNAAVKA--------GIHFAVAAGN--ENQDACNTSPAA 370
             G          + P+ DL   A VK         G  +  A+GN   + D CN     
Sbjct: 277 DDGRHL-------QGPS-DLVKKALVKGVTEGRDSKGAIYVFASGNGGAHGDNCNYDGYT 328

Query: 371 AE-NAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLS-TYIGSETATATLS----GTSM 424
               +IT+GA    D    +S    C  + A   +  S  YI S       S    GTS 
Sbjct: 329 NSIYSITIGAIDHKDLHPPYSE--GCSAVMAVTYSSGSGEYIHSSDINGRCSNSHGGTSA 386

Query: 425 ASPHVAGLLTYFLSLQP 441
           A+P  AG+ T  L   P
Sbjct: 387 AAPLAAGVYTLLLEANP 403

>NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6
           YNL238W
          Length = 833

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 68/255 (26%), Positives = 99/255 (38%), Gaps = 38/255 (14%)

Query: 215 YDDDAGKGVTSYVIDTGI---NVNHKD-FNGRAVW--GKTVPQNDEDADGNGHGTHCAGT 268
           Y++  G G+ + ++D G+   N N KD F+    W      P        + HGT CAG 
Sbjct: 186 YENVTGTGIVAAIVDDGVDYDNDNIKDNFSREGSWDFNDNGPLPKPKLKDDYHGTRCAGE 245

Query: 269 IASEH------YGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEASKKNKKGFK 322
           IA+         GVA +A+V  I++L    SG ++      E  A S   A   N   + 
Sbjct: 246 IAASKNNGICGVGVAYDAKVAGIRIL----SGELT-----AEDEAASLVHALDVNDI-YS 295

Query: 323 GSTANMSLGGGKSPALDLAVNAAVKA--------GIHFAVAAGNENQ--DACNTSPAAAE 372
            S      G       DL   A ++         G  +  A+GN     D CN       
Sbjct: 296 CSWGPRDDGTHLQGPTDLVKKAMIRGVTEGRDQKGALYVFASGNGGAYGDNCNYDGYTNS 355

Query: 373 -NAITVGASTLSDDRAYFSNWGKCVDIFA----PGLNVLSTYIGSETATATLSGTSMASP 427
             +ITVGA         +S     V +       G  + +T IG + +  T  GTS A+P
Sbjct: 356 IYSITVGAIDHKGLHPPYSESCSAVMVVTCSSGSGEFIHTTDIGDKCSN-THGGTSAAAP 414

Query: 428 HVAGLLTYFLSLQPD 442
             AG+ T  L   P+
Sbjct: 415 LAAGVYTLVLQANPE 429

>KLLA0D19811g Chr4 complement(1672338..1674608) [2271 bp, 756 aa]
           {ON} uniprot|P09231 Kluyveromyces lactis KLLA0D19811g
           KEX1 protease precursor
          Length = 756

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 92/240 (38%), Gaps = 19/240 (7%)

Query: 220 GKGVTSYVIDTGINVNHKDFN------GRAVWGKTVPQNDEDADGNGHGTHCAGTIASEH 273
           G GV + ++D G++  ++D        G   +    P        + HGT CAG IA+  
Sbjct: 155 GYGVVAALVDDGLDYENEDLKDNFCVEGSWDFNDNNPLPKPRLKDDYHGTRCAGEIAAFR 214

Query: 274 -----YGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEASKKNKKGFKGSTANM 328
                 GVA N++V  I++L  +G  T  D    + +    +   S        G T   
Sbjct: 215 NDICGVGVAYNSKVSGIRIL--SGQITAEDEAASLIYGLDVNDIYSCSWGPSDDGKTMQA 272

Query: 329 SLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQ--DACN-TSPAAAENAITVGASTLSDD 385
                K   +          G  +  A+GN     D+CN      +  +ITVGA      
Sbjct: 273 PDTLVKKAIIKGVTEGRDAKGALYVFASGNGGMFGDSCNFDGYTNSIFSITVGAIDWKGL 332

Query: 386 RAYFSNWGKCVDI--FAPGL-NVLSTYIGSETATATLSGTSMASPHVAGLLTYFLSLQPD 442
              +S     V +  ++ G  N + T    E  + T  GTS A+P  AG+ T  L   P+
Sbjct: 333 HPPYSESCSAVMVVTYSSGSGNYIKTTDLDEKCSNTHGGTSAAAPLAAGIYTLVLEANPN 392

>Ecym_6486 Chr6 complement(941694..944039) [2346 bp, 781 aa] {ON}
           similar to Ashbya gossypii ABL203W
          Length = 781

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 43/94 (45%), Gaps = 23/94 (24%)

Query: 215 YDDDAGKGVTSYVIDTGINVNHKD------------FNGRAVWGKTVPQNDEDADGNGHG 262
           Y++  G GV + ++D G++   +D            FN      K +  +D       HG
Sbjct: 154 YNNITGHGVVAAIVDDGLDYESEDLKDNFCAEGSWDFNANTALPKPILGDD------NHG 207

Query: 263 THCAGTIASEH-----YGVAKNAEVVAIKVLRSN 291
           T CAG IA+        GVA NA+V  I++L ++
Sbjct: 208 TRCAGEIAAAKNKVCGVGVAYNAKVSGIRILSAD 241

>KLTH0H00418g Chr8 (46022..48457) [2436 bp, 811 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 811

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 38/85 (44%), Gaps = 11/85 (12%)

Query: 215 YDDDAGKGVTSYVIDTGINVNHKD----FNGRAVW--GKTVPQNDEDADGNGHGTHCAGT 268
           Y++  G  V   V+D G++   +D    F+    W      P        + HGT CAG 
Sbjct: 155 YENVTGHNVVVAVVDDGLDYESEDLKDNFSAEGSWDFNDNGPMPKPRLSDDYHGTRCAGE 214

Query: 269 IASEH-----YGVAKNAEVVAIKVL 288
           IA+        GVA NA+V  I++L
Sbjct: 215 IAAVKNKACGIGVAYNAKVAGIRIL 239

>TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6
           YNL238W
          Length = 842

 Score = 35.4 bits (80), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 62/253 (24%), Positives = 98/253 (38%), Gaps = 43/253 (16%)

Query: 219 AGKGVTSYVIDTGINVNHKDFNGRAVWGKTVPQNDEDA------DGNGHGTHCAGTIASE 272
            GK VT  ++D G++  ++D   +  +  +   ND  A        + HGT CAG IA+ 
Sbjct: 166 TGKNVTVAIVDDGVDYENEDLKDKFCFEGSWDFNDNTAKPKPRLSDDYHGTRCAGEIAAV 225

Query: 273 H-----YGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEASKKNKKGFKGSTAN 327
                  GVA +A +  +++L  +G  T+ D    + +          K    F  S   
Sbjct: 226 RNDYCGVGVAFDAHISGLRIL--SGELTVEDEAAALIYGL--------KYNDIFSCSWGP 275

Query: 328 MSLGGGKSPALDLAVNAAVKA--------GIHFAVAAGNE--NQDACNTSPAAAE-NAIT 376
              G       DL   A +K         G  +  A+GN   + D CN         +IT
Sbjct: 276 PDDGQHLQGPYDLVKKAFIKGIQDGRDEKGAIYVFASGNGAISGDNCNYDGYTNSIYSIT 335

Query: 377 VGASTLSDDRAYFSNWGK-CVDIFA------PGLNVLSTYIGSETATATLSGTSMASPHV 429
           +GA    D R     + + C  + A       G  + +T I  + +T    GTS A+P  
Sbjct: 336 IGA---IDHRGLHPAYSESCSAVMAVTYSSGSGKFIETTDINGKCSTHH-GGTSAAAPLA 391

Query: 430 AGLLTYFLSLQPD 442
           AG+    L   P+
Sbjct: 392 AGVYALLLEANPE 404

>TPHA0P01790 Chr16 complement(373247..375646) [2400 bp, 799 aa] {ON}
           Anc_2.6 YNL238W
          Length = 799

 Score = 35.0 bits (79), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 39/83 (46%), Gaps = 15/83 (18%)

Query: 219 AGKGVTSYVIDTGINVNHKD----FNGRAVW----GKTVPQNDEDADGNGHGTHCAGTIA 270
            GKGV + ++D G++ N +D    F     W     K +P      D   HGT CAG IA
Sbjct: 162 TGKGVVAAIVDDGLDHNSEDLKDNFCEEGSWDFNENKKLPTPKLIDD--YHGTRCAGEIA 219

Query: 271 SEH-----YGVAKNAEVVAIKVL 288
           +        GVA  A+V  I++L
Sbjct: 220 AVKNEYCGLGVAYGAKVAGIRIL 242

>ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]
           {ON} similar to uniprot|P13134 YNL238W Saccharomyces
           cerevisiae KEX2 Subtilisin-like protease (proprotein
           convertase)
          Length = 790

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 42/87 (48%), Gaps = 15/87 (17%)

Query: 215 YDDDAGKGVTSYVIDTGINVNHKD----FNGRAVW----GKTVPQNDEDADGNGHGTHCA 266
           Y++  G GV + ++D G++   +D    F     W       +P+   D D   HGT CA
Sbjct: 154 YENITGHGVVAAIVDDGLDYESEDLKDNFCKEGSWDFNDNTKLPKPRLDDDY--HGTRCA 211

Query: 267 GTIASEH-----YGVAKNAEVVAIKVL 288
           G IA+        GVA NA++  I++L
Sbjct: 212 GEIAAVPNDFCAVGVAFNAKLSGIRIL 238

>KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa]
           {ON} Anc_2.6 YNL238W
          Length = 766

 Score = 34.7 bits (78), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 41/88 (46%), Gaps = 16/88 (18%)

Query: 215 YDDDAGKGVTSYVIDTGINVNHKD----FNGRAVW----GKTVPQNDEDADGNGHGTHCA 266
           Y +  GKGV + V+D G++  + D    F     W       +P+     D   HGT CA
Sbjct: 152 YQNITGKGVVAAVVDDGLDYENPDIKDNFCKEGSWDFNANTNLPKPTLADD--YHGTRCA 209

Query: 267 GTIASEH------YGVAKNAEVVAIKVL 288
           G IA+         GVA +A+V  I++L
Sbjct: 210 GEIAAVKNNGICGIGVAYDAKVAGIRIL 237

>CAGL0J07546g Chr10 complement(733686..736055) [2370 bp, 789 aa]
           {ON} similar to uniprot|P13134 Saccharomyces cerevisiae
           YNL238w KEX2 endoproteinase of late golgi compartment
          Length = 789

 Score = 34.7 bits (78), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 69/250 (27%), Positives = 95/250 (38%), Gaps = 36/250 (14%)

Query: 219 AGKGVTSYVIDTGINVNHKD----FNGRAVW----GKTVPQNDEDADGNGHGTHCAGTIA 270
            GKGV + +ID G++    D    F     W     + +P      D   HGT CAG IA
Sbjct: 169 TGKGVVAAIIDDGVDYTSPDLKDNFCKEGSWDFNENQQLPMPLLSDDN--HGTRCAGEIA 226

Query: 271 S---EHY---GVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEASKKNKKGFKGS 324
           +    +Y   GVA +A+V  I++L  +G  T  D     E A+  H            G 
Sbjct: 227 AIRNNNYCGVGVAYDAKVSGIRIL--SGPLTAED-----EAASLVHALDVNDIYSCSWGP 279

Query: 325 TANMSLGGGKSPALDLAVNAAV------KAGIH-FAVAAGNENQDACNTSPAAAE-NAIT 376
           T +     G SP +  A+   V      K  I+ FA   G  + D CN         +IT
Sbjct: 280 TDDGKHLQGPSPLVKKAMKKGVTEGRGNKGAIYVFASGNGGMHGDNCNYDGYTNSIYSIT 339

Query: 377 VGASTLSDDRAYFSNWGKCVDIF----APGLNVLSTYIGSETATATLSGTSMASPHVAGL 432
           VGA         +S     V +       G  + ST I          GTS A+P  AG+
Sbjct: 340 VGAIDHKGLHPPYSESCSAVLVVTYSSGSGEYIHSTDING-GCYDRHGGTSAAAPIAAGI 398

Query: 433 LTYFLSLQPD 442
               L   P+
Sbjct: 399 YALVLEANPN 408

>KNAG0F00770 Chr6 (137641..140121) [2481 bp, 826 aa] {ON} Anc_2.6
           YNL238W
          Length = 826

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 40/88 (45%), Gaps = 16/88 (18%)

Query: 215 YDDDAGKGVTSYVIDTGINVNHKD----FNGRAVW----GKTVPQNDEDADGNGHGTHCA 266
           Y +  G GV   ++D G++  + D    F     W      T+P+     D   HGT CA
Sbjct: 165 YGNVTGSGVVVAIVDDGVDYENPDIADNFCAEGSWDFNDNTTLPKPRLADDY--HGTRCA 222

Query: 267 GTIASEH------YGVAKNAEVVAIKVL 288
           G IA+         GVA N++V  +++L
Sbjct: 223 GEIAASKNNGFCGIGVAYNSKVSGLRIL 250

>Kwal_56.24800 s56 complement(1150009..1152420) [2412 bp, 803 aa]
           {ON} YNL238W (KEX2) - Ca2+-dependent serine protease
           [contig 160] FULL
          Length = 803

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 38/85 (44%), Gaps = 11/85 (12%)

Query: 215 YDDDAGKGVTSYVIDTGINVNHKD----FNGRAVW--GKTVPQNDEDADGNGHGTHCAGT 268
           Y++  G  V   V+D G++   +D    F+    W     V         + HGT CAG 
Sbjct: 156 YENITGHNVVVAVVDDGLDYESEDLKDNFSAEGSWDFNDNVALPKPRLSDDYHGTRCAGE 215

Query: 269 IASEH-----YGVAKNAEVVAIKVL 288
           IA+        GVA NA+V  +++L
Sbjct: 216 IAAGKNQFCGVGVAYNAKVAGLRIL 240

>Kpol_1050.72 s1050 complement(157470..160439) [2970 bp, 989 aa]
           {ON} complement(157470..160439) [2970 nt, 990 aa]
          Length = 989

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 1/35 (2%)

Query: 320 GFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAV 354
           G K   A M+  GG SP ++ AV A V+AGIH+  
Sbjct: 204 GIKKKLAVMT-SGGDSPGMNAAVRAVVRAGIHYGC 237

>ADL360C Chr4 complement(72248..74185) [1938 bp, 645 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML128C
           (MSC1)
          Length = 645

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 49/107 (45%), Gaps = 14/107 (13%)

Query: 285 IKVLRSNGSGTMSDVVKGVEFAAQSHQEASKKNKKGFKGS----------TANMSLGGGK 334
           ++ L S     ++++ K  + A +  +EA+ K+K   K S            N ++G GK
Sbjct: 270 VEWLGSIAQKELAEIFKQKDAAMKLSKEAAGKSKNAIKKSGQNAVQYGKDAGNAAMGYGK 329

Query: 335 SPALDLAVNAA---VKAGIHFAVAAGNENQDACNTSPAAAENAITVG 378
           +   D AVNA      AG H    A N  +DA NT   A ++A+  G
Sbjct: 330 NVGKD-AVNAGRDVANAGKHAGKDAVNAGKDAVNTGKHAGKDAVNAG 375

>TPHA0H01010 Chr8 (213903..217121) [3219 bp, 1072 aa] {ON} Anc_5.111
           YGR218W
          Length = 1072

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 54/134 (40%), Gaps = 3/134 (2%)

Query: 411 GSETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQASGITPAQLKKKLIAYSTKDV 470
           GS   T       +    ++ ++     L+P     F+ A GI  A   K+         
Sbjct: 596 GSFLTTQPYQSDPLIETIISDIINITCDLEPQQVLIFYHACGIIVAVQGKQATRRQLLSN 655

Query: 471 LYELPEDTPNYLIYNGGGQDLSDFWGKSEEQVKEEGSIQDFKDFKLSELIESFDTKTDLL 530
           L ELP  T + LI    G + ++FW    E++K   +I        SEL  SF T+   +
Sbjct: 656 LLELPNTTWS-LITKKHGLNTNEFWDM--EKIKIVANIIRINTVVCSELHTSFCTQLIHI 712

Query: 531 FEEVRSVFDKLNII 544
           +  +  ++D +  I
Sbjct: 713 YPYLLKIYDSITAI 726

>NCAS0F00490 Chr6 (89926..92889) [2964 bp, 987 aa] {ON} Anc_5.85
           YGR240C
          Length = 987

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 34/65 (52%), Gaps = 3/65 (4%)

Query: 290 SNGSGTMSDVVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAG 349
           +N S + SDV +    +A +  + +   +K  K   A M+  GG SP ++ AV A V+ G
Sbjct: 174 ANVSESSSDVSRDASLSAINMLKQTLSGQK--KKKIAVMT-SGGDSPGMNAAVRAVVRTG 230

Query: 350 IHFAV 354
           IHF  
Sbjct: 231 IHFGC 235

>Kpol_1015.8 s1015
           complement(19725..20576,20692..20940,20990..20998,
           21041..22462) [2532 bp, 843 aa] {ON}
           complement(19725..20576,20692..20940,20990..20998,
           21041..22462) [2532 nt, 844 aa]
          Length = 843

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 38/85 (44%), Gaps = 11/85 (12%)

Query: 215 YDDDAGKGVTSYVIDTGINVNHKD----FNGRAVWGKTVPQNDEDA--DGNGHGTHCAGT 268
           Y+   GKGV   ++D G++   +D    F     W     QN        + HGT CAG 
Sbjct: 157 YEGITGKGVVVAIVDDGLDYESEDLKDNFCKEGSWDFNENQNLPKPLLYDDYHGTRCAGE 216

Query: 269 IASEH-----YGVAKNAEVVAIKVL 288
           IA+        GVA  ++V  I++L
Sbjct: 217 IAAAKNEYCGLGVAYGSKVSGIRIL 241

>CAGL0E01903g Chr5 (190465..191754) [1290 bp, 429 aa] {ON} similar
           to uniprot|Q12383 Saccharomyces cerevisiae YOL125w
          Length = 429

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 32/66 (48%), Gaps = 13/66 (19%)

Query: 472 YELPEDTPNYLIYNGGG---------QDLSDFWGKSEEQVKEEGSIQ----DFKDFKLSE 518
           Y+L +D P Y++ + G          QD      K+ E+VK+  +I     D KD KLS 
Sbjct: 197 YQLQDDLPKYVLIDRGSNRMKFDKKFQDDLMALSKNPEKVKQRIAIDRLKLDIKDLKLST 256

Query: 519 LIESFD 524
           +IE  D
Sbjct: 257 VIEEHD 262

>NDAI0D02620 Chr4 complement(606774..609737) [2964 bp, 987 aa] {ON}
           Anc_5.85
          Length = 987

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 32/65 (49%), Gaps = 8/65 (12%)

Query: 290 SNGSGTMSDVVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAG 349
           S GS T++     +    QS   A +K KK      A M+  GG SP ++ AV A V+ G
Sbjct: 179 SAGSETVNASTSAINLLKQSL--AGQKKKK-----IAVMT-SGGDSPGMNAAVRAVVRTG 230

Query: 350 IHFAV 354
           IHF  
Sbjct: 231 IHFGC 235

>CAGL0F08041g Chr6 complement(792575..795550) [2976 bp, 991 aa] {ON}
           highly similar to uniprot|P16861 Saccharomyces
           cerevisiae YGR240c PFK1 6-phosphofructokinase
          Length = 991

 Score = 31.6 bits (70), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 31/68 (45%), Gaps = 12/68 (17%)

Query: 297 SDVVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIH----- 351
           +D V  ++ + QS     KK K     S       GG SP ++ AV A V+ GIH     
Sbjct: 190 TDAVNQLKESLQSGSNLQKKKKIAVMTS-------GGDSPGMNAAVRAVVRTGIHYGCDV 242

Query: 352 FAVAAGNE 359
           FAV  G E
Sbjct: 243 FAVYEGYE 250

>AGR144C Chr7 complement(1017912..1024127) [6216 bp, 2071 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER155C
           (BEM2)
          Length = 2071

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 4/69 (5%)

Query: 49  AKEITRAAAEKGEEVKLAPLVSSPQPANIIPHRYIIVFKKDATPEEISFHKEIISEAHAE 108
           A E + AA +  +E +  PL+  P P+  +P   I+    +A+ E      E +SEA+  
Sbjct: 240 ALEPSAAALQMHQERQEMPLLQPPLPSEAVPAPSIL----EASMESGELRLEYLSEAYPH 295

Query: 109 SVAKLDSKD 117
              +LD KD
Sbjct: 296 PDLQLDKKD 304

>TDEL0G01090 Chr7 (223036..225987) [2952 bp, 983 aa] {ON} Anc_5.85
           YGR240C
          Length = 983

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 23/46 (50%)

Query: 309 SHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAV 354
           ++ E  ++   G K     +   GG SP ++ AV A V+ GIHF  
Sbjct: 187 ANAEILRQTLSGQKKKKIAVMTSGGDSPGMNAAVRAVVRTGIHFGC 232

>ABL203W Chr2 (26256..28562) [2307 bp, 768 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YNL238W (KEX2)
          Length = 768

 Score = 31.6 bits (70), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 37/86 (43%), Gaps = 23/86 (26%)

Query: 220 GKGVTSYVIDTGINVNHKD------------FNGRAVWGKTVPQNDEDADGNGHGTHCAG 267
           G G+   V+D G++   +D            FN      K +  +D       HGT CAG
Sbjct: 156 GHGIVVAVVDDGLDYESEDLKDNFCAEGSWDFNSNTALPKPMLSDDT------HGTRCAG 209

Query: 268 TIASEH-----YGVAKNAEVVAIKVL 288
            IA+        GVA N++V  I++L
Sbjct: 210 EIAAAKNQFCGLGVAFNSKVSGIRIL 235

>Smik_16.66 Chr16 (123019..125982) [2964 bp, 987 aa] {ON} YGR240C
           (REAL)
          Length = 987

 Score = 31.2 bits (69), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 15/23 (65%)

Query: 332 GGKSPALDLAVNAAVKAGIHFAV 354
           GG SP ++ AV A V+ GIHF  
Sbjct: 214 GGDSPGMNAAVRAVVRTGIHFGC 236

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,156,607
Number of extensions: 2586407
Number of successful extensions: 6351
Number of sequences better than 10.0: 105
Number of HSP's gapped: 6311
Number of HSP's successfully gapped: 107
Length of query: 544
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 429
Effective length of database: 40,294,809
Effective search space: 17286473061
Effective search space used: 17286473061
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 68 (30.8 bits)