Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E00946g6.13ON49349324150.0
Ecym_30166.13ON48946221920.0
KLTH0C11462g6.13ON49246321920.0
Kwal_56.223626.13ON49346321870.0
KLLA0D00902g6.13ON49246221320.0
TDEL0G045806.13ON48446221140.0
ACR013C6.13ON48846620890.0
Kpol_1032.46.13ON46746020520.0
CAGL0A01045g6.13ON48346020450.0
Kpol_1045.766.13ON48546020100.0
TPHA0J002706.13ON49646119910.0
YPL262W (FUM1)6.13ON48846119880.0
ZYRO0C07964g6.13ON50546319850.0
Skud_16.166.13ON48846119820.0
Smik_6.4706.13ON48846119820.0
NCAS0D026206.13ON49346519740.0
Suva_16.436.13ON48846119690.0
KNAG0E027506.13ON49846319500.0
KAFR0B065206.13ON49546519320.0
NDAI0I024706.13ON47546419040.0
TBLA0G010006.13ON46546118400.0
TBLA0A071306.13ON50046218200.0
KLLA0A08404g1.354ON4612091143e-05
Skud_8.701.354ON4632381134e-05
Suva_15.2011.354ON4632381125e-05
Smik_8.831.354ON4632381081e-04
SAKL0D09746g1.354ON4642381063e-04
ZYRO0G00748g1.354ON4622401053e-04
YLR359W (ADE13)4.197ON4823141045e-04
KNAG0I015601.354ON4622401036e-04
YHR018C (ARG4)1.354ON4632381036e-04
Smik_12.4464.197ON4823141036e-04
Kpol_1018.1251.354ON4602381028e-04
Suva_10.4594.197ON4823141028e-04
TBLA0F034801.354ON4662371010.001
TDEL0D022201.354ON4652391000.001
CAGL0B02794g4.197ON482180990.002
Skud_12.4434.197ON482314980.002
Ecym_27491.354ON470286970.003
NDAI0J019504.197ON482314970.003
NCAS0J012004.197ON482312970.003
TPHA0B010404.197ON482180960.004
TPHA0A021901.354ON463233950.005
Kwal_47.180664.197ON482311930.010
ZYRO0B07964g4.197ON482290920.013
AEL019W1.354ON469217910.017
Ecym_24524.197ON482186900.022
KLLA0B13189g4.197ON482180880.039
KNAG0B058404.197ON482178880.039
KAFR0A062304.197ON482180880.039
Kpol_1042.164.197ON482180870.052
TBLA0A083204.197ON482263860.068
Kwal_27.127821.354ON465274850.088
Suva_4.4946.148ON85092850.10
KLTH0G19338g1.354ON465270840.12
SAKL0B04972g4.197ON482178830.16
ABL006C4.197ON482184800.36
TDEL0E017604.197ON482261761.1
NDAI0F00630singletonON1133119761.3
KLTH0A03344g4.197ON482178741.9
Kpol_1050.635.94ON1058189732.9
TDEL0G04710na 1ON40649714.1
KNAG0D034804.117ON116293706.6
Kwal_33.14842singletonOFF5032617.4
Kwal_23.4183singletonOFF11986658.0
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= SAKL0E00946g
         (1482 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly s...   934   0.0  
Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to ...   848   0.0  
KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {...   848   0.0  
Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W ...   847   0.0  
KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly s...   825   0.0  
TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {O...   818   0.0  
ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON} S...   809   0.0  
Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..516...   795   0.0  
CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {...   792   0.0  
Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa] ...   778   0.0  
TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13...   771   0.0  
YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumaras...   770   0.0  
ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {...   769   0.0  
Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W (...   768   0.0  
Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON...   768   0.0  
NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {O...   764   0.0  
Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W (...   763   0.0  
KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.1...   755   0.0  
KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6...   748   0.0  
NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {O...   738   0.0  
TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.1...   713   0.0  
TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6...   705   0.0  
KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {...    49   3e-05
Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}...    48   4e-05
Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {...    48   5e-05
Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}...    46   1e-04
SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {...    45   3e-04
ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly s...    45   3e-04
YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}  ADE13Aden...    45   5e-04
KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.3...    44   6e-04
YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}  ...    44   6e-04
Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359...    44   6e-04
Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]...    44   8e-04
Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359...    44   8e-04
TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.3...    44   0.001
TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.3...    43   0.001
CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {...    43   0.002
Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359...    42   0.002
Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {O...    42   0.003
NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4....    42   0.003
NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4....    42   0.003
TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {O...    42   0.004
TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.3...    41   0.005
Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359...    40   0.010
ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {...    40   0.013
AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic ho...    40   0.017
Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar t...    39   0.022
KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]...    39   0.039
KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON} Anc_4...    39   0.039
KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa] ...    39   0.039
Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON} (40749....    38   0.052
TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa] ...    38   0.068
Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]...    37   0.088
Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W ...    37   0.10 
KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]...    37   0.12 
SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly...    37   0.16 
ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON} S...    35   0.36 
TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {O...    34   1.1  
NDAI0F00630 Chr6 complement(150952..154353) [3402 bp, 1133 aa] {...    34   1.3  
KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly...    33   1.9  
Kpol_1050.63 s1050 (138268..141444) [3177 bp, 1058 aa] {ON} (138...    33   2.9  
TDEL0G04710 Chr7 (860069..861289) [1221 bp, 406 aa] {ON}               32   4.1  
KNAG0D03480 Chr4 complement(625236..628724) [3489 bp, 1162 aa] {...    32   6.6  
Kwal_33.14842 s33 (836539..836691) [153 bp, 50 aa] {OFF} [contig...    28   7.4  
Kwal_23.4183 s23 (605416..605775) [360 bp, 119 aa] {OFF} YNR044W...    30   8.0  

>SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly
            similar to uniprot|P08417 Saccharomyces cerevisiae
            YPL262W FUM1 Fumarase converts fumaric acid to L-malic
            acid in the TCA cycle cytosolic and mitochondrial
            localization determined by the N-terminal mitochondrial
            targeting sequence and protein conformation
          Length = 493

 Score =  934 bits (2415), Expect = 0.0
 Identities = 478/493 (96%), Positives = 478/493 (96%)
 Frame = +1

Query: 1    MLRITAAANRNLXXXXXXXXXXXXXXXAQQKYRIETDAFGEIKVPADKYWGAQTQRSFEN 180
            MLRITAAANRNL               AQQKYRIETDAFGEIKVPADKYWGAQTQRSFEN
Sbjct: 1    MLRITAAANRNLLPSSSIRMLSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRSFEN 60

Query: 181  FKIGGARERMPEAVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHFP 360
            FKIGGARERMPEAVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHFP
Sbjct: 61   FKIGGARERMPEAVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHFP 120

Query: 361  LVVFQTGSGTQSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIA 540
            LVVFQTGSGTQSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIA
Sbjct: 121  LVVFQTGSGTQSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIA 180

Query: 541  AVTEITHSLLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG 720
            AVTEITHSLLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG
Sbjct: 181  AVTEITHSLLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG 240

Query: 721  IARVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 900
            IARVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH
Sbjct: 241  IARVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 300

Query: 901  DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1080
            DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE
Sbjct: 301  DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 360

Query: 1081 AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGI 1260
            AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGI
Sbjct: 361  AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGI 420

Query: 1261 KANEDRISKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEKEFD 1440
            KANEDRISKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEKEFD
Sbjct: 421  KANEDRISKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEKEFD 480

Query: 1441 EWVIPEKMIGPKE 1479
            EWVIPEKMIGPKE
Sbjct: 481  EWVIPEKMIGPKE 493

>Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to
            Ashbya gossypii ACR013C
          Length = 489

 Score =  848 bits (2192), Expect = 0.0
 Identities = 417/462 (90%), Positives = 448/462 (96%)
 Frame = +1

Query: 88   QKYRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEAVVRAFGVLKKSAAIVN 267
            QK+RIETDAFGEIKVPA+KYWGAQTQRS ENFKIGG RERMPE +++AFG+LKKSAAIVN
Sbjct: 26   QKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERMPEPIIKAFGILKKSAAIVN 85

Query: 268  ESLGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEIIG 447
            ESLGTLDP+ISKPIQ+AADEVI+GKL+DHFPLVVFQTGSGTQSNMNANEVISNRAIE+IG
Sbjct: 86   ESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGTQSNMNANEVISNRAIELIG 145

Query: 448  GEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFSS 627
            GE G+KQ+HPNNHCNQAQSSNDTFPSVMHIAAVTEIT++LLPELTALRDSFQKK++EFS 
Sbjct: 146  GELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTALRDSFQKKTEEFSH 205

Query: 628  IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNTKV 807
            IVKIGRTHLQDATPLTLGQEF GY QQ+TNGI RVEQSLHHLKFLAQGGTAVGTGLNTKV
Sbjct: 206  IVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLAQGGTAVGTGLNTKV 265

Query: 808  GFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGS 987
            GFAEKIAEQVSKET I+FKTAPNKFEALAAHDAVVECSGALNT+ACSLFKIANDIRYLGS
Sbjct: 266  GFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNTVACSLFKIANDIRYLGS 325

Query: 988  GPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNV 1167
            GPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ CVQVMGNN+ ITFAGASGQFELNV
Sbjct: 326  GPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGNNSTITFAGASGQFELNV 385

Query: 1168 FKPVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHESLMLVTALNPKIGYDA 1347
            FKPVMISNLL+S+RLLADASYSFRVHCVDGIKANED+I+K+LHESLMLVTALNPKIGYD+
Sbjct: 386  FKPVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIAKILHESLMLVTALNPKIGYDS 445

Query: 1348 ASKVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGP 1473
            A KVAKNAHKK ITLKESAL+LGVL+E+EF EWV+PEKMIGP
Sbjct: 446  ACKVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKMIGP 487

>KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {ON}
            highly similar to uniprot|P08417 Saccharomyces cerevisiae
            YPL262W FUM1 Fumarase converts fumaric acid to L-malic
            acid in the TCA cycle cytosolic and mitochondrial
            localization determined by the N-terminal mitochondrial
            targeting sequence and protein conformation
          Length = 492

 Score =  848 bits (2192), Expect = 0.0
 Identities = 424/463 (91%), Positives = 442/463 (95%)
 Frame = +1

Query: 88   QKYRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEAVVRAFGVLKKSAAIVN 267
            QK R+ETDAFGEI VPADKYWGAQTQRS ENFKIGGARERMPE VVRAFG+LKKSAAIVN
Sbjct: 30   QKCRVETDAFGEINVPADKYWGAQTQRSLENFKIGGARERMPEPVVRAFGILKKSAAIVN 89

Query: 268  ESLGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEIIG 447
            ESLGTLDP+ISKPIQ+AADEVI GKL+DHFPLVVFQTGSGTQSNMNANEVISNRAIEI+G
Sbjct: 90   ESLGTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSNMNANEVISNRAIEIVG 149

Query: 448  GEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFSS 627
            G+ G+K +HPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSF  KS EF S
Sbjct: 150  GKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFATKSKEFES 209

Query: 628  IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNTKV 807
            IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGI+RVEQSL HLKFLAQGGTAVGTGLNTKV
Sbjct: 210  IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLAQGGTAVGTGLNTKV 269

Query: 808  GFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGS 987
            GF EKIAEQVSKETGIDFKTAPNKFEALAAHDA+VECSGALNTLACSLFKIANDIRYLGS
Sbjct: 270  GFGEKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTLACSLFKIANDIRYLGS 329

Query: 988  GPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNV 1167
            GPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNV
Sbjct: 330  GPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNV 389

Query: 1168 FKPVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHESLMLVTALNPKIGYDA 1347
            FKPVMISNLLSSVRLL DA YSFRVHCVDGI+AN D+I+KLLHESLMLVTALNPKIGYDA
Sbjct: 390  FKPVMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKLLHESLMLVTALNPKIGYDA 449

Query: 1348 ASKVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGPK 1476
            ASKVAKNAHKKGITLKESAL+L VL   EFD+WV+PE M+GPK
Sbjct: 450  ASKVAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVGPK 492

>Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W
            (FUM1) - mitochondrial and cytoplasmic fumarase (fumarate
            hydralase) [contig 186] FULL
          Length = 493

 Score =  847 bits (2187), Expect = 0.0
 Identities = 418/463 (90%), Positives = 443/463 (95%)
 Frame = +1

Query: 88   QKYRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEAVVRAFGVLKKSAAIVN 267
            QKYR+ETDAFGEIKVP DK WGAQTQRS ENFKIGG RERMPE +V+AFG+LKKSAAIVN
Sbjct: 30   QKYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFGILKKSAAIVN 89

Query: 268  ESLGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEIIG 447
            ESLGTLDP++SKPIQ AADEVI GKL+DHFPLVVFQTGSGTQSNMNANEVISNRAI+++G
Sbjct: 90   ESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVISNRAIQLVG 149

Query: 448  GEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFSS 627
            GE GSK +HPNNHCNQAQSSNDTFPSVMHIAAVTE+TH LLPEL ALRD+F KK+ EF S
Sbjct: 150  GEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDS 209

Query: 628  IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNTKV 807
            IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGI+RVE SLH+LKFLAQGGTAVGTGLNTKV
Sbjct: 210  IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKV 269

Query: 808  GFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGS 987
            GFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGS
Sbjct: 270  GFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGS 329

Query: 988  GPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNV 1167
            GPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNV
Sbjct: 330  GPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNV 389

Query: 1168 FKPVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHESLMLVTALNPKIGYDA 1347
            FKPVMISNLLSS+RLL DA YSFRVHCV+GI+ANED+I+KLLHESLMLVTALNPKIGYDA
Sbjct: 390  FKPVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLMLVTALNPKIGYDA 449

Query: 1348 ASKVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGPK 1476
            ASKVAKNAHKKGITLKESAL+LGVL+  EFDEWV+PE M+GPK
Sbjct: 450  ASKVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGPK 492

>KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly
            similar to uniprot|P08417 Saccharomyces cerevisiae
            YPL262W FUM1 Fumarase converts fumaric acid to L-malic
            acid in the TCA cycle cytosolic and mitochondrial
            localization determined by the N-terminal mitochondrial
            targeting sequence and protein conformation
          Length = 492

 Score =  825 bits (2132), Expect = 0.0
 Identities = 411/462 (88%), Positives = 441/462 (95%)
 Frame = +1

Query: 94   YRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEAVVRAFGVLKKSAAIVNES 273
            YR+ETDAFGEI+VP+DKYWGAQTQRS +NFKIGG RERMPE +V+AFGVLKKSAA+VNE 
Sbjct: 31   YRVETDAFGEIQVPSDKYWGAQTQRSLQNFKIGGPRERMPEPIVKAFGVLKKSAAVVNER 90

Query: 274  LGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEIIGGE 453
            LGTLDPEI+KPI++AADEV QGKLM+HFPLVVFQTGSGTQSNMNANEVISNRAIE+IGGE
Sbjct: 91   LGTLDPEIAKPIKQAADEVAQGKLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGE 150

Query: 454  KGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFSSIV 633
             GSK++HPNNHCNQAQSSNDTFPSVMHIAAVTEITH LLPEL  L+ + ++KSDEF  IV
Sbjct: 151  LGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELEGLKVALKQKSDEFQHIV 210

Query: 634  KIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNTKVGF 813
            KIGRTHLQDATPLTLGQEFSGYVQQ+ NGIARV+QSL+HLKFLAQGGTAVGTGLNTKVGF
Sbjct: 211  KIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFLAQGGTAVGTGLNTKVGF 270

Query: 814  AEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGP 993
            AE IAEQVSKETGIDFKTAPNKFEALAAHDAVVE SGALNTLA SLFKIANDIRYLGSGP
Sbjct: 271  AEDIAEQVSKETGIDFKTAPNKFEALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSGP 330

Query: 994  RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 1173
            RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN+AAITFAGASGQFELNVFK
Sbjct: 331  RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNHAAITFAGASGQFELNVFK 390

Query: 1174 PVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHESLMLVTALNPKIGYDAAS 1353
            PVMISNLLSS+RLL DAS SFR+HCV+GIKANEDRI+KLLHESLMLVTALNPKIGYDAAS
Sbjct: 391  PVMISNLLSSIRLLGDASNSFRIHCVEGIKANEDRIAKLLHESLMLVTALNPKIGYDAAS 450

Query: 1354 KVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGPKE 1479
            KVAKNAHKKGITLKESAL+L VL+ +EFD+WVIPEKMIGPKE
Sbjct: 451  KVAKNAHKKGITLKESALELKVLSSEEFDQWVIPEKMIGPKE 492

>TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {ON}
            Anc_6.13 YPL262W
          Length = 484

 Score =  818 bits (2114), Expect = 0.0
 Identities = 408/462 (88%), Positives = 433/462 (93%)
 Frame = +1

Query: 91   KYRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEAVVRAFGVLKKSAAIVNE 270
            ++R+ETDAFGEIKV AD+YWGAQTQRS ENF+IGG RERMPE +VRAFGVLKKSAA+VNE
Sbjct: 22   QFRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRERMPEPIVRAFGVLKKSAAVVNE 81

Query: 271  SLGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEIIGG 450
            SLGTLDP++++PI++AADEV QGKL  HFPLVVFQTGSGTQSNMNANEVISNRAIE+IGG
Sbjct: 82   SLGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVISNRAIELIGG 141

Query: 451  EKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFSSI 630
            E GSKQ+HPNNHCNQAQSSNDTFPSVMHIAAVTEIT  LLPEL  LRDS   KS EFS I
Sbjct: 142  ELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSLDAKSKEFSDI 201

Query: 631  VKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNTKVG 810
            VKIGRTHLQDATPLTLGQEFSGYVQQ++NGI RVE SLH LK+LAQGGTAVGTGLNTK+G
Sbjct: 202  VKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTAVGTGLNTKIG 261

Query: 811  FAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSG 990
            FAEKIAEQVSKETG+DFKTAPNKFEALAAHDAVVE SGALNT+ACSLFKIA DIRYLGSG
Sbjct: 262  FAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSG 321

Query: 991  PRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVF 1170
            PRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQVCVQVMGNNAAITFAGASGQFELNVF
Sbjct: 322  PRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGASGQFELNVF 381

Query: 1171 KPVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHESLMLVTALNPKIGYDAA 1350
            KPVMISNLLSSVRLLADASYSFRVHCVDGI AN DRI KL+HESLMLVTALNPKIGYDAA
Sbjct: 382  KPVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGKLMHESLMLVTALNPKIGYDAA 441

Query: 1351 SKVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGPK 1476
            SKVAKNAHKKGITLK+SAL LGVL E EFDEWV+PE MIGPK
Sbjct: 442  SKVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMIGPK 483

>ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YPL262W
            (FUM1)
          Length = 488

 Score =  809 bits (2089), Expect = 0.0
 Identities = 402/466 (86%), Positives = 438/466 (93%)
 Frame = +1

Query: 82   AQQKYRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEAVVRAFGVLKKSAAI 261
            A Q++R+ETDAFGEI+VPADKYWGAQTQRS ENF+IGGARERMPE VVRAFGVLKKSAA+
Sbjct: 23   APQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRAFGVLKKSAAV 82

Query: 262  VNESLGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEI 441
            VNE LGTL+P I+K IQ+AADEV QG+LM+HFPLVVFQTGSGTQSNMNANEVISNRAIE+
Sbjct: 83   VNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVISNRAIEL 142

Query: 442  IGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEF 621
            +GGE GSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEIT SLLPEL ALR SFQ+K+DEF
Sbjct: 143  LGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVSFQRKTDEF 202

Query: 622  SSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNT 801
            + IVKIGRTHLQDATPLTLGQEFSGY QQ+ NGIARVE +   L+FLAQGGTAVGTGLNT
Sbjct: 203  AHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGLNT 262

Query: 802  KVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYL 981
            + GFAE+IA QVS+ETG++F+TAPNKFEALAAHDAVVE SGALNTLACSLFKIANDIRYL
Sbjct: 263  RRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRYL 322

Query: 982  GSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFEL 1161
            GSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQ CVQVMGNNAAITFAGASGQFEL
Sbjct: 323  GSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFAGASGQFEL 382

Query: 1162 NVFKPVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHESLMLVTALNPKIGY 1341
            NVFKPVMI+NLLSSVRLLADA+ SFRVHCVDGI+ NEDRI+KLLHESLMLVTALNPKIGY
Sbjct: 383  NVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLVTALNPKIGY 442

Query: 1342 DAASKVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGPKE 1479
            DAAS VAKNAHKKGITL+ SAL+LGVL + EFDEWV+PEKMIGP++
Sbjct: 443  DAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPRD 488

>Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..5164)
            [1404 nt, 468 aa]
          Length = 467

 Score =  795 bits (2052), Expect = 0.0
 Identities = 393/460 (85%), Positives = 428/460 (93%)
 Frame = +1

Query: 94   YRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEAVVRAFGVLKKSAAIVNES 273
            +R+ETD FGEIKVPADKYWGAQTQRS+ENFKIGG RERMPE VV+AFGVLKKSAAIVNE 
Sbjct: 7    FRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNEE 66

Query: 274  LGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEIIGGE 453
             G LD  ISK IQ+AADEVI+GKL +HFPLVVFQTGSGTQSNMNANEVISNRAIE+ GG 
Sbjct: 67   FGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGI 126

Query: 454  KGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFSSIV 633
             GSK++HPNNHCN AQSSNDTFP+VMHIAAVTEITH L+P++T L+D+   KS EF  IV
Sbjct: 127  MGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIV 186

Query: 634  KIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNTKVGF 813
            KIGRTHLQDATPLTLGQEFSGYVQQL NGIAR+E SL +LKFLAQGGTAVGTGLNTK+GF
Sbjct: 187  KIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGF 246

Query: 814  AEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGP 993
            AE+IAEQVSKETGI+FKTAPNKFEALAAHDA+VE SGALNT+ACSLFKIA DIRYLGSGP
Sbjct: 247  AERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGP 306

Query: 994  RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 1173
            RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK
Sbjct: 307  RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 366

Query: 1174 PVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHESLMLVTALNPKIGYDAAS 1353
            PVMISNLLSS+RLL DA +SF +HCV+GI+ANED+I+KLLHESLMLVTALNPKIGYD+A+
Sbjct: 367  PVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSAT 426

Query: 1354 KVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGP 1473
            KVAKNAHKKGITLKESAL+LGVL E EFDEWV+PEKM+GP
Sbjct: 427  KVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGP 466

>CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {ON}
            highly similar to uniprot|P08417 Saccharomyces cerevisiae
            YPL262w FUM1 fumarate hydratase
          Length = 483

 Score =  792 bits (2045), Expect = 0.0
 Identities = 391/460 (85%), Positives = 426/460 (92%)
 Frame = +1

Query: 94   YRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEAVVRAFGVLKKSAAIVNES 273
            YR+ETD FGEIKVPADKYWGAQTQRSF+NFKIGGARERMPE +VRAFGVLKKSAAIVNE 
Sbjct: 22   YRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARERMPEPIVRAFGVLKKSAAIVNEK 81

Query: 274  LGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEIIGGE 453
            LGTLD EI+ PIQ+AADEV +GKL DHFPLVVFQTGSGTQSNMNANEVISNRAIE+IGGE
Sbjct: 82   LGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGE 141

Query: 454  KGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFSSIV 633
             GSK++HPNNHCNQAQSSNDTFPSVMHIAAVTEIT+SLLPE+T L+D+  KK++EF  IV
Sbjct: 142  LGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEITQLKDALHKKAEEFQDIV 201

Query: 634  KIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNTKVGF 813
            KIGRTHLQDATPLTLGQEFSGYVQQL NGIAR+E +L HLK+LAQGGTAVGTGLNTK GF
Sbjct: 202  KIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYLAQGGTAVGTGLNTKEGF 261

Query: 814  AEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGP 993
             + IAEQ+SKETGIDFKTAPNKFEALAAHDA+VE SGALNT+ACSLFKIA DIRYLGSGP
Sbjct: 262  DKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGP 321

Query: 994  RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 1173
            RCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAA+TFAGA+GQFELNVFK
Sbjct: 322  RCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGANGQFELNVFK 381

Query: 1174 PVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHESLMLVTALNPKIGYDAAS 1353
            PVMISNLLSS+RLLADA +SFRVHCV+GI+AN ++I+  LH SLMLVTALNPKIGYDAAS
Sbjct: 382  PVMISNLLSSIRLLADACHSFRVHCVEGIEANREKINHNLHNSLMLVTALNPKIGYDAAS 441

Query: 1354 KVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGP 1473
            K+AKNA KK ITLKESAL+L  L  +EFDEWVIPE M+GP
Sbjct: 442  KIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENMVGP 481

>Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa] {ON}
            complement(177449..178906) [1458 nt, 486 aa]
          Length = 485

 Score =  778 bits (2010), Expect = 0.0
 Identities = 388/460 (84%), Positives = 423/460 (91%)
 Frame = +1

Query: 94   YRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEAVVRAFGVLKKSAAIVNES 273
            +R+ETD FGEIKVPA+KYWGAQT+RSFENFKIGG+RERMPEAVVRAFGVLKK AAIVN  
Sbjct: 24   FRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKKCAAIVNTE 83

Query: 274  LGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEIIGGE 453
            LG LDP  SK IQ+AADEV  GKL DHFPLVVFQTGSGTQSNMNANEVISNRAIE+ GG 
Sbjct: 84   LGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGV 143

Query: 454  KGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFSSIV 633
             GSK++HPNNHCN AQSSNDTFP+VMHIAAVT+I+  LLPELT LRD+   KS EF  IV
Sbjct: 144  LGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIV 203

Query: 634  KIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNTKVGF 813
            KIGRTHLQDATPLTLGQEFSGYVQQLTNGI R+E++  +L+FLAQGGTAVGTGLNTK G+
Sbjct: 204  KIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGW 263

Query: 814  AEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGP 993
            AE+IA ++SKETG+ FKTAPNKFEALAAHDA+VE SGALNT+ACSLFKIA DIRYLGSGP
Sbjct: 264  AERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGP 323

Query: 994  RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 1173
            RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAA+TFAGASGQFELNVFK
Sbjct: 324  RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASGQFELNVFK 383

Query: 1174 PVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHESLMLVTALNPKIGYDAAS 1353
            PV+ISNLLSSV+LL DAS SFRVHCV+GIKANE +IS+LLH SLMLVTALNPKIGYDAA+
Sbjct: 384  PVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNPKIGYDAAT 443

Query: 1354 KVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGP 1473
            KVAKNAHKKGITLKESAL+LGVL EKEFDEWV+PEKM+GP
Sbjct: 444  KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 483

>TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13
            YPL262W
          Length = 496

 Score =  771 bits (1991), Expect = 0.0
 Identities = 379/461 (82%), Positives = 421/461 (91%)
 Frame = +1

Query: 94   YRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEAVVRAFGVLKKSAAIVNES 273
            +RIETD FGEIKVPA+KYWGAQT+RSFENF+IGG RERMP+ VV+AFGVLKKSAAIVNE 
Sbjct: 36   FRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVKAFGVLKKSAAIVNEG 95

Query: 274  LGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEIIGGE 453
             GTLDP+ISK IQ+AADEVIQGKL DHFPLVVFQTGSGTQSNMNANEVISNRAIE++GG 
Sbjct: 96   YGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGT 155

Query: 454  KGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFSSIV 633
             GSKQVHPNNH NQAQSSND+FP+VMHIAAVTEIT  L+PE+  LRD+ + KS +F+ IV
Sbjct: 156  LGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDFAHIV 215

Query: 634  KIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNTKVGF 813
            KIGRTHLQDATPLTLGQEFSGYVQQLTNGI R+E SL +LKFLAQGGTAVGTGLNT++GF
Sbjct: 216  KIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTGLNTRIGF 275

Query: 814  AEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGP 993
            AEKIAEQ+SKETG+ FKTAPNKFEALAAHDA+VE SGA+ T+A SLFKIA DIRYLGSGP
Sbjct: 276  AEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGP 335

Query: 994  RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 1173
            RCGYGELSLPENEPGSSIMPGK+NPTQNEA+TQVC Q++GNN  I FAG  GQFELNVFK
Sbjct: 336  RCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGNNQTIIFAGTQGQFELNVFK 395

Query: 1174 PVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHESLMLVTALNPKIGYDAAS 1353
            PVMISNLLSS+RLL D S SFR+HCV+GIKANE+RI+ L+++SLMLVTALNPKIGYD A+
Sbjct: 396  PVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIADLMNKSLMLVTALNPKIGYDEAT 455

Query: 1354 KVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGPK 1476
            KVAKNAHKKGITLKESA+QLG L E EFDEWV+PEKMIGPK
Sbjct: 456  KVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMIGPK 496

>YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumarase,
            converts fumaric acid to L-malic acid in the TCA cycle;
            cytosolic and mitochondrial distribution determined by
            the N-terminal targeting sequence, protein conformation,
            and status of glyoxylate shunt; phosphorylated in
            mitochondria
          Length = 488

 Score =  770 bits (1988), Expect = 0.0
 Identities = 385/461 (83%), Positives = 419/461 (90%)
 Frame = +1

Query: 94   YRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEAVVRAFGVLKKSAAIVNES 273
            +R ETDAFGEI VPADKYWGAQTQRSF+NFKIGGARERMP  +V AFGVLKKSAAIVNES
Sbjct: 28   FRTETDAFGEIHVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNES 87

Query: 274  LGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEIIGGE 453
            LG LDP+ISK IQ+AADEV  GKL DHFPLVVFQTGSGTQSNMNANEVISNRAIEI+GG+
Sbjct: 88   LGGLDPKISKAIQQAADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGK 147

Query: 454  KGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFSSIV 633
             GSKQVHPNNHCNQ+QSSNDTFP+VMHIAA  +I + L+PELT L+++ + KS EF  IV
Sbjct: 148  IGSKQVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFDHIV 207

Query: 634  KIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNTKVGF 813
            KIGRTHLQDATPLTLGQEFSGYVQQ+ NGI RV  SL  L FLAQGGTAVGTGLNTK GF
Sbjct: 208  KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGF 267

Query: 814  AEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGP 993
              KIAEQ+SKETG+ F+TAPNKFEALAAHDA+VECSGALNTLACSLFKIA DIRYLGSGP
Sbjct: 268  DVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGP 327

Query: 994  RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 1173
            RCGY EL LPENEPGSSIMPGKVNPTQNEA+TQVCVQVMGNNAAITFAG+ GQFELNVFK
Sbjct: 328  RCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFK 387

Query: 1174 PVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHESLMLVTALNPKIGYDAAS 1353
            PVMI+NLL+S+RL+ DA+YSFRVHCV+GIKANE RI +LL +SLMLVTALNPKIGYDAAS
Sbjct: 388  PVMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAAS 447

Query: 1354 KVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGPK 1476
            KVAKNAHKKGITLKESAL+LGVL EKEFDEWV+PE M+GPK
Sbjct: 448  KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEHMLGPK 488

>ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {ON}
            highly similar to uniprot|P08417 Saccharomyces cerevisiae
            YPL262W FUM1 Fumarase converts fumaric acid to L-malic
            acid in the TCA cycle cytosolic and mitochondrial
            localization determined by the N-terminal mitochondrial
            targeting sequence and protein conformation
          Length = 505

 Score =  769 bits (1985), Expect = 0.0
 Identities = 381/463 (82%), Positives = 420/463 (90%)
 Frame = +1

Query: 88   QKYRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEAVVRAFGVLKKSAAIVN 267
            Q++R+ETDAFGEIKVPADKYWGAQTQRSFENF+IGG RERMPEAVV AFG+LKK+ A VN
Sbjct: 42   QEHRVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVN 101

Query: 268  ESLGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEIIG 447
            E+ G LDP+++  I++AADEV  GKL DHFPLVVFQTGSGTQSNMNANEVISNRAIE++G
Sbjct: 102  EANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLG 161

Query: 448  GEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFSS 627
            G+ GSK VHPNNH N +QSSNDTFP+VMHIAAV  IT  LLP LTAL+DS QKKS+EF+ 
Sbjct: 162  GKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFAD 221

Query: 628  IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNTKV 807
            IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI RVE +L  LK LAQGGTAVGTGLNTK+
Sbjct: 222  IVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKI 281

Query: 808  GFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGS 987
            G+AE +A +V+KETGIDF+TAPNKFEALAAHDAVVE SGALNTLA SLFKIA DIRYLGS
Sbjct: 282  GWAENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGS 341

Query: 988  GPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNV 1167
            GPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQVCVQV GN++AITFAGASGQFELNV
Sbjct: 342  GPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNV 401

Query: 1168 FKPVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHESLMLVTALNPKIGYDA 1347
            FKPVMISNLLSS+ LL+DASYSFRVHCVDGI+AN + I+KLLHESLMLVTALNPKIGYDA
Sbjct: 402  FKPVMISNLLSSINLLSDASYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDA 461

Query: 1348 ASKVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGPK 1476
            ASKVAKNAHK GITLKESALQL +L  +EFD WV+PE MIGPK
Sbjct: 462  ASKVAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGPK 504

>Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W (REAL)
          Length = 488

 Score =  768 bits (1982), Expect = 0.0
 Identities = 382/461 (82%), Positives = 419/461 (90%)
 Frame = +1

Query: 94   YRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEAVVRAFGVLKKSAAIVNES 273
            +RIETDAFGEI VPADKYWGAQTQRSF+NFKIGGARERMP  +V AFGVLKKSAA+VNES
Sbjct: 28   FRIETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAVVNES 87

Query: 274  LGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEIIGGE 453
            LG LDP+ISK IQ+AADEV  GKL DHFPLVVFQTGSGTQSNMNANEVISNRAIEI+GG+
Sbjct: 88   LGGLDPKISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGK 147

Query: 454  KGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFSSIV 633
             GSK+VHPNNHCNQ+QSSNDTFP+VMHIAA  +I + L+PELT L+++ + KS EF  IV
Sbjct: 148  IGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFEHIV 207

Query: 634  KIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNTKVGF 813
            KIGRTHLQDATPLTLGQEFSGYVQQ+ NGI RV  SL  L FLAQGGTAVGTGLNTK GF
Sbjct: 208  KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGF 267

Query: 814  AEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGP 993
              KIAEQ+S ETG+ F+TAPNKFEALAAHDA+VECSGALNTLACSLFKIA DIRYLGSGP
Sbjct: 268  DIKIAEQISSETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGP 327

Query: 994  RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 1173
            RCGY EL LPENEPGSSIMPGKVNPTQNEA+TQVCVQVMGNNAAITFAG+ GQFELNVFK
Sbjct: 328  RCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFK 387

Query: 1174 PVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHESLMLVTALNPKIGYDAAS 1353
            PVMI+NLL+S+RL+ D++YSFRVHCV+GIKANE RI +LL +SLMLVTALNPKIGYDAAS
Sbjct: 388  PVMIANLLNSIRLITDSAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAAS 447

Query: 1354 KVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGPK 1476
            KVAKNAHKKGITLKESAL+LGVL EKEFDEWV+PE M+GPK
Sbjct: 448  KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488

>Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON}
            YPL262W (REAL)
          Length = 488

 Score =  768 bits (1982), Expect = 0.0
 Identities = 383/461 (83%), Positives = 418/461 (90%)
 Frame = +1

Query: 94   YRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEAVVRAFGVLKKSAAIVNES 273
            +R ETDAFGEI VPADKYWGAQTQRSF+NFKIGGARERMP  +V AFGVLKKSAAIVNES
Sbjct: 28   FRTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNES 87

Query: 274  LGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEIIGGE 453
            LG LDP+ISK IQ+AADEV  GKL DHFPLVVFQTGSGTQSNMNANEVISNRAIEI+GG+
Sbjct: 88   LGGLDPKISKAIQEAADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGK 147

Query: 454  KGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFSSIV 633
             GSK+VHPNNHCNQ+QSSNDTFP+VMHIAA  +I + L+PEL  L+++ + KS EF  IV
Sbjct: 148  IGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELANLKNALEAKSKEFDHIV 207

Query: 634  KIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNTKVGF 813
            KIGRTHLQDATPLTLGQEFSGYVQQ+ NGI RV  SL  L FLAQGGTAVGTGLNTK GF
Sbjct: 208  KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGF 267

Query: 814  AEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGP 993
              KIAEQ+SKETG+ F+TAPNKFEALAAHDA+VECSGALNTLACSLFKIA DIRYLGSGP
Sbjct: 268  DVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGP 327

Query: 994  RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 1173
            RCGY EL LPENEPGSSIMPGKVNPTQNEA+TQVCVQVMGNNAAITFAG+ GQFELNVFK
Sbjct: 328  RCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFK 387

Query: 1174 PVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHESLMLVTALNPKIGYDAAS 1353
            PVMI+NLL+S+RL+ DA+YSFRVHCV+GIKANE RI +LL +SLMLVTALNPKIGYDAAS
Sbjct: 388  PVMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAAS 447

Query: 1354 KVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGPK 1476
            KVAKNAHKKGITLKESAL+LGVL EKEFDEWV+PE M+GPK
Sbjct: 448  KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488

>NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {ON}
            Anc_6.13 YPL262W
          Length = 493

 Score =  764 bits (1974), Expect = 0.0
 Identities = 369/465 (79%), Positives = 426/465 (91%)
 Frame = +1

Query: 82   AQQKYRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEAVVRAFGVLKKSAAI 261
            +QQ+YRIETD+FGEIKVPADKYWGAQTQRSF+NFKIGG+RER+P+ ++ AFG+LKKSAAI
Sbjct: 28   SQQQYRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRERIPDPIITAFGILKKSAAI 87

Query: 262  VNESLGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEI 441
            VNESLGTLDP+++ PI+KAADEV+QGKL DHFPLVVFQTGSGTQ+NMN NEVISNRAIE+
Sbjct: 88   VNESLGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGSGTQTNMNVNEVISNRAIEL 147

Query: 442  IGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEF 621
            +GG+ GSKQ+HPNNHCNQ+QSSNDTFPSVMHIAAV EIT+SL+PELT L+D+   K+ EF
Sbjct: 148  VGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELTKLKDALDVKAKEF 207

Query: 622  SSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNT 801
            + IVKIGRTHLQDATPLTLGQEFSGYVQQL NGI R+E SL+HLKFLAQGGTAVGTGLNT
Sbjct: 208  ADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFLAQGGTAVGTGLNT 267

Query: 802  KVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYL 981
            K+GF + IAE+VSKETGI+FKTAPNKFEALAAHDA+V  SGALNT+A SLFKIA DIRYL
Sbjct: 268  KIGFDKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGALNTVAGSLFKIAQDIRYL 327

Query: 982  GSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFEL 1161
            GSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQVCVQ+MGNN  I+ AG+ GQFEL
Sbjct: 328  GSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQIMGNNQTISIAGSQGQFEL 387

Query: 1162 NVFKPVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHESLMLVTALNPKIGY 1341
            NV+KP+MI+NLL+S+RL+ DA  SFR+HC+D +KAN+D+I++ L++SLMLVTALNPKIGY
Sbjct: 388  NVYKPLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKINENLNKSLMLVTALNPKIGY 447

Query: 1342 DAASKVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGPK 1476
            DAASK+AKNAH K ITLKESAL+L  L  +EFDEWV+PE MIGPK
Sbjct: 448  DAASKIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENMIGPK 492

>Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W (REAL)
          Length = 488

 Score =  763 bits (1969), Expect = 0.0
 Identities = 381/461 (82%), Positives = 416/461 (90%)
 Frame = +1

Query: 94   YRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEAVVRAFGVLKKSAAIVNES 273
            +R ETDAFGEI VPADKYWGAQTQRSF+NFKIGGARERMP  +V AFGVLKKSAAIVNES
Sbjct: 28   FRTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNES 87

Query: 274  LGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEIIGGE 453
            LG LDP++SK IQ+AADEV  GKL DHFPLVVFQTGSGTQSNMNANEVISNRAIEI+GG+
Sbjct: 88   LGGLDPKVSKAIQQAADEVAAGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGK 147

Query: 454  KGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFSSIV 633
             GSKQVHPNN CNQ+QSSNDTFP+VMHIAA  +I   L+PELT L+++ + KS EF  IV
Sbjct: 148  IGSKQVHPNNDCNQSQSSNDTFPTVMHIAASLQIEKELIPELTNLKNALEAKSKEFEHIV 207

Query: 634  KIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNTKVGF 813
            KIGRTHLQDATPLTLGQEFSGYVQQ+ NGI RV  +L  L FLAQGGTAVGTGLNTK GF
Sbjct: 208  KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGF 267

Query: 814  AEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGP 993
              KIAEQ+SKETG+ F+TAPNKFEALAAHDA+VECSGALNTLACSLFKIA DIRYLGSGP
Sbjct: 268  DVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGP 327

Query: 994  RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 1173
            RCGY EL LPENEPGSSIMPGKVNPTQNEA+TQVCVQVMGNNAAITF G+ GQFELNVFK
Sbjct: 328  RCGYNELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFGGSQGQFELNVFK 387

Query: 1174 PVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHESLMLVTALNPKIGYDAAS 1353
            PVMI+NLL+S+RL+ADAS SFR+HCV+GIKANE RI +LL +SLMLVTALNPKIGYDAAS
Sbjct: 388  PVMIANLLNSIRLIADASRSFRIHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAAS 447

Query: 1354 KVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGPK 1476
            KVAKNAHKKGITLKESAL+LGVL EKEFDEWV+PE M+GPK
Sbjct: 448  KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488

>KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.13
            YPL262W
          Length = 498

 Score =  755 bits (1950), Expect = 0.0
 Identities = 372/463 (80%), Positives = 419/463 (90%)
 Frame = +1

Query: 88   QKYRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEAVVRAFGVLKKSAAIVN 267
            Q++R+ETD+FGEI VPAD+YWGAQTQRSF+NFKIGG RE++PE VVRAFG+LKKSAA VN
Sbjct: 35   QEFRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDREKIPEPVVRAFGILKKSAATVN 94

Query: 268  ESLGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEIIG 447
            E+LGTLD  I+  I+ AADEV +GKL DHFPLVVFQTGSGTQSNMNANEVISNRAIE++G
Sbjct: 95   ENLGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSGTQSNMNANEVISNRAIELLG 154

Query: 448  GEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFSS 627
            GE GSKQVHPNNH NQ+QSSNDTFP+VMHIAA TEI + L+PEL  L+D+ Q K +EFSS
Sbjct: 155  GELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQNLKDALQHKVEEFSS 214

Query: 628  IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNTKV 807
            IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI RV+ SL+HL FLAQGGTAVGTGLNTKV
Sbjct: 215  IVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLAQGGTAVGTGLNTKV 274

Query: 808  GFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGS 987
            GF + +AE+VSKETG+ F+TAPNKFEALAAHDA+VE SGALNTLACSLFKIA DIRYLGS
Sbjct: 275  GFDKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASGALNTLACSLFKIAQDIRYLGS 334

Query: 988  GPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNV 1167
            GPRCGYGEL LP NEPGSSIMPGKVNPTQNEAMTQVCVQVMGNN+ ITFAG+ GQFELNV
Sbjct: 335  GPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNSTITFAGSQGQFELNV 394

Query: 1168 FKPVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHESLMLVTALNPKIGYDA 1347
            +KP+MISNLLSS+RLL DAS SFR+HC++ +KAN+D+I + L++SLMLVTALNPKIGYDA
Sbjct: 395  YKPLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKIDENLNKSLMLVTALNPKIGYDA 454

Query: 1348 ASKVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGPK 1476
            A+KVAKNAH K ITLKESAL+LGVL EKEFDEWVIPE MI PK
Sbjct: 455  AAKVAKNAHHKNITLKESALELGVLTEKEFDEWVIPENMISPK 497

>KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6.13
            YPL262W
          Length = 495

 Score =  748 bits (1932), Expect = 0.0
 Identities = 366/465 (78%), Positives = 419/465 (90%)
 Frame = +1

Query: 85   QQKYRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEAVVRAFGVLKKSAAIV 264
            +  +R ETD+FGEI VP DKYWGAQTQRS +NFKIGG RE++P  ++ AFG+LKKSAAIV
Sbjct: 31   KSSFRAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGEREKIPIPIIEAFGILKKSAAIV 90

Query: 265  NESLGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEII 444
            NE LGTLD E++K I  AADEV QGKL DHFPLVVFQTGSGTQSNMNANEVISNRAIE++
Sbjct: 91   NERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELM 150

Query: 445  GGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFS 624
            GG+ GSK VHPNNH NQ+QSSNDTFP+VMHIAA+ EIT  LLPEL +L++S  KKS+EF+
Sbjct: 151  GGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNSLKNSLDKKSNEFN 210

Query: 625  SIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNTK 804
             IVKIGRTHLQDATPLTLGQEFSGYVQQ+TNGI R+E +L+HLKFLAQGGTAVGTGLNTK
Sbjct: 211  DIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLAQGGTAVGTGLNTK 270

Query: 805  VGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLG 984
             GF + IAEQ+S+ETGI+F+TAPNKFEALAAHDA+VE SGALNTLACSLFKIA DIRYLG
Sbjct: 271  AGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLACSLFKIAQDIRYLG 330

Query: 985  SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELN 1164
            SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVC+QVMGN++ ITFAG+ GQFELN
Sbjct: 331  SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHSTITFAGSQGQFELN 390

Query: 1165 VFKPVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHESLMLVTALNPKIGYD 1344
            V+KP++ISNLLSS+RLL DASYSFRVHC+DG+KAN + I++ L++SLMLVTALNP IGYD
Sbjct: 391  VYKPLLISNLLSSIRLLTDASYSFRVHCIDGLKANRENITENLNKSLMLVTALNPYIGYD 450

Query: 1345 AASKVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGPKE 1479
             ASK+AKNAH K ITLKESAL+LG+L E++F EWVIPEKMIGPK+
Sbjct: 451  NASKIAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKMIGPKQ 495

>NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {ON}
            Anc_6.13 YPL262W
          Length = 475

 Score =  738 bits (1904), Expect = 0.0
 Identities = 355/464 (76%), Positives = 420/464 (90%)
 Frame = +1

Query: 85   QQKYRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEAVVRAFGVLKKSAAIV 264
            +  +R+ETD+FGEIKVP++KYWGAQTQRSF+NFKIGG RE++P  +++AFG+LKKSAAIV
Sbjct: 11   ESSFRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAAIV 70

Query: 265  NESLGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEII 444
            N+SLGTLDP I+ PI KA+DEVIQGKL DHFPLVVFQTGSGTQ+NMNANEVISNRA E+I
Sbjct: 71   NQSLGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELI 130

Query: 445  GGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFS 624
            G E GSK++HPNNH NQ+QSSNDTFPSVMHIAAV E+ ++L+P+LT L++S   K+ E++
Sbjct: 131  GAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYA 190

Query: 625  SIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNTK 804
            +IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGI R++ SL+HLKFLAQGGTAVGTGLNTK
Sbjct: 191  NIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTK 250

Query: 805  VGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLG 984
            VGF + IA++VSKETGIDF+TAPNKFEALAAHDA+V  S A+ T+A SLFKIA DIRYLG
Sbjct: 251  VGFDKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLG 310

Query: 985  SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELN 1164
            SGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQV +Q+MGNN  I  AG+ GQFELN
Sbjct: 311  SGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFELN 370

Query: 1165 VFKPVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHESLMLVTALNPKIGYD 1344
            V+KP+MI+NLL+S+RL++DA +SF++HCVDG+KAN D+I++ LH+SLMLVTALNPKIGYD
Sbjct: 371  VYKPLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIGYD 430

Query: 1345 AASKVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGPK 1476
            AASK+AKNAH K ITLKESAL+LG+L E+EFD+WVIPE MIGPK
Sbjct: 431  AASKLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGPK 474

>TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.13
            YPL262W
          Length = 465

 Score =  713 bits (1840), Expect = 0.0
 Identities = 344/461 (74%), Positives = 406/461 (88%)
 Frame = +1

Query: 97   RIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEAVVRAFGVLKKSAAIVNESL 276
            RIE D FGE++VPA+KYWGAQTQR+  NF IGG RERMPE ++ A+G+LKKS AIVNESL
Sbjct: 5    RIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNESL 64

Query: 277  GTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEIIGGEK 456
            GTLDP+ISK IQ+AADEV +G L +HFPLVVFQTGSGTQ+NMN NEVISNRAIEI+GG+ 
Sbjct: 65   GTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQL 124

Query: 457  GSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFSSIVK 636
            GSK VHPNNH NQ+QS+ND+FP+ MHI+AV E+   LLPEL  LRD+ + KS EF+ IVK
Sbjct: 125  GSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKIVK 184

Query: 637  IGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNTKVGFA 816
            IGRTHLQDATPLTLGQEFSGYVQQ+ NGI RV+ SL +LKF+AQGGTAVGTG+NTK  F 
Sbjct: 185  IGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFD 244

Query: 817  EKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPR 996
              +A+Q+S ETGI+FKTAPNKFEALA+HDA+VECSGALNTLACSLFKI+ DIR+LGSGPR
Sbjct: 245  ILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPR 304

Query: 997  CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKP 1176
            CGYGELSLPENEPGSSIMPGKVNPTQNEAM Q C+QVMGNN+AITFAGASGQFELN +KP
Sbjct: 305  CGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTYKP 364

Query: 1177 VMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHESLMLVTALNPKIGYDAASK 1356
            +MISNLL+S+RLL D+  SFR+HC+ GI+ANED+I+KLL+ESLMLVTALNPKIGYDAA+ 
Sbjct: 365  LMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAATA 424

Query: 1357 VAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGPKE 1479
            +AK+AHK G+TLKE+AL+  +L  ++FDEW++PE M+ P E
Sbjct: 425  IAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHPSE 465

>TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6.13
            YPL262W
          Length = 500

 Score =  705 bits (1820), Expect = 0.0
 Identities = 343/462 (74%), Positives = 400/462 (86%)
 Frame = +1

Query: 88   QKYRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEAVVRAFGVLKKSAAIVN 267
            Q  R ETD+FGEI+VPA+KYWGAQTQRSF NFKIGG RERMPE ++RAFG  KK+AAIVN
Sbjct: 38   QGTRTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERERMPEPIIRAFGQQKKAAAIVN 97

Query: 268  ESLGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEIIG 447
             SLGTLD  +   I +AA+EV QG L +HFPLVVFQTGSGTQSNMNANEVISNRAIE++G
Sbjct: 98   NSLGTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELLG 157

Query: 448  GEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFSS 627
            G  GSKQVHPNNH NQ+QSSNDTFP+VMHIAA+TEIT++LLP L  LR++   K+ EF  
Sbjct: 158  GTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIVLRETLDSKAKEFEK 217

Query: 628  IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNTKV 807
            I+KIGRTHLQDATPLTLGQEFSGY QQLTN I R+E++L  L+++AQGGTAVGTGLNTK+
Sbjct: 218  IIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLNTKI 277

Query: 808  GFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGS 987
            GFAE+ A Q+S +T + F T+PNKFE+LAAHDA+V    +LNTLACSLFKI+ DIRYL S
Sbjct: 278  GFAEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLACSLFKISQDIRYLAS 337

Query: 988  GPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNV 1167
            GPRCGYGELS+PENEPGSSIMPGKVNPTQNEAM Q CVQVMGNN+ I+FAGASGQFELN 
Sbjct: 338  GPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNT 397

Query: 1168 FKPVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHESLMLVTALNPKIGYDA 1347
            +KP+MI+NLLSS RLL+DA +SF +HC  GI+AN+D+I +LLHESLMLVT+LNPKIGYDA
Sbjct: 398  YKPLMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGYDA 457

Query: 1348 ASKVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGP 1473
            ASKVAKNAH KGITLK+SAL+L +L+ K+FDEWV PE M+GP
Sbjct: 458  ASKVAKNAHHKGITLKQSALELDILSSKQFDEWVRPENMLGP 499

>KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {ON}
            highly similar to uniprot|P04076 Saccharomyces cerevisiae
            YHR018C ARG4 Argininosuccinate lyase catalyzes the final
            step in the arginine biosynthesis pathway
          Length = 461

 Score = 48.5 bits (114), Expect = 3e-05
 Identities = 54/209 (25%), Positives = 87/209 (41%), Gaps = 1/209 (0%)
 Frame = +1

Query: 499  QSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTL 678
            +S ND   + M I     +  ++LP L++L     ++++E   ++  G THLQ A P+  
Sbjct: 111  RSRNDQVATDMRIYCRDILNGTVLPALSSLIKVILQRAEEEIDVLMPGYTHLQRAQPIRW 170

Query: 679  GQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGID 858
                S Y    T    R++Q +  L     G  A+        G    I ++     G++
Sbjct: 171  AHWLSCYATYFTEDYKRLQQIVERLNVSPLGAGAL-------AGHPYGI-DREFLAAGLN 222

Query: 859  FK-TAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEP 1035
            F     N   A+A  D VVE     +     + + A D+  + S    G+ +LS      
Sbjct: 223  FNGVIGNSLTAVADRDFVVEIMFWGSLFMNHISRFAEDL-IIYSTAEFGFIQLS-DAYST 280

Query: 1036 GSSIMPGKVNPTQNEAMTQVCVQVMGNNA 1122
            GSS+MP K NP   E +     +V G  A
Sbjct: 281  GSSLMPQKKNPDSLELLRGKSGRVFGQLA 309

>Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}
            YHR018C (REAL)
          Length = 463

 Score = 48.1 bits (113), Expect = 4e-05
 Identities = 64/238 (26%), Positives = 94/238 (39%), Gaps = 1/238 (0%)
 Frame = +1

Query: 406  ANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 585
            ANE    R  EIIG +   K VH        +S ND   + + I     +  +L P L  
Sbjct: 91   ANE---RRLGEIIGRDIAGK-VHTG------RSRNDQVVTDLRIYCRDVVNDNLFPALKG 140

Query: 586  LRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLA 765
            L D   K++    +I+  G THLQ A P+      S Y    T    R++Q LH L    
Sbjct: 141  LVDVLIKRAKGEINILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLDQILHRLNQSP 200

Query: 766  QGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTA-PNKFEALAAHDAVVECSGALNTLA 942
             G  A+        G    I  +   E G+ F +   N   A++  D +VE         
Sbjct: 201  LGAGAL-------AGHPYGIDREFLAE-GLGFNSVIGNSMVAVSDRDFIVELMFWGTLFM 252

Query: 943  CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 1116
              + + A D+  +      G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 253  NHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {ON}
            YHR018C (REAL)
          Length = 463

 Score = 47.8 bits (112), Expect = 5e-05
 Identities = 63/238 (26%), Positives = 93/238 (39%), Gaps = 1/238 (0%)
 Frame = +1

Query: 406  ANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 585
            ANE    R  E+IG +   K VH        +S ND   + + I     +  SL P +  
Sbjct: 91   ANE---RRLGELIGRDIAGK-VHTG------RSRNDQVVTDLRIYCRDVVNDSLFPAMKG 140

Query: 586  LRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLA 765
            L D   K+++    I+  G THLQ A P+      S Y    T    R+ Q LH L    
Sbjct: 141  LVDVLVKRAEGEMDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLVQILHRLNQSP 200

Query: 766  QGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTA-PNKFEALAAHDAVVECSGALNTLA 942
             G  A+        G    I  +   E G+ F +   N   A++  D +VE         
Sbjct: 201  LGAGAL-------AGHPYGIDREFLAE-GLGFNSVIGNSLVAVSDRDFIVELMFWGTLFM 252

Query: 943  CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 1116
              + + A D+  +      G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 253  NHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}
            YHR018C (REAL)
          Length = 463

 Score = 46.2 bits (108), Expect = 1e-04
 Identities = 63/238 (26%), Positives = 93/238 (39%), Gaps = 1/238 (0%)
 Frame = +1

Query: 406  ANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 585
            ANE    R  E+IG +   K VH        +S ND   + + I     +  +L P L  
Sbjct: 91   ANE---RRLGELIGRDIAGK-VHTG------RSRNDQVVTDLRIYCRDVVNGTLFPALKG 140

Query: 586  LRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLA 765
            L D   K+++    I+  G THLQ A P+      S Y    T    R+ Q LH L    
Sbjct: 141  LVDVLIKRAEGEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLNQSP 200

Query: 766  QGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTA-PNKFEALAAHDAVVECSGALNTLA 942
             G  A+        G    I  +   E G+ F +   N   A++  D +VE         
Sbjct: 201  LGAGAL-------AGHPYGIDREFLAE-GLGFNSVIGNSLVAVSDRDFIVELMFWGTLFM 252

Query: 943  CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 1116
              + + A D+  +      G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 253  NHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {ON}
            highly similar to uniprot|P04076 Saccharomyces cerevisiae
            YHR018C ARG4 Argininosuccinate lyase catalyzes the final
            step in the arginine biosynthesis pathway
          Length = 464

 Score = 45.4 bits (106), Expect = 3e-04
 Identities = 64/238 (26%), Positives = 90/238 (37%), Gaps = 2/238 (0%)
 Frame = +1

Query: 406  ANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 585
            ANE    R  EIIG E   K VH        +S ND   + M I     +   LLP L A
Sbjct: 92   ANE---RRLGEIIGREISGK-VHTG------RSRNDQVATDMRIYCRDILNEVLLPALQA 141

Query: 586  LRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLA 765
                   ++ E   ++  G THLQ A P+      S Y    T    R++Q +  L    
Sbjct: 142  FIKVLTTRAKEEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYNRLKQIVERLNKSP 201

Query: 766  QG-GTAVGTGLNTKVGFAEKIAEQVSKETGIDFK-TAPNKFEALAAHDAVVECSGALNTL 939
             G G   G        F  +         G+ F+    N   A++  D VVE        
Sbjct: 202  LGAGALAGHPYGIDREFLAR---------GLGFQGVIGNSLTAVSDRDFVVEIMFWGTLF 252

Query: 940  ACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 1113
               + + + D+  + S    G+ +LS      GSS+MP K NP   E +     +V G
Sbjct: 253  MNHISRFSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNPDSLELLRGKAGRVFG 308

>ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly
            similar to uniprot|P04076 Saccharomyces cerevisiae
            YHR018C ARG4 Argininosuccinate lyase catalyzes the final
            step in the arginine biosynthesis pathway
          Length = 462

 Score = 45.1 bits (105), Expect = 3e-04
 Identities = 64/240 (26%), Positives = 93/240 (38%), Gaps = 1/240 (0%)
 Frame = +1

Query: 406  ANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 585
            ANE    R  EIIG +   K VH        +S ND   + M I     +   LLP L  
Sbjct: 91   ANE---RRLGEIIGRDIAGK-VHTG------RSRNDQVVTDMRIFCRDTVNEKLLPGLKE 140

Query: 586  LRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLA 765
            L     K++++    +  G THLQ A P+      S Y    T  + R+ Q L       
Sbjct: 141  LVSVMVKRAEKEIGYLMPGYTHLQRAQPIRWSHWLSSYATYFTEDLKRLRQLLERFN--- 197

Query: 766  QGGTAVGTGLNTKVGF-AEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLA 942
            Q     G       G   E +AE++  +  I      N   A++  D VVE         
Sbjct: 198  QSPLGAGALAGHPYGIDREFLAEELGFQGVIG-----NSLVAVSDRDFVVELMFWGTLFM 252

Query: 943  CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNA 1122
              + + A D+  + S    G+ +L+      GSS+MP K N    E +     +V G+ A
Sbjct: 253  NHISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGDLA 310

>YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}
            ADE13Adenylosuccinate lyase, catalyzes two steps in the
            'de novo' purine nucleotide biosynthetic pathway;
            expression is repressed by adenine and activated by Bas1p
            and Pho2p; mutations in human ortholog ADSL cause
            adenylosuccinase deficiency
          Length = 482

 Score = 44.7 bits (104), Expect = 5e-04
 Identities = 69/314 (21%), Positives = 134/314 (42%), Gaps = 17/314 (5%)
 Frame = +1

Query: 565  LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 744
            ++P+L  + +   K + E+  +  +G TH Q A   TLG+  + ++Q+L   +   E++ 
Sbjct: 128  IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 745  HHLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 900
            + +      GT        A+  G + KV   E + E+V++  G D K  P   +   + 
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDERVTELLGFD-KVYPVTGQTY-SR 242

Query: 901  DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1080
               ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243  KIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 1081 AMTQVCVQVMGNNAAITFAGASGQ-FELNVFKPVMISNLLSSVRLLADASYSFRVHCVDG 1257
             +  +  + +G+  +     AS Q FE  +    +    L S  L AD   S  ++   G
Sbjct: 300  RVCSL-ARHLGSLFSDAVQTASVQWFERTLDDSAIRRISLPSAFLTADILLSTLLNISSG 358

Query: 1258 I----KANEDRISK----LLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQL 1413
            +    K  E RI      +  E++++          +   ++   +H+    +KE   + 
Sbjct: 359  LVVYPKVIERRIKGELPFMATENIIMAMVEKNASRQEVHERIRVLSHQAAAVVKEEGGEN 418

Query: 1414 GVLNEKEFDEWVIP 1455
             ++   + DE+  P
Sbjct: 419  DLIERVKRDEFFKP 432

>KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.354
            YHR018C
          Length = 462

 Score = 44.3 bits (103), Expect = 6e-04
 Identities = 65/240 (27%), Positives = 92/240 (38%), Gaps = 1/240 (0%)
 Frame = +1

Query: 406  ANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 585
            ANE    R  EIIG     K VH        +S ND   + M I     +   LLP +  
Sbjct: 91   ANE---RRLGEIIGRHIAGK-VHTG------RSRNDQVVTDMRIYCRDILNEKLLPFMAD 140

Query: 586  LRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLA 765
            L     K+++     +  G THLQ A P+      S Y    T    R++Q L  L    
Sbjct: 141  LIKVLVKRAENEIDTLMPGYTHLQRAQPIRWAHWLSSYATYFTEDYKRLKQILERLNVSP 200

Query: 766  QGGTAVGTGLNTKVGFAEKIAEQVSKETGIDF-KTAPNKFEALAAHDAVVECSGALNTLA 942
             G  A+        G    I  +   E G++F     N   A++  D VVE         
Sbjct: 201  LGAGAL-------AGHPYGIDREFLAE-GLNFGGVIGNSLVAVSDRDFVVELMFWGTLFM 252

Query: 943  CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNA 1122
              + + A D+  + S    G+ +LS      GSS+MP K N    E +     +V G+ A
Sbjct: 253  NHISRFAEDL-IIYSTAEFGFVKLS-DSYSTGSSLMPQKKNADSLELLRGKSGRVFGDLA 310

>YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}
            ARG4Argininosuccinate lyase, catalyzes the final step in
            the arginine biosynthesis pathway
          Length = 463

 Score = 44.3 bits (103), Expect = 6e-04
 Identities = 61/238 (25%), Positives = 93/238 (39%), Gaps = 1/238 (0%)
 Frame = +1

Query: 406  ANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 585
            ANE    R  E+IG +   K VH        +S ND   + + I     +  +L P L  
Sbjct: 91   ANE---RRLGELIGRDIAGK-VHTG------RSRNDQVVTDLRIYCRDIVNDTLFPALKG 140

Query: 586  LRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLA 765
            L +   K+++    ++  G THLQ A P+      S Y    T    R+ Q LH L    
Sbjct: 141  LVEVLIKRAEGEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLNQSP 200

Query: 766  QGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTA-PNKFEALAAHDAVVECSGALNTLA 942
             G  A+        G    I  +   E G+ F +   N   A++  D +VE         
Sbjct: 201  LGAGAL-------AGHPYGIDREFLAE-GLGFNSVIGNSLVAVSDRDFIVELMFWGTLFM 252

Query: 943  CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 1116
              + + A D+  +      G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 253  NHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359W
            (REAL)
          Length = 482

 Score = 44.3 bits (103), Expect = 6e-04
 Identities = 69/314 (21%), Positives = 133/314 (42%), Gaps = 17/314 (5%)
 Frame = +1

Query: 565  LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 744
            ++P+L  + +   K + E+  +  +G TH Q A   TLG+  + ++Q+L   +   E++ 
Sbjct: 128  IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 745  HHLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 900
            + +      GT        A+  G + KV   E + E+V++  G D K  P   +   + 
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDERVTELLGFD-KVYPVTGQTY-SR 242

Query: 901  DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1080
               ++    L++ A +  K+A DIR L +       E    + + GSS M  K NP + E
Sbjct: 243  KIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNPMRCE 299

Query: 1081 AMTQVCVQVMGNNAAITFAGASGQ-FELNVFKPVMISNLLSSVRLLADASYSFRVHCVDG 1257
             +  +  + +G+  +     AS Q FE  +    +    L S  L AD   S  ++   G
Sbjct: 300  RVCSL-ARHLGSLFSDAVQTASVQWFERTLDDSAIRRISLPSAFLTADILLSTLLNISSG 358

Query: 1258 I----KANEDRISK----LLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQL 1413
            +    K  E RI      +  E++++          +   ++   +H+    +KE   + 
Sbjct: 359  LVVYPKVIERRIKGELPFMATENIIMAMVEKNASRQEVHERIRVLSHQAAAVVKEEGGEN 418

Query: 1414 GVLNEKEFDEWVIP 1455
             ++   + DE+  P
Sbjct: 419  DLIERVKNDEFFKP 432

>Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa] {ON}
            complement(330965..332347) [1383 nt, 461 aa]
          Length = 460

 Score = 43.9 bits (102), Expect = 8e-04
 Identities = 65/238 (27%), Positives = 91/238 (38%), Gaps = 1/238 (0%)
 Frame = +1

Query: 406  ANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 585
            ANE    R  E+IG +   K VH        +S ND   + + I     I   LLP L +
Sbjct: 89   ANE---RRLGELIGTDISGK-VHTG------RSRNDQCVTDLRIYCRDIIQDKLLPSLKS 138

Query: 586  LRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLA 765
            L     K+ +    I+  G THLQ A P+      S Y    T    R++Q L  L    
Sbjct: 139  LIQVLVKRGEGEIGILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQLLDRLNVSP 198

Query: 766  QGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFK-TAPNKFEALAAHDAVVECSGALNTLA 942
             G  A+        G    I ++     G+ F     N   A++  D VVE         
Sbjct: 199  LGAGAL-------AGHPYGI-DREFLANGLGFNGVIGNSLVAVSDRDFVVELLFWGTLFM 250

Query: 943  CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 1116
              + + A D+  + S    G+  LS      GSS+MP K N    E +     +V GN
Sbjct: 251  NHISRFAEDL-IIYSTAEFGFITLS-DAYSTGSSLMPQKKNSDSLELLRGKSGRVFGN 306

>Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359W
            (REAL)
          Length = 482

 Score = 43.9 bits (102), Expect = 8e-04
 Identities = 69/314 (21%), Positives = 134/314 (42%), Gaps = 17/314 (5%)
 Frame = +1

Query: 565  LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 744
            ++P+L  + +   K + E+  +  +G TH Q A   TLG+  + ++Q+L   +   E++ 
Sbjct: 128  IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFERAR 187

Query: 745  HHLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 900
            + +      GT        A+  G + KV   E + E+V++  G D K  P   +   + 
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDERVTELLGFD-KVYPVTGQTY-SR 242

Query: 901  DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1080
               ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243  KIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 1081 AMTQVCVQVMGNNAAITFAGASGQ-FELNVFKPVMISNLLSSVRLLADASYSFRVHCVDG 1257
             +  +  + +G+    T   AS Q FE  +    +    L S  L AD   S  ++   G
Sbjct: 300  RVCSL-ARHLGSLFNDTVQTASVQWFERTLDDSAIRRISLPSAFLTADILLSTLLNISSG 358

Query: 1258 I----KANEDRISK----LLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQL 1413
            +    K  E RI      +  E++++          +   ++   +H+    +KE   + 
Sbjct: 359  LVVYPKVIERRIKGELPFMATENIIMAMVEKNASRQEVHERIRVLSHQAAAVVKEEGGEN 418

Query: 1414 GVLNEKEFDEWVIP 1455
             ++   + D++  P
Sbjct: 419  DLIERVKKDKFFQP 432

>TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.354
            YHR018C
          Length = 466

 Score = 43.5 bits (101), Expect = 0.001
 Identities = 60/237 (25%), Positives = 90/237 (37%), Gaps = 1/237 (0%)
 Frame = +1

Query: 406  ANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 585
            ANE    R  EIIG        H     +  +S ND   + + I     +   LLP +  
Sbjct: 91   ANE---RRLGEIIG-------THIAGKVHTGRSRNDQCVTDLRIYCRDILVEKLLPFMID 140

Query: 586  LRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLA 765
            L     K+++    I+  G THLQ A P+      S Y    T    R++Q L  L    
Sbjct: 141  LVQVITKRAENEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQVLERLNKCP 200

Query: 766  QGGTAVGTGLNTKVGFAEKIAEQ-VSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLA 942
             G  A+        G    I  Q +S E G +     N   A++  D +V+         
Sbjct: 201  LGAGAI-------AGHPYGIDRQYLSDELGFN-SIIGNSLVAVSDRDFIVDIMFWSTLFM 252

Query: 943  CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 1113
              + + + D+  + S    G+ +LS      GSS+MP K N    E +     +V G
Sbjct: 253  NHISRFSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFG 307

>TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.354
            YHR018C
          Length = 465

 Score = 43.1 bits (100), Expect = 0.001
 Identities = 62/239 (25%), Positives = 90/239 (37%)
 Frame = +1

Query: 406  ANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 585
            ANE    R  EIIG     K VH        +S ND   + + I     +   L P+L A
Sbjct: 91   ANE---RRLGEIIGRNIAGK-VHTG------RSRNDQCVTDLRIYCRDLLNDKLFPDLQA 140

Query: 586  LRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLA 765
            L D   K+  E   ++  G THLQ A P+      S Y    T    R+ Q +  +    
Sbjct: 141  LVDVMIKRGKEEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDFKRLRQIMDRIN--- 197

Query: 766  QGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLAC 945
            Q     G       G      E ++   G D     N   A++  D +VE          
Sbjct: 198  QSPLGAGALAGHPYGIDR---EFLAAGLGFD-GVIGNSLVAVSDRDFIVELMFWGTLFMN 253

Query: 946  SLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNA 1122
             + + A D+  + S    G+ +L+      GSS+MP K N    E +     +V G+ A
Sbjct: 254  HISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGDLA 310

>CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {ON}
            highly similar to uniprot|Q05911 Saccharomyces cerevisiae
            YLR359w ADE13
          Length = 482

 Score = 42.7 bits (99), Expect = 0.002
 Identities = 45/180 (25%), Positives = 82/180 (45%), Gaps = 8/180 (4%)
 Frame = +1

Query: 565  LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 744
            ++P+L  + +   K + E+  +  +G TH Q A   TLG+  + ++Q+L   +   E++ 
Sbjct: 128  VIPKLVNVINRLAKFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 745  HHLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 900
            + +      GT        A+  G + KV   E++ E+V++  G D  T         + 
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGNHDKV---EELDERVTELLGFD--TVYPVTGQTYSR 242

Query: 901  DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1080
               ++    L++ A S  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243  KIDIDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

>Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359W
            (REAL)
          Length = 482

 Score = 42.4 bits (98), Expect = 0.002
 Identities = 68/314 (21%), Positives = 133/314 (42%), Gaps = 17/314 (5%)
 Frame = +1

Query: 565  LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 744
            ++P+L  + +   K + E+  +  +G TH Q A   TLG+  + ++Q+L   +   E++ 
Sbjct: 128  IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 745  HHLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 900
            + +      GT        A+  G + KV   E +  +V++  G D K  P   +   + 
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDARVTELLGFD-KVYPVTGQTY-SR 242

Query: 901  DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1080
               ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243  KIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 1081 AMTQVCVQVMGNNAAITFAGASGQ-FELNVFKPVMISNLLSSVRLLADASYSFRVHCVDG 1257
             +  +  + +G+  +     AS Q FE  +    +    L S  L AD   S  ++   G
Sbjct: 300  RVCSL-ARHLGSLFSDAVQTASVQWFERTLDDSAIRRISLPSAFLTADILLSTLLNISSG 358

Query: 1258 I----KANEDRISK----LLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQL 1413
            +    K  E RI      +  E++++          +   ++   +H+    +KE   + 
Sbjct: 359  LVVYPKVIERRIKGELPFMATENIIMAMVEKNASRQEVHERIRVLSHQAAAVVKEEGGEN 418

Query: 1414 GVLNEKEFDEWVIP 1455
             ++   + DE+  P
Sbjct: 419  DLIERVKKDEFFKP 432

>Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {ON}
            similar to Ashbya gossypii AEL019W
          Length = 470

 Score = 42.0 bits (97), Expect = 0.003
 Identities = 69/286 (24%), Positives = 106/286 (37%), Gaps = 6/286 (2%)
 Frame = +1

Query: 274  LGTLDPE----ISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEI 441
            +G LD E    I K + +   E   GK  +H            +    ANE    R  E+
Sbjct: 52   IGLLDVEELSLIHKGLLEIESEWSSGKFEEH---------PDDEDIHTANE---RRLGEL 99

Query: 442  IGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEF 621
            IG     K VH        +S ND   + M I     +   +LP +++       ++ E 
Sbjct: 100  IGTAVAGK-VHTG------RSRNDQVATDMRIYCREILNEKILPAVSSFIRVLINRAREE 152

Query: 622  SSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNT 801
              ++  G THLQ A P+      S Y    T    R+ Q +  L    Q     G     
Sbjct: 153  VDVLMPGYTHLQRAQPIRWSHWLSCYATYFTEDYNRLRQVVERLN---QSPLGAGALAGH 209

Query: 802  KVGFAEK-IAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRY 978
              G   K +AEQ+     I      N   A++  D V+E     +     + + A D+  
Sbjct: 210  PYGIDRKYLAEQLGFNGIIG-----NSLVAVSDRDFVIEIMFWGSLFMNHISRFAEDLII 264

Query: 979  LGSGPRCGYGELSLPE-NEPGSSIMPGKVNPTQNEAMTQVCVQVMG 1113
              +     +G ++L +    GSS+MP K NP   E +     +V G
Sbjct: 265  YSTAE---FGFINLADAYSTGSSLMPQKKNPDSLELLRGKSGRVFG 307

>NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4.197
            YLR359W
          Length = 482

 Score = 42.0 bits (97), Expect = 0.003
 Identities = 68/314 (21%), Positives = 129/314 (41%), Gaps = 17/314 (5%)
 Frame = +1

Query: 565  LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 744
            ++P+L  + D   K + E+  +  +G TH Q A   TLG+  + ++Q+L   +    ++ 
Sbjct: 128  VIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRAR 187

Query: 745  HHLKFLAQGGTAVGTGLNTKVGF------AEKIAEQVSKETGIDFKTAPNKFEALAAHDA 906
            + +      GT  GT  +    F       E + ++V++  G D  T         +   
Sbjct: 188  NDIGLRGVKGT-TGTQASFLALFHGDHDKVEALDKRVTELLGFD--TVYPVTGQTYSRKI 244

Query: 907  VVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLP--ENEPGSSIMPGKVNPTQNE 1080
             ++    L++ A +  K+A DIR L +       EL  P  +++ GSS M  K NP + E
Sbjct: 245  DIDVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 1081 AMTQVCVQVMGNNAAITFAGASGQ-FELNVFKPVMISNLLSSVRLLADASYSFRVHCVDG 1257
             +  +  + +G+  +     AS Q FE  +    +    L S  L  D   S  ++   G
Sbjct: 300  RVCSL-ARHLGSLFSDAVQTASVQWFERTLDDSAIRRISLPSAFLTTDILLSTLLNISSG 358

Query: 1258 I----KANEDRISK----LLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQL 1413
            +    K  E RI      +  E++++          D   ++   +H+    +KE     
Sbjct: 359  LVVYPKVIERRIKSELPFMATENIIMAMVEKKASRQDVHERIRVLSHQAAAVVKEQGGDN 418

Query: 1414 GVLNEKEFDEWVIP 1455
             ++   + DE+  P
Sbjct: 419  DLIERIQKDEYFKP 432

>NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4.197
            YLR359W
          Length = 482

 Score = 42.0 bits (97), Expect = 0.003
 Identities = 67/312 (21%), Positives = 127/312 (40%), Gaps = 15/312 (4%)
 Frame = +1

Query: 565  LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 744
            ++P+L  + D   K + E+  +  +G TH Q A   TLG+  + ++Q+L   +    ++ 
Sbjct: 128  IIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 745  HHLKFLAQGGTAVGTGLNTKVGF------AEKIAEQVSKETGIDFKTAPNKFEALAAHDA 906
            + +      GT  GT  +    F       E + ++V++  G D  T         +   
Sbjct: 188  NDIGLRGVKGT-TGTQASFLALFHGDHDKVEALDKRVTELLGFD--TVYPVTGQTYSRKI 244

Query: 907  VVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAM 1086
             ++    L + A +  K+A DIR L +       E    +++ GSS M  K NP + E +
Sbjct: 245  DIDVLAPLASFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPMRCERV 301

Query: 1087 TQVCVQVMGNNAAITFAGASGQ-FELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGI- 1260
              +  + +G+  +     AS Q FE  +    +    L S  L AD   S  ++   G+ 
Sbjct: 302  CSL-ARHLGSLFSDAVQTASVQWFERTLDDSAIRRISLPSAFLTADILLSTLLNISSGLV 360

Query: 1261 ---KANEDRISK----LLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGV 1419
               K  E RI      +  E++++          D   ++   +H+    +KE      +
Sbjct: 361  VYPKVIERRIKSELPFMATENIIMAMVEKNASRQDVHEQIRVLSHQAAAVVKEQGGDNDL 420

Query: 1420 LNEKEFDEWVIP 1455
            +   + DE+  P
Sbjct: 421  IQRIQADEFFKP 432

>TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {ON}
            Anc_4.197 YLR359W
          Length = 482

 Score = 41.6 bits (96), Expect = 0.004
 Identities = 45/180 (25%), Positives = 80/180 (44%), Gaps = 8/180 (4%)
 Frame = +1

Query: 565  LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 744
            ++P+L  + D   K + E+  +  +G TH Q A   TLG+  + ++Q+L   +    ++ 
Sbjct: 128  IIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRSTLWIQELLWDLRNFVRAR 187

Query: 745  HHLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 900
            + L      GT        A+  G + KV   E++ E+V++  G D  T         + 
Sbjct: 188  NDLGLRGVKGTTGTQASFLALFHGNHDKV---EELDERVTELLGFD--TVYPVTGQTYSR 242

Query: 901  DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1080
               ++    L + A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243  KIDIDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

>TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.354
            YHR018C
          Length = 463

 Score = 41.2 bits (95), Expect = 0.005
 Identities = 58/233 (24%), Positives = 89/233 (38%), Gaps = 1/233 (0%)
 Frame = +1

Query: 421  SNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSF 600
            + R +  I G K S +VH        +S ND   + + I     ++  LL  L  L +  
Sbjct: 92   NERRLGEIIGTKISGKVHTG------RSRNDQCVTDLRIYCREYLSDKLLKNLETLINVL 145

Query: 601  QKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTA 780
              +++E    +  G THLQ A P+      S Y         R+ Q    L     G  A
Sbjct: 146  INRAEEEIEFIMPGYTHLQRAQPIRWSHWLSSYATYFLEDYKRLVQLKERLNKSPLGAGA 205

Query: 781  VGTGLNTKVGFAEKI-AEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFK 957
            +        G    I  E ++++ G D     N   A++  D VVE           + +
Sbjct: 206  LA-------GHPYGIDREYLAEKLGFD-SVIGNSLVAVSDRDFVVEILFWSTLFMNHISR 257

Query: 958  IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 1116
             A D+  + S    G+ +LS      GSS+MP K N    E +     +V GN
Sbjct: 258  FAEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGN 308

>Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359W
            (ADE13) - Adenylosuccinate Lyase [contig 198] FULL
          Length = 482

 Score = 40.4 bits (93), Expect = 0.010
 Identities = 65/311 (20%), Positives = 125/311 (40%), Gaps = 14/311 (4%)
 Frame = +1

Query: 565  LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 744
            L+P+L  + D   K + E+  +  +G TH Q A   TLG+  + ++Q+L   +    ++ 
Sbjct: 128  LIPKLVNVIDRLSKFAMEWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 745  HHLKFLAQGGTAVGTG-----LNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAV 909
            + +      GT    G      ++     E + ++V++  G D  T         +    
Sbjct: 188  NDIGLRGVKGTTGTQGSFLALFHSDHDKVEALDKRVTELLGFD--TVYPVTGQTYSRKID 245

Query: 910  VECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMT 1089
            ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E + 
Sbjct: 246  IDVLAPLSSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPMRCERVC 302

Query: 1090 QVCVQVMGNNAAITFAGASGQ-FELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIKA 1266
             +  + +G+  +     AS Q FE  +    +    L S  L AD   S  ++   G+  
Sbjct: 303  SL-ARHLGSLFSDAVQTASVQWFERTLDDSAIRRISLPSAFLTADILLSTLLNISSGLVV 361

Query: 1267 NEDRISKLLHESLMLVTALN---PKIGYDAASKVAKNA-----HKKGITLKESALQLGVL 1422
                I + +   L  +   N     +G  A+ +    A     H+    +KE      ++
Sbjct: 362  YPKVIERRIKSELPFMATENFIMAMVGKGASRQEVHEAIRVLSHQAAAVVKEEGGDNDLI 421

Query: 1423 NEKEFDEWVIP 1455
               + D++  P
Sbjct: 422  ERVKTDKFFEP 432

>ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {ON}
            highly similar to uniprot|Q05911 Saccharomyces cerevisiae
            YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
            in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 40.0 bits (92), Expect = 0.013
 Identities = 63/290 (21%), Positives = 117/290 (40%), Gaps = 10/290 (3%)
 Frame = +1

Query: 565  LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 744
            ++P+L  + D   K +  +  +  +G TH Q A   TLG+  + ++Q L   +   +++ 
Sbjct: 128  IIPKLINVIDRLSKFALNYKDVPVLGWTHFQPAQLTTLGKRVTLWIQDLLWDLRNFDRAR 187

Query: 745  HHLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 900
            + +      GT        A+  G + KV   E++ ++V++  G  F+T         + 
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGNHDKV---EELDQRVTELLG--FETVYPVTGQTYSR 242

Query: 901  DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1080
               ++    L + A +  K+A DIR L +       E    + + GSS M  K NP + E
Sbjct: 243  KIDIDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNPMRCE 299

Query: 1081 AMTQVCVQVMGN--NAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVD 1254
             +  +  + MG+  N A+  A     FE  +    +    L S  L AD   S  ++   
Sbjct: 300  RVCSL-ARHMGSLFNDAVQTASVQ-WFERTLDDSAIRRISLPSAFLTADILLSTLLNISS 357

Query: 1255 GIKANEDRISKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESA 1404
            G+      I + ++  L  +   N  +         +  H+K   L   A
Sbjct: 358  GMVVYPKVIERRINSELPFMATENIIMAMVEKGASRQEVHEKIRVLSHQA 407

>AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YHR018C (ARG4)
          Length = 469

 Score = 39.7 bits (91), Expect = 0.017
 Identities = 50/217 (23%), Positives = 82/217 (37%)
 Frame = +1

Query: 472  HPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFSSIVKIGRTH 651
            H +   +  +S ND   + M +     +   + P L  L      ++ E   ++  G TH
Sbjct: 103  HISGKVHTGRSRNDQVATDMRLYCREMLQDKVEPALFELIKVLLHRAREEIDVLMPGYTH 162

Query: 652  LQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAE 831
            LQ A P+      S Y         R+++ +  L    Q     G       G      E
Sbjct: 163  LQRAQPIRWSHWLSCYATYFVEDFKRLKEVIARLN---QSPLGAGALAGHPYGIDR---E 216

Query: 832  QVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGE 1011
             ++ E G D     N   A++  D VVE     +     + ++A D+  + S    G+ +
Sbjct: 217  YLACELGFD-GVIGNSMTAVSDRDFVVEIMSWGSLFMNHISRLAEDL-IIYSTAEFGFVK 274

Query: 1012 LSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNA 1122
            L+      GSS+MP K NP   E +     +V G  A
Sbjct: 275  LA-DAYSTGSSLMPQKRNPDSLELLRGKSGRVFGQLA 310

>Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar to
            Ashbya gossypii ABL006C
          Length = 482

 Score = 39.3 bits (90), Expect = 0.022
 Identities = 45/186 (24%), Positives = 83/186 (44%), Gaps = 14/186 (7%)
 Frame = +1

Query: 565  LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 744
            L+P+L  + +     + ++  +  +G TH Q A   TLG+  + ++Q+L   +    ++ 
Sbjct: 128  LIPKLVNVINRLSTFAIKYKDLPVLGWTHYQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 745  HHLKFLAQGGTAVGTGLNTKVGF------AEKIAEQVSKETGIDF------KTAPNKFEA 888
            + + F    GT  GT  +    F       E + ++V++ +G D       +T   K + 
Sbjct: 188  NDIGFRGVKGT-TGTQASFLALFHGDHDKVEALDKRVAELSGFDIIYPVTGQTYSRKVD- 245

Query: 889  LAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLP--ENEPGSSIMPGKV 1062
                   ++  G L++ A +  K+A DIR L +       EL  P   ++ GSS M  K 
Sbjct: 246  -------IDVLGPLSSFAATSHKLATDIRLLAN-----LKELEEPFEASQIGSSAMAYKR 293

Query: 1063 NPTQNE 1080
            NP + E
Sbjct: 294  NPMRCE 299

>KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa] {ON}
            highly similar to uniprot|Q05911 Saccharomyces cerevisiae
            YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
            in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 38.5 bits (88), Expect = 0.039
 Identities = 44/180 (24%), Positives = 80/180 (44%), Gaps = 8/180 (4%)
 Frame = +1

Query: 565  LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 744
            L+P+L  + +   K + E+  +  +G TH Q A   TLG+  + ++Q+L   +    ++ 
Sbjct: 128  LIPKLVNVINRLSKFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 745  HHLKFLAQGGTAVGTGLNTKVGF------AEKIAEQVSKETGIDFKTAPNKFEALAAHDA 906
            + +      GT  GT  +    F       E + ++V++  G  F T         +   
Sbjct: 188  NDIGLRGVKGT-TGTQASFLTLFHGDHDKVEALDKRVAELLG--FSTVYPVTGQTYSRKI 244

Query: 907  VVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLP--ENEPGSSIMPGKVNPTQNE 1080
             ++    L++ A +  K+A DIR L +       EL  P  +++ GSS M  K NP + E
Sbjct: 245  DIDVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYKRNPMRCE 299

>KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON} Anc_4.197
            YLR359W
          Length = 482

 Score = 38.5 bits (88), Expect = 0.039
 Identities = 42/178 (23%), Positives = 78/178 (43%), Gaps = 6/178 (3%)
 Frame = +1

Query: 565  LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 744
            ++P+L  + D   K + ++  +  +G TH Q A   TLG+  + ++Q+L   +    ++ 
Sbjct: 128  VIPKLVNVIDRLSKFALQYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFVRAR 187

Query: 745  HHLKFLAQGGTAVGTGLNTKVGF------AEKIAEQVSKETGIDFKTAPNKFEALAAHDA 906
            + +      GT  GT  +    F       E + ++V++  G D  T         +   
Sbjct: 188  NDIGLRGVKGT-TGTQASFLALFHGDHDKVEALDKRVTELLGFD--TVYPVTGQTYSRKI 244

Query: 907  VVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1080
             ++    L++ A S  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 245  DIDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

>KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa] {ON}
            Anc_4.197 YLR359W
          Length = 482

 Score = 38.5 bits (88), Expect = 0.039
 Identities = 45/180 (25%), Positives = 79/180 (43%), Gaps = 8/180 (4%)
 Frame = +1

Query: 565  LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 744
            L+P+L  + +   K +     +  +G TH Q A   TLG+  + ++Q+L   +   E++ 
Sbjct: 128  LIPKLVNVINRLCKFAMANKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 745  HHLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 900
            + +      GT        A+  G + KV   EK+ E+V +  G D  T         + 
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGDHNKV---EKLDERVVELLGFD--TVYPVTGQTYSR 242

Query: 901  DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1080
               ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243  KIDIDAFAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

>Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON}
            (40749..42197) [1449 nt, 483 aa]
          Length = 482

 Score = 38.1 bits (87), Expect = 0.052
 Identities = 40/180 (22%), Positives = 77/180 (42%), Gaps = 8/180 (4%)
 Frame = +1

Query: 565  LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 744
            ++P+L  + D   K + E+  +  +G TH Q A   T+G+  + ++Q+L   +    ++ 
Sbjct: 128  IIPKLVNVIDRLAKFASEYKDLPVLGWTHFQPAQLTTMGKRATLWIQELLWDLRNFVRAR 187

Query: 745  HHLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 900
            + +      GT        A+  G + KV   +K   ++     + F T         + 
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGDDDKVEALDKRVVEL-----LGFDTVYPVTGQTYSR 242

Query: 901  DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1080
               ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243  KIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

>TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa] {ON}
            Anc_4.197 YLR359W
          Length = 482

 Score = 37.7 bits (86), Expect = 0.068
 Identities = 58/263 (22%), Positives = 110/263 (41%), Gaps = 9/263 (3%)
 Frame = +1

Query: 565  LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 744
            ++P+L  + +     + E+  +  +G TH Q A   TLG+  + ++Q+L   +   E++ 
Sbjct: 128  VIPKLVNVINRLANFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 745  HHLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 900
            + +      GT        A+  G + KV   E++ E+V +  G D  T         + 
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGNHDKV---EELDERVVELLGFD--TVYPVTGQTYSR 242

Query: 901  DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1080
               ++    L + A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243  KIDIDVVSPLVSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 1081 AMTQVCVQVMGNNAAITFAGASGQ-FELNVFKPVMISNLLSSVRLLADASYSFRVHCVDG 1257
             +  +  + +G+  + T   AS Q FE  +    +    L S  L  D   +  ++   G
Sbjct: 300  RVCSL-ARHLGSLLSDTVQTASVQWFERTLDDSAIRRISLPSAFLTTDILLTTLLNISSG 358

Query: 1258 IKANEDRISKLLHESLMLVTALN 1326
            +      I++ +   L  +   N
Sbjct: 359  LVVYPKVIARRIQSELPFMATEN 381

>Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa] {ON}
            YHR018C (ARG4) - argininosuccinate lyase [contig 260]
            FULL
          Length = 465

 Score = 37.4 bits (85), Expect = 0.088
 Identities = 66/274 (24%), Positives = 104/274 (37%), Gaps = 8/274 (2%)
 Frame = +1

Query: 325  EVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQS 504
            E+I+G+   +     F    G +    ANE    R  EIIG     K VH        +S
Sbjct: 70   EIIRGEWASNS----FVEKDGDEDIHTANE---RRLGEIIGRHIAGK-VHTG------RS 115

Query: 505  SNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQ 684
             ND   + M I    E   +L   L  L  +  ++S++    +  G THLQ A P+    
Sbjct: 116  RNDQVATDMRIYC-REALDNLAKILEDLIGAILQRSEQEIDALMPGYTHLQRAQPIRWSH 174

Query: 685  EFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTG--------LNTKVGFAEKIAEQVS 840
              + Y    T    R++Q    L     G  A+           L  ++GF++ I     
Sbjct: 175  WLNLYATYFTEDFKRLKQIRERLNVSPLGCGALAGHPYGIDREFLAERLGFSDVIG---- 230

Query: 841  KETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSL 1020
                       N  +A++  D VVE     +     + + + D+  + S     + +LS 
Sbjct: 231  -----------NSLQAVSDRDFVVEIMFWCSLFMNHISRFSEDL-IIYSTAEFNFVKLS- 277

Query: 1021 PENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNA 1122
                 GSS+MP K NP   E +     +V G+ A
Sbjct: 278  DAYSTGSSLMPQKKNPDSLELLRGKSGRVFGSLA 311

>Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W
           (REAL)
          Length = 850

 Score = 37.4 bits (85), Expect = 0.10
 Identities = 25/92 (27%), Positives = 43/92 (46%), Gaps = 6/92 (6%)
 Frame = +1

Query: 250 SAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNR 429
           S A+ ++ L   DP  +K + + +D+   G     F L     G G ++  +  E   N+
Sbjct: 641 SKAMRDDELKASDPLQTKELHEMSDKFESGMKKGKFRLSKGFGGKGLENIKSKREEAQNK 700

Query: 430 AIEIIGGEKGSKQVH------PNNHCNQAQSS 507
            +E   G+K + Q+       PN H N+A+SS
Sbjct: 701 ELEHKKGQKNNDQLENKSDHSPNEHANEAESS 732

>KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa] {ON}
            highly similar to uniprot|P04076 Saccharomyces cerevisiae
            YHR018C ARG4 Argininosuccinate lyase catalyzes the final
            step in the arginine biosynthesis pathway
          Length = 465

 Score = 37.0 bits (84), Expect = 0.12
 Identities = 68/270 (25%), Positives = 105/270 (38%), Gaps = 6/270 (2%)
 Frame = +1

Query: 325  EVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQS 504
            E+I+G+   +     F    G +    ANE    R  EIIG     K VH        +S
Sbjct: 70   EIIRGEWASNS----FVEKDGDEDIHTANE---RRLGEIIGRHIAGK-VHTG------RS 115

Query: 505  SNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQ 684
             ND   + M I    E   ++   L  L  +  +++++    +  G THLQ A P+    
Sbjct: 116  RNDQVATDMRIYC-REALDNMAKILKDLVGAILQRAEQEIDALMPGYTHLQRAQPIRWSH 174

Query: 685  EFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKI-AEQVSKETGIDF 861
              + Y    T    R++Q    L     G  A+        G    I  E +++  G D 
Sbjct: 175  WLNLYATYFTEDFKRLKQIRERLNVSPLGCGALA-------GHPYGIDREHIAERLGFD- 226

Query: 862  KTAPNKFEALAAHDAVVECSGALNTLACSLF-----KIANDIRYLGSGPRCGYGELSLPE 1026
                N  +A++  D VVE         CSLF     + + D+  + S     + +LS   
Sbjct: 227  GVIGNSLQAVSDRDFVVEI-----LFWCSLFMNHISRFSEDL-IIYSTAEFNFVKLS-DA 279

Query: 1027 NEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 1116
               GSS+MP K NP   E +     +V G+
Sbjct: 280  YSTGSSLMPQKKNPDSLELLRGKSGRVFGS 309

>SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly
            similar to uniprot|Q05911 Saccharomyces cerevisiae
            YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
            in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 36.6 bits (83), Expect = 0.16
 Identities = 41/178 (23%), Positives = 78/178 (43%), Gaps = 6/178 (3%)
 Frame = +1

Query: 565  LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 744
            L+P+L  + +   + + E+  +  +G TH Q A   TLG+  + ++Q+L   +    ++ 
Sbjct: 128  LIPKLVNVINRLSQFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 745  HHLKFLAQGGTAVGTGLNTKVGF------AEKIAEQVSKETGIDFKTAPNKFEALAAHDA 906
            + +      GT  GT  +    F       E + ++V++  G D  T         +   
Sbjct: 188  NDIGLRGVKGT-TGTQASFLALFHGDHDKVEALDKRVTELLGFD--TVYPVTGQTYSRKI 244

Query: 907  VVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1080
             ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 245  DIDVLAPLSSFAATAHKMATDIRLLANLKEM---EEPFEKSQIGSSAMAYKRNPMRCE 299

>ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR359W
            (ADE13)
          Length = 482

 Score = 35.4 bits (80), Expect = 0.36
 Identities = 41/184 (22%), Positives = 79/184 (42%), Gaps = 12/184 (6%)
 Frame = +1

Query: 565  LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 744
            ++P+L  + +   K + E+  +  +G TH Q A   TLG+  + ++Q+L   +    ++ 
Sbjct: 128  IIPKLVNVINRLSKFACEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRAR 187

Query: 745  HHLKFLAQGGTAVGTGLNTKVGF------AEKIAEQVSKETGIDF------KTAPNKFEA 888
            + +      GT  GT  +    F       E + ++V++  G D       +T   K + 
Sbjct: 188  NDIGLRGVKGT-TGTQASFLALFHGDHDRVEALDKRVTELLGFDIVYPVTGQTYSRKID- 245

Query: 889  LAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNP 1068
                   ++  G+ ++   +  K+A DIR L +       E    + + GSS M  K NP
Sbjct: 246  -------IDILGSGSSFEATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNP 295

Query: 1069 TQNE 1080
             + E
Sbjct: 296  MRCE 299

>TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {ON}
            Anc_4.197 YLR359W
          Length = 482

 Score = 33.9 bits (76), Expect = 1.1
 Identities = 55/261 (21%), Positives = 107/261 (40%), Gaps = 7/261 (2%)
 Frame = +1

Query: 565  LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 744
            ++P+L  + +     + ++  +  +G TH Q A   TLG+  + ++Q+L   +    ++ 
Sbjct: 128  IIPKLVNVINRLSDFALKYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 745  HHLKFLAQGGTAVGTGLNTKVGF------AEKIAEQVSKETGIDFKTAPNKFEALAAHDA 906
            + +      GT  GT  +    F       E + ++V++  G D  T         +   
Sbjct: 188  NDIGLRGVKGT-TGTQASFLALFHGDHDKVEALDKRVTELLGFD--TVYPVTGQTYSRKI 244

Query: 907  VVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAM 1086
             ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E +
Sbjct: 245  DIDVLSPLSSFAATAHKMATDIRLLANLKEM---EEPFEKSQIGSSAMAYKRNPMRCERV 301

Query: 1087 TQVCVQVMGNNAAITFAGASGQ-FELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIK 1263
              +  + +G+  +     AS Q FE  +    +    L S  L AD   S  ++   G+ 
Sbjct: 302  CSL-ARHLGSLFSDAVQTASVQWFERTLDDSAIRRISLPSAFLTADILLSTLLNISSGLV 360

Query: 1264 ANEDRISKLLHESLMLVTALN 1326
                 I + +   L  +   N
Sbjct: 361  VYPKVIERRIKSELPFMATEN 381

>NDAI0F00630 Chr6 complement(150952..154353) [3402 bp, 1133 aa] {ON}
           
          Length = 1133

 Score = 33.9 bits (76), Expect = 1.3
 Identities = 26/119 (21%), Positives = 48/119 (40%)
 Frame = +1

Query: 520 PSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGY 699
           P+++  A  T +  S L     +R+    K++E +  V+I  +      P  + +EF   
Sbjct: 110 PNILRSALKTMVQPSELVPWRTIRNDITNKNNEVTIYVRISTSDSSTEPPSEITKEFGDI 169

Query: 700 VQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPN 876
           + +         +++HH   L +G T V            K  E   K+   D KT+P+
Sbjct: 170 LVEKIPAHDEHTKTIHHQITLKEGATPVFQRAYRMAEEERKALEDELKDLMKDNKTSPS 228

>KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly
            similar to uniprot|Q05911 Saccharomyces cerevisiae
            YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
            in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 33.1 bits (74), Expect = 1.9
 Identities = 40/178 (22%), Positives = 77/178 (43%), Gaps = 6/178 (3%)
 Frame = +1

Query: 565  LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 744
            L+P+L  + +   + + ++  +  +G TH Q A   TLG+  + ++Q+L   +    ++ 
Sbjct: 128  LIPKLVNVINRLSQFALQWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 745  HHLKFLAQGGTAVGTGLNTKVGF------AEKIAEQVSKETGIDFKTAPNKFEALAAHDA 906
            + +      GT  GT  +    F       E + ++V++  G D  T         +   
Sbjct: 188  NDIGLRGVKGT-TGTQASFLALFHGDHDKVEALDKRVTELLGFD--TVYPVTGQTYSRKI 244

Query: 907  VVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1080
             ++    L + A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 245  DIDVLAPLCSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPMRCE 299

>Kpol_1050.63 s1050 (138268..141444) [3177 bp, 1058 aa] {ON}
           (138268..141444) [3177 nt, 1059 aa]
          Length = 1058

 Score = 32.7 bits (73), Expect = 2.9
 Identities = 44/189 (23%), Positives = 72/189 (38%), Gaps = 9/189 (4%)
 Frame = +1

Query: 208 MPEAVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSG 387
           +PE+ + A G  +  A+           E+SK   K  D      +    P  V  T  G
Sbjct: 434 VPESFIGALGQNRTLASPAPNVESDAVTELSKESSKVED------ISSQSPKYV-ATELG 486

Query: 388 TQSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSL 567
           +Q+  N+N+VI    IEI   E        NN  N+ +        V +++  TEI    
Sbjct: 487 SQTEENSNDVIHEEIIEIYNDEL-------NNTINKTEEPEK--DEVKYVSLDTEIDIQT 537

Query: 568 LPELTALRDSFQ-----KKSDEFSSIVKIGRTHLQDATPLT----LGQEFSGYVQQLTNG 720
           +   T  RD  +     K S +     K+G    +DA  +T    + Q     +Q+ T  
Sbjct: 538 VQSPTKSRDDLKSDEQIKHSKDIVKQGKMGEVSAKDAIYITGAEVIPQSNEELIQRRTKE 597

Query: 721 IARVEQSLH 747
           +   E  ++
Sbjct: 598 VTNNEMHIN 606

>TDEL0G04710 Chr7 (860069..861289) [1221 bp, 406 aa] {ON} 
          Length = 406

 Score = 32.0 bits (71), Expect = 4.1
 Identities = 21/49 (42%), Positives = 26/49 (53%), Gaps = 5/49 (10%)
 Frame = +1

Query: 175 ENFK-IGGARERMPEA----VVRAFGVLKKSAAIVNESLGTLDPEISKP 306
           EN K  GG + R+P A    +VR   VLK+ A  VNES      E+ KP
Sbjct: 275 ENSKGAGGVQRRLPTAHIHPLVRVHPVLKRKALFVNESFSRRIVELKKP 323

>KNAG0D03480 Chr4 complement(625236..628724) [3489 bp, 1162 aa] {ON}
           Anc_4.117 YGL006W
          Length = 1162

 Score = 31.6 bits (70), Expect = 6.6
 Identities = 29/93 (31%), Positives = 45/93 (48%), Gaps = 21/93 (22%)
 Frame = +1

Query: 100 IETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEAVVRAFG------------VL 243
           ++TD    IKVP ++  G Q  RS + ++  G   R+PE + ++FG            +L
Sbjct: 52  LKTDLETGIKVPLNETEGTQNHRSTDRYRKYG-DNRIPERLPKSFGKLIWEAFNDKTMLL 110

Query: 244 KKSAAIVNESLG---------TLDPEISKPIQK 315
             +AAIV+ +LG           DPE   PI+K
Sbjct: 111 LTAAAIVSFALGMYEYFYTPVEYDPE-GNPIKK 142

>Kwal_33.14842 s33 (836539..836691) [153 bp, 50 aa] {OFF} [contig
           101] FULL
          Length = 50

 Score = 28.1 bits (61), Expect = 7.4
 Identities = 13/32 (40%), Positives = 19/32 (59%)
 Frame = -1

Query: 108 GFYPVLLLSQRGACR*HSDRRRWQEVSVSSCS 13
           GF+P L ++  G CR H     WQ++ + SCS
Sbjct: 14  GFFPPLCVTLLGPCRFH-----WQQLLLLSCS 40

>Kwal_23.4183 s23 (605416..605775) [360 bp, 119 aa] {OFF} YNR044W
           (AGA1) - anchorage subunit of a-agglutinin [contig 1]
           FULL
          Length = 119

 Score = 29.6 bits (65), Expect = 8.0
 Identities = 25/86 (29%), Positives = 32/86 (37%)
 Frame = -2

Query: 386 PDPV*KTTNGKWSINLPWITSSAAF*IGLEISGSKVPRDSLTMAADFFKTPKALTTASGI 207
           P P  K T  + S++  W  SS      L  + S  P            TP         
Sbjct: 22  PSPAPKNTRTRSSLHNRWSRSSCPKNTALSTTLSSSPW-----------TPS-------- 62

Query: 206 RSLAPPILKFSKERWVWAPQYLSAGT 129
           RS+AP  L  S   W+WAP   S+ T
Sbjct: 63  RSIAPLTLTTSSNPWIWAPSAASSTT 88

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 147,863,931
Number of extensions: 3448136
Number of successful extensions: 9815
Number of sequences better than 10.0: 65
Number of HSP's gapped: 9804
Number of HSP's successfully gapped: 65
Length of query: 494
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 380
Effective length of database: 40,409,475
Effective search space: 15355600500
Effective search space used: 15355600500
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 35 (18.1 bits)