Re-run this search with the SEG filter switched on (default)

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E00946g6.13ON49349326350.0
KLTH0C11462g6.13ON49249323470.0
Kwal_56.223626.13ON49349323440.0
Ecym_30166.13ON48948123160.0
KLLA0D00902g6.13ON49249122570.0
TDEL0G045806.13ON48448322240.0
ACR013C6.13ON48849322220.0
CAGL0A01045g6.13ON48349121480.0
Kpol_1032.46.13ON46746021450.0
Kpol_1045.766.13ON48546021120.0
YPL262W (FUM1)6.13ON48849520970.0
NCAS0D026206.13ON49349320920.0
ZYRO0C07964g6.13ON50547920920.0
TPHA0J002706.13ON49647620900.0
Smik_6.4706.13ON48849520880.0
Skud_16.166.13ON48849520790.0
Suva_16.436.13ON48849520770.0
KNAG0E027506.13ON49848020580.0
KAFR0B065206.13ON49548120320.0
NDAI0I024706.13ON47546419500.0
TBLA0G010006.13ON46546119250.0
TBLA0A071306.13ON50047619130.0
KLLA0A08404g1.354ON4612431251e-06
Skud_8.701.354ON4632381242e-06
NDAI0G059401.354ON4622431222e-06
Suva_15.2011.354ON4632391223e-06
Smik_8.831.354ON4632381197e-06
NCAS0A090101.354ON4622381171e-05
SAKL0D09746g1.354ON4642371161e-05
KNAG0I015601.354ON4622431152e-05
YHR018C (ARG4)1.354ON4632391124e-05
ZYRO0G00748g1.354ON4622441125e-05
TBLA0F034801.354ON4662371116e-05
TDEL0D022201.354ON4652411108e-05
Kpol_1018.1251.354ON4602421099e-05
Suva_10.4594.197ON4821861091e-04
YLR359W (ADE13)4.197ON4821861091e-04
Smik_12.4464.197ON4821861081e-04
CAGL0B02794g4.197ON4821921081e-04
CAGL0I08987g1.354ON4612371072e-04
TPHA0B010404.197ON4821921053e-04
Ecym_27491.354ON4702881035e-04
Skud_12.4434.197ON4821861028e-04
AEL019W1.354ON4692421028e-04
TPHA0A021901.354ON4632401019e-04
Ecym_24524.197ON4821941010.001
NDAI0J019504.197ON4821941000.001
Kwal_47.180664.197ON4821891000.001
NCAS0J012004.197ON482192990.002
Kwal_27.127821.354ON465284980.002
ZYRO0B07964g4.197ON482186980.002
Kpol_1042.164.197ON482192970.003
KNAG0B058404.197ON482192970.003
KLTH0G19338g1.354ON465272960.004
KAFR0A062304.197ON482192960.004
TBLA0A083204.197ON482213950.005
KLLA0B13189g4.197ON482186950.005
SAKL0B04972g4.197ON482192930.010
ABL006C4.197ON482190870.044
KLTH0A03344g4.197ON482192860.069
TDEL0E017604.197ON482192840.11
Suva_4.4946.148ON85092751.3
KNAG0D034804.117ON116296751.3
TDEL0G04710na 1ON40643713.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E00946g
         (493 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly s...  1019   0.0  
KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {...   908   0.0  
Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W ...   907   0.0  
Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to ...   896   0.0  
KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly s...   874   0.0  
TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {O...   861   0.0  
ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON} S...   860   0.0  
CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {...   832   0.0  
Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..516...   830   0.0  
Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa] ...   818   0.0  
YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumaras...   812   0.0  
NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {O...   810   0.0  
ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {...   810   0.0  
TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13...   809   0.0  
Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON...   808   0.0  
Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W (...   805   0.0  
Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W (...   804   0.0  
KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.1...   797   0.0  
KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6...   787   0.0  
NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {O...   755   0.0  
TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.1...   746   0.0  
TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6...   741   0.0  
KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {...    53   1e-06
Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}...    52   2e-06
NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON} Anc_1...    52   2e-06
Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {...    52   3e-06
Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}...    50   7e-06
NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa] ...    50   1e-05
SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {...    49   1e-05
KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.3...    49   2e-05
YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}  ...    48   4e-05
ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly s...    48   5e-05
TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.3...    47   6e-05
TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.3...    47   8e-05
Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]...    47   9e-05
Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359...    47   1e-04
YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}  ADE13Aden...    47   1e-04
Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359...    46   1e-04
CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {...    46   1e-04
CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {...    46   2e-04
TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {O...    45   3e-04
Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {O...    44   5e-04
Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359...    44   8e-04
AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic ho...    44   8e-04
TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.3...    44   9e-04
Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar t...    44   0.001
NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4....    43   0.001
Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359...    43   0.001
NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4....    43   0.002
Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]...    42   0.002
ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {...    42   0.002
Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON} (40749....    42   0.003
KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON} Anc_4...    42   0.003
KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]...    42   0.004
KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa] ...    42   0.004
TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa] ...    41   0.005
KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]...    41   0.005
SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly...    40   0.010
ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON} S...    38   0.044
KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly...    38   0.069
TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {O...    37   0.11 
Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W ...    33   1.3  
KNAG0D03480 Chr4 complement(625236..628724) [3489 bp, 1162 aa] {...    33   1.3  
TDEL0G04710 Chr7 (860069..861289) [1221 bp, 406 aa] {ON}               32   3.6  

>SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 493

 Score = 1019 bits (2635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/493 (100%), Positives = 493/493 (100%)

Query: 1   MLRITAAANRNLLPSSSIRMLSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRSFEN 60
           MLRITAAANRNLLPSSSIRMLSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRSFEN
Sbjct: 1   MLRITAAANRNLLPSSSIRMLSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRSFEN 60

Query: 61  FKIGGARERMPEAVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHFP 120
           FKIGGARERMPEAVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHFP
Sbjct: 61  FKIGGARERMPEAVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHFP 120

Query: 121 LVVFQTGSGTQSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIA 180
           LVVFQTGSGTQSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIA
Sbjct: 121 LVVFQTGSGTQSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIA 180

Query: 181 AVTEITHSLLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG 240
           AVTEITHSLLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG
Sbjct: 181 AVTEITHSLLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG 240

Query: 241 IARVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 300
           IARVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH
Sbjct: 241 IARVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 300

Query: 301 DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 360
           DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE
Sbjct: 301 DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 360

Query: 361 AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGI 420
           AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGI
Sbjct: 361 AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGI 420

Query: 421 KANEDRISKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEKEFD 480
           KANEDRISKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEKEFD
Sbjct: 421 KANEDRISKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEKEFD 480

Query: 481 EWVIPEKMIGPKE 493
           EWVIPEKMIGPKE
Sbjct: 481 EWVIPEKMIGPKE 493

>KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 492

 Score =  908 bits (2347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/493 (88%), Positives = 463/493 (93%), Gaps = 2/493 (0%)

Query: 1   MLRITA-AANRNLLPSSSIRMLSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRSFE 59
           M ++TA  AN++L  S   R++STSS+++Q K R+ETDAFGEI VPADKYWGAQTQRS E
Sbjct: 1   MFKLTAEVANKSLSGSPKTRLISTSSAISQ-KCRVETDAFGEINVPADKYWGAQTQRSLE 59

Query: 60  NFKIGGARERMPEAVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHF 119
           NFKIGGARERMPE VVRAFG+LKKSAAIVNESLGTLDP+ISKPIQ+AADEVI GKL+DHF
Sbjct: 60  NFKIGGARERMPEPVVRAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVISGKLVDHF 119

Query: 120 PLVVFQTGSGTQSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHI 179
           PLVVFQTGSGTQSNMNANEVISNRAIEI+GG+ G+K +HPNNHCNQAQSSNDTFPSVMHI
Sbjct: 120 PLVVFQTGSGTQSNMNANEVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHI 179

Query: 180 AAVTEITHSLLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTN 239
           AAVTEITHSLLPELTALRDSF  KS EF SIVKIGRTHLQDATPLTLGQEFSGYVQQLTN
Sbjct: 180 AAVTEITHSLLPELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTN 239

Query: 240 GIARVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAA 299
           GI+RVEQSL HLKFLAQGGTAVGTGLNTKVGF EKIAEQVSKETGIDFKTAPNKFEALAA
Sbjct: 240 GISRVEQSLIHLKFLAQGGTAVGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAA 299

Query: 300 HDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQN 359
           HDA+VECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQN
Sbjct: 300 HDAIVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQN 359

Query: 360 EAMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDG 419
           EAMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLL DA YSFRVHCVDG
Sbjct: 360 EAMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLGDACYSFRVHCVDG 419

Query: 420 IKANEDRISKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEKEF 479
           I+AN D+I+KLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESAL+L VL   EF
Sbjct: 420 IEANRDKIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLTSAEF 479

Query: 480 DEWVIPEKMIGPK 492
           D+WV+PE M+GPK
Sbjct: 480 DQWVVPENMVGPK 492

>Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W
           (FUM1) - mitochondrial and cytoplasmic fumarase
           (fumarate hydralase) [contig 186] FULL
          Length = 493

 Score =  907 bits (2344), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/493 (87%), Positives = 463/493 (93%), Gaps = 2/493 (0%)

Query: 1   MLRITA-AANRNLLPSSSIRMLSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRSFE 59
           M ++T  AAN+ L+  S  R++STSSSL Q KYR+ETDAFGEIKVP DK WGAQTQRS E
Sbjct: 1   MFKVTTEAANKALISGSKARLISTSSSLGQ-KYRVETDAFGEIKVPTDKLWGAQTQRSLE 59

Query: 60  NFKIGGARERMPEAVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHF 119
           NFKIGG RERMPE +V+AFG+LKKSAAIVNESLGTLDP++SKPIQ AADEVI GKL+DHF
Sbjct: 60  NFKIGGQRERMPEPIVKAFGILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHF 119

Query: 120 PLVVFQTGSGTQSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHI 179
           PLVVFQTGSGTQSNMNANEVISNRAI+++GGE GSK +HPNNHCNQAQSSNDTFPSVMHI
Sbjct: 120 PLVVFQTGSGTQSNMNANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHI 179

Query: 180 AAVTEITHSLLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTN 239
           AAVTE+TH LLPEL ALRD+F KK+ EF SIVKIGRTHLQDATPLTLGQEFSGYVQQLTN
Sbjct: 180 AAVTEVTHLLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTN 239

Query: 240 GIARVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAA 299
           GI+RVE SLH+LKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAA
Sbjct: 240 GISRVEHSLHNLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAA 299

Query: 300 HDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQN 359
           HDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQN
Sbjct: 300 HDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQN 359

Query: 360 EAMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDG 419
           EAMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSS+RLL DA YSFRVHCV+G
Sbjct: 360 EAMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEG 419

Query: 420 IKANEDRISKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEKEF 479
           I+ANED+I+KLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESAL+LGVL+  EF
Sbjct: 420 IQANEDKIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEF 479

Query: 480 DEWVIPEKMIGPK 492
           DEWV+PE M+GPK
Sbjct: 480 DEWVVPENMVGPK 492

>Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to
           Ashbya gossypii ACR013C
          Length = 489

 Score =  896 bits (2316), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/481 (88%), Positives = 460/481 (95%), Gaps = 3/481 (0%)

Query: 13  LPSSSI--RMLSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERM 70
           +P+  I  RM+ST++ L  QK+RIETDAFGEIKVPA+KYWGAQTQRS ENFKIGG RERM
Sbjct: 8   IPAKRIADRMMSTTAGL-NQKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERM 66

Query: 71  PEAVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGT 130
           PE +++AFG+LKKSAAIVNESLGTLDP+ISKPIQ+AADEVI+GKL+DHFPLVVFQTGSGT
Sbjct: 67  PEPIIKAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGT 126

Query: 131 QSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLL 190
           QSNMNANEVISNRAIE+IGGE G+KQ+HPNNHCNQAQSSNDTFPSVMHIAAVTEIT++LL
Sbjct: 127 QSNMNANEVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLL 186

Query: 191 PELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHH 250
           PELTALRDSFQKK++EFS IVKIGRTHLQDATPLTLGQEF GY QQ+TNGI RVEQSLHH
Sbjct: 187 PELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHH 246

Query: 251 LKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGAL 310
           LKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKET I+FKTAPNKFEALAAHDAVVECSGAL
Sbjct: 247 LKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGAL 306

Query: 311 NTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVM 370
           NT+ACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ CVQVM
Sbjct: 307 NTVACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVM 366

Query: 371 GNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKL 430
           GNN+ ITFAGASGQFELNVFKPVMISNLL+S+RLLADASYSFRVHCVDGIKANED+I+K+
Sbjct: 367 GNNSTITFAGASGQFELNVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIAKI 426

Query: 431 LHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIG 490
           LHESLMLVTALNPKIGYD+A KVAKNAHKK ITLKESAL+LGVL+E+EF EWV+PEKMIG
Sbjct: 427 LHESLMLVTALNPKIGYDSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKMIG 486

Query: 491 P 491
           P
Sbjct: 487 P 487

>KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 492

 Score =  874 bits (2257), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/491 (85%), Positives = 454/491 (92%), Gaps = 13/491 (2%)

Query: 3   RITAAANRNLLPSSSIRMLSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRSFENFK 62
           R++A  NR     +S+RM+S         YR+ETDAFGEI+VP+DKYWGAQTQRS +NFK
Sbjct: 15  RVSAKVNR----LASLRMVS---------YRVETDAFGEIQVPSDKYWGAQTQRSLQNFK 61

Query: 63  IGGARERMPEAVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHFPLV 122
           IGG RERMPE +V+AFGVLKKSAA+VNE LGTLDPEI+KPI++AADEV QGKLM+HFPLV
Sbjct: 62  IGGPRERMPEPIVKAFGVLKKSAAVVNERLGTLDPEIAKPIKQAADEVAQGKLMEHFPLV 121

Query: 123 VFQTGSGTQSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAV 182
           VFQTGSGTQSNMNANEVISNRAIE+IGGE GSK++HPNNHCNQAQSSNDTFPSVMHIAAV
Sbjct: 122 VFQTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAV 181

Query: 183 TEITHSLLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIA 242
           TEITH LLPEL  L+ + ++KSDEF  IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGIA
Sbjct: 182 TEITHHLLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIA 241

Query: 243 RVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDA 302
           RV+QSL+HLKFLAQGGTAVGTGLNTKVGFAE IAEQVSKETGIDFKTAPNKFEALAAHDA
Sbjct: 242 RVKQSLYHLKFLAQGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFKTAPNKFEALAAHDA 301

Query: 303 VVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAM 362
           VVE SGALNTLA SLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAM
Sbjct: 302 VVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAM 361

Query: 363 TQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIKA 422
           TQVCVQVMGN+AAITFAGASGQFELNVFKPVMISNLLSS+RLL DAS SFR+HCV+GIKA
Sbjct: 362 TQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDASNSFRIHCVEGIKA 421

Query: 423 NEDRISKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEKEFDEW 482
           NEDRI+KLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESAL+L VL+ +EFD+W
Sbjct: 422 NEDRIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLSSEEFDQW 481

Query: 483 VIPEKMIGPKE 493
           VIPEKMIGPKE
Sbjct: 482 VIPEKMIGPKE 492

>TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {ON}
           Anc_6.13 YPL262W
          Length = 484

 Score =  861 bits (2224), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/483 (85%), Positives = 441/483 (91%), Gaps = 2/483 (0%)

Query: 10  RNLLPSSSIRMLSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARER 69
           R  L S  + ++  S+   Q  +R+ETDAFGEIKV AD+YWGAQTQRS ENF+IGG RER
Sbjct: 3   RTGLLSRPLSVVKMSTKAGQ--FRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRER 60

Query: 70  MPEAVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSG 129
           MPE +VRAFGVLKKSAA+VNESLGTLDP++++PI++AADEV QGKL  HFPLVVFQTGSG
Sbjct: 61  MPEPIVRAFGVLKKSAAVVNESLGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSG 120

Query: 130 TQSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSL 189
           TQSNMNANEVISNRAIE+IGGE GSKQ+HPNNHCNQAQSSNDTFPSVMHIAAVTEIT  L
Sbjct: 121 TQSNMNANEVISNRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHL 180

Query: 190 LPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLH 249
           LPEL  LRDS   KS EFS IVKIGRTHLQDATPLTLGQEFSGYVQQ++NGI RVE SLH
Sbjct: 181 LPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLH 240

Query: 250 HLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGA 309
            LK+LAQGGTAVGTGLNTK+GFAEKIAEQVSKETG+DFKTAPNKFEALAAHDAVVE SGA
Sbjct: 241 RLKYLAQGGTAVGTGLNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGA 300

Query: 310 LNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQV 369
           LNT+ACSLFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQVCVQV
Sbjct: 301 LNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQV 360

Query: 370 MGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISK 429
           MGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGI AN DRI K
Sbjct: 361 MGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGK 420

Query: 430 LLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMI 489
           L+HESLMLVTALNPKIGYDAASKVAKNAHKKGITLK+SAL LGVL E EFDEWV+PE MI
Sbjct: 421 LMHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMI 480

Query: 490 GPK 492
           GPK
Sbjct: 481 GPK 483

>ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL262W
           (FUM1)
          Length = 488

 Score =  860 bits (2222), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/493 (83%), Positives = 453/493 (91%), Gaps = 5/493 (1%)

Query: 1   MLRITAAANRNLLPSSSIRMLSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRSFEN 60
           MLR++    R  + SS+ R L  S++ A Q++R+ETDAFGEI+VPADKYWGAQTQRS EN
Sbjct: 1   MLRLS----RGCVGSSAARRL-MSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLEN 55

Query: 61  FKIGGARERMPEAVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHFP 120
           F+IGGARERMPE VVRAFGVLKKSAA+VNE LGTL+P I+K IQ+AADEV QG+LM+HFP
Sbjct: 56  FRIGGARERMPEPVVRAFGVLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFP 115

Query: 121 LVVFQTGSGTQSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIA 180
           LVVFQTGSGTQSNMNANEVISNRAIE++GGE GSKQVHPNNHCNQAQSSNDTFPSVMHIA
Sbjct: 116 LVVFQTGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIA 175

Query: 181 AVTEITHSLLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG 240
           AVTEIT SLLPEL ALR SFQ+K+DEF+ IVKIGRTHLQDATPLTLGQEFSGY QQ+ NG
Sbjct: 176 AVTEITRSLLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANG 235

Query: 241 IARVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 300
           IARVE +   L+FLAQGGTAVGTGLNT+ GFAE+IA QVS+ETG++F+TAPNKFEALAAH
Sbjct: 236 IARVEHAQESLRFLAQGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAH 295

Query: 301 DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 360
           DAVVE SGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE
Sbjct: 296 DAVVEASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 355

Query: 361 AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGI 420
           A+TQ CVQVMGNNAAITFAGASGQFELNVFKPVMI+NLLSSVRLLADA+ SFRVHCVDGI
Sbjct: 356 ALTQACVQVMGNNAAITFAGASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGI 415

Query: 421 KANEDRISKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEKEFD 480
           + NEDRI+KLLHESLMLVTALNPKIGYDAAS VAKNAHKKGITL+ SAL+LGVL + EFD
Sbjct: 416 QDNEDRIAKLLHESLMLVTALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFD 475

Query: 481 EWVIPEKMIGPKE 493
           EWV+PEKMIGP++
Sbjct: 476 EWVVPEKMIGPRD 488

>CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262w FUM1 fumarate hydratase
          Length = 483

 Score =  832 bits (2148), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/491 (81%), Positives = 440/491 (89%), Gaps = 10/491 (2%)

Query: 1   MLRITAAANRNLLPSSSIRMLSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRSFEN 60
           MLR ++ A  +L+  S+ RM+          YR+ETD FGEIKVPADKYWGAQTQRSF+N
Sbjct: 1   MLRASSRAKTSLIGYSA-RMM---------HYRVETDTFGEIKVPADKYWGAQTQRSFQN 50

Query: 61  FKIGGARERMPEAVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHFP 120
           FKIGGARERMPE +VRAFGVLKKSAAIVNE LGTLD EI+ PIQ+AADEV +GKL DHFP
Sbjct: 51  FKIGGARERMPEPIVRAFGVLKKSAAIVNEKLGTLDSEIAGPIQQAADEVAKGKLNDHFP 110

Query: 121 LVVFQTGSGTQSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIA 180
           LVVFQTGSGTQSNMNANEVISNRAIE+IGGE GSK++HPNNHCNQAQSSNDTFPSVMHIA
Sbjct: 111 LVVFQTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIA 170

Query: 181 AVTEITHSLLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG 240
           AVTEIT+SLLPE+T L+D+  KK++EF  IVKIGRTHLQDATPLTLGQEFSGYVQQL NG
Sbjct: 171 AVTEITNSLLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNG 230

Query: 241 IARVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 300
           IAR+E +L HLK+LAQGGTAVGTGLNTK GF + IAEQ+SKETGIDFKTAPNKFEALAAH
Sbjct: 231 IARIENTLPHLKYLAQGGTAVGTGLNTKEGFDKLIAEQISKETGIDFKTAPNKFEALAAH 290

Query: 301 DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 360
           DA+VE SGALNT+ACSLFKIA DIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNE
Sbjct: 291 DAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNE 350

Query: 361 AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGI 420
           AMTQVCVQVMGNNAA+TFAGA+GQFELNVFKPVMISNLLSS+RLLADA +SFRVHCV+GI
Sbjct: 351 AMTQVCVQVMGNNAAVTFAGANGQFELNVFKPVMISNLLSSIRLLADACHSFRVHCVEGI 410

Query: 421 KANEDRISKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEKEFD 480
           +AN ++I+  LH SLMLVTALNPKIGYDAASK+AKNA KK ITLKESAL+L  L  +EFD
Sbjct: 411 EANREKINHNLHNSLMLVTALNPKIGYDAASKIAKNAFKKNITLKESALELKYLTSEEFD 470

Query: 481 EWVIPEKMIGP 491
           EWVIPE M+GP
Sbjct: 471 EWVIPENMVGP 481

>Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..5164)
           [1404 nt, 468 aa]
          Length = 467

 Score =  830 bits (2145), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/460 (85%), Positives = 428/460 (93%)

Query: 32  YRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEAVVRAFGVLKKSAAIVNES 91
           +R+ETD FGEIKVPADKYWGAQTQRS+ENFKIGG RERMPE VV+AFGVLKKSAAIVNE 
Sbjct: 7   FRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNEE 66

Query: 92  LGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEIIGGE 151
            G LD  ISK IQ+AADEVI+GKL +HFPLVVFQTGSGTQSNMNANEVISNRAIE+ GG 
Sbjct: 67  FGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGI 126

Query: 152 KGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFSSIV 211
            GSK++HPNNHCN AQSSNDTFP+VMHIAAVTEITH L+P++T L+D+   KS EF  IV
Sbjct: 127 MGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIV 186

Query: 212 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNTKVGF 271
           KIGRTHLQDATPLTLGQEFSGYVQQL NGIAR+E SL +LKFLAQGGTAVGTGLNTK+GF
Sbjct: 187 KIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGF 246

Query: 272 AEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGP 331
           AE+IAEQVSKETGI+FKTAPNKFEALAAHDA+VE SGALNT+ACSLFKIA DIRYLGSGP
Sbjct: 247 AERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGP 306

Query: 332 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 391
           RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK
Sbjct: 307 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 366

Query: 392 PVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHESLMLVTALNPKIGYDAAS 451
           PVMISNLLSS+RLL DA +SF +HCV+GI+ANED+I+KLLHESLMLVTALNPKIGYD+A+
Sbjct: 367 PVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSAT 426

Query: 452 KVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGP 491
           KVAKNAHKKGITLKESAL+LGVL E EFDEWV+PEKM+GP
Sbjct: 427 KVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGP 466

>Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa]
           {ON} complement(177449..178906) [1458 nt, 486 aa]
          Length = 485

 Score =  818 bits (2112), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/460 (84%), Positives = 423/460 (91%)

Query: 32  YRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEAVVRAFGVLKKSAAIVNES 91
           +R+ETD FGEIKVPA+KYWGAQT+RSFENFKIGG+RERMPEAVVRAFGVLKK AAIVN  
Sbjct: 24  FRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKKCAAIVNTE 83

Query: 92  LGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEIIGGE 151
           LG LDP  SK IQ+AADEV  GKL DHFPLVVFQTGSGTQSNMNANEVISNRAIE+ GG 
Sbjct: 84  LGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGV 143

Query: 152 KGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFSSIV 211
            GSK++HPNNHCN AQSSNDTFP+VMHIAAVT+I+  LLPELT LRD+   KS EF  IV
Sbjct: 144 LGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIV 203

Query: 212 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNTKVGF 271
           KIGRTHLQDATPLTLGQEFSGYVQQLTNGI R+E++  +L+FLAQGGTAVGTGLNTK G+
Sbjct: 204 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGW 263

Query: 272 AEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGP 331
           AE+IA ++SKETG+ FKTAPNKFEALAAHDA+VE SGALNT+ACSLFKIA DIRYLGSGP
Sbjct: 264 AERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGP 323

Query: 332 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 391
           RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAA+TFAGASGQFELNVFK
Sbjct: 324 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASGQFELNVFK 383

Query: 392 PVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHESLMLVTALNPKIGYDAAS 451
           PV+ISNLLSSV+LL DAS SFRVHCV+GIKANE +IS+LLH SLMLVTALNPKIGYDAA+
Sbjct: 384 PVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNPKIGYDAAT 443

Query: 452 KVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGP 491
           KVAKNAHKKGITLKESAL+LGVL EKEFDEWV+PEKM+GP
Sbjct: 444 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 483

>YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumarase,
           converts fumaric acid to L-malic acid in the TCA cycle;
           cytosolic and mitochondrial distribution determined by
           the N-terminal targeting sequence, protein conformation,
           and status of glyoxylate shunt; phosphorylated in
           mitochondria
          Length = 488

 Score =  812 bits (2097), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/495 (79%), Positives = 435/495 (87%), Gaps = 10/495 (2%)

Query: 1   MLRITAAANRNLLPSS---SIRMLSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRS 57
           MLR T  + +  + SS   +IR +++S       +R ETDAFGEI VPADKYWGAQTQRS
Sbjct: 1   MLRFTNCSCKTFVKSSYKLNIRRMNSS-------FRTETDAFGEIHVPADKYWGAQTQRS 53

Query: 58  FENFKIGGARERMPEAVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMD 117
           F+NFKIGGARERMP  +V AFGVLKKSAAIVNESLG LDP+ISK IQ+AADEV  GKL D
Sbjct: 54  FQNFKIGGARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKISKAIQQAADEVASGKLDD 113

Query: 118 HFPLVVFQTGSGTQSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVM 177
           HFPLVVFQTGSGTQSNMNANEVISNRAIEI+GG+ GSKQVHPNNHCNQ+QSSNDTFP+VM
Sbjct: 114 HFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKQVHPNNHCNQSQSSNDTFPTVM 173

Query: 178 HIAAVTEITHSLLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQL 237
           HIAA  +I + L+PELT L+++ + KS EF  IVKIGRTHLQDATPLTLGQEFSGYVQQ+
Sbjct: 174 HIAASLQIQNELIPELTNLKNALEAKSKEFDHIVKIGRTHLQDATPLTLGQEFSGYVQQV 233

Query: 238 TNGIARVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEAL 297
            NGI RV  SL  L FLAQGGTAVGTGLNTK GF  KIAEQ+SKETG+ F+TAPNKFEAL
Sbjct: 234 ENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEAL 293

Query: 298 AAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPT 357
           AAHDA+VECSGALNTLACSLFKIA DIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPT
Sbjct: 294 AAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPT 353

Query: 358 QNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCV 417
           QNEA+TQVCVQVMGNNAAITFAG+ GQFELNVFKPVMI+NLL+S+RL+ DA+YSFRVHCV
Sbjct: 354 QNEALTQVCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDAAYSFRVHCV 413

Query: 418 DGIKANEDRISKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEK 477
           +GIKANE RI +LL +SLMLVTALNPKIGYDAASKVAKNAHKKGITLKESAL+LGVL EK
Sbjct: 414 EGIKANEPRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEK 473

Query: 478 EFDEWVIPEKMIGPK 492
           EFDEWV+PE M+GPK
Sbjct: 474 EFDEWVVPEHMLGPK 488

>NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {ON}
           Anc_6.13 YPL262W
          Length = 493

 Score =  810 bits (2092), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/493 (76%), Positives = 443/493 (89%), Gaps = 2/493 (0%)

Query: 1   MLRITAAANRNLLPSSSIRM-LSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRSFE 59
           ML++  A N  +L   + RM LST+++ +QQ+YRIETD+FGEIKVPADKYWGAQTQRSF+
Sbjct: 1   MLKLKLA-NPTILRLQASRMSLSTTTAASQQQYRIETDSFGEIKVPADKYWGAQTQRSFQ 59

Query: 60  NFKIGGARERMPEAVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHF 119
           NFKIGG+RER+P+ ++ AFG+LKKSAAIVNESLGTLDP+++ PI+KAADEV+QGKL DHF
Sbjct: 60  NFKIGGSRERIPDPIITAFGILKKSAAIVNESLGTLDPKVADPIKKAADEVVQGKLKDHF 119

Query: 120 PLVVFQTGSGTQSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHI 179
           PLVVFQTGSGTQ+NMN NEVISNRAIE++GG+ GSKQ+HPNNHCNQ+QSSNDTFPSVMHI
Sbjct: 120 PLVVFQTGSGTQTNMNVNEVISNRAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHI 179

Query: 180 AAVTEITHSLLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTN 239
           AAV EIT+SL+PELT L+D+   K+ EF+ IVKIGRTHLQDATPLTLGQEFSGYVQQL N
Sbjct: 180 AAVLEITNSLIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLEN 239

Query: 240 GIARVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAA 299
           GI R+E SL+HLKFLAQGGTAVGTGLNTK+GF + IAE+VSKETGI+FKTAPNKFEALAA
Sbjct: 240 GIYRIESSLYHLKFLAQGGTAVGTGLNTKIGFDKLIAEEVSKETGIEFKTAPNKFEALAA 299

Query: 300 HDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQN 359
           HDA+V  SGALNT+A SLFKIA DIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQN
Sbjct: 300 HDAIVFASGALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQN 359

Query: 360 EAMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDG 419
           EAMTQVCVQ+MGNN  I+ AG+ GQFELNV+KP+MI+NLL+S+RL+ DA  SFR+HC+D 
Sbjct: 360 EAMTQVCVQIMGNNQTISIAGSQGQFELNVYKPLMIANLLNSIRLMTDACKSFRIHCIDD 419

Query: 420 IKANEDRISKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEKEF 479
           +KAN+D+I++ L++SLMLVTALNPKIGYDAASK+AKNAH K ITLKESAL+L  L  +EF
Sbjct: 420 LKANKDKINENLNKSLMLVTALNPKIGYDAASKIAKNAHLKNITLKESALELKYLTAEEF 479

Query: 480 DEWVIPEKMIGPK 492
           DEWV+PE MIGPK
Sbjct: 480 DEWVVPENMIGPK 492

>ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 505

 Score =  810 bits (2092), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/479 (80%), Positives = 427/479 (89%), Gaps = 1/479 (0%)

Query: 14  PSSSIRMLSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEA 73
           P S I  L T++   Q+ +R+ETDAFGEIKVPADKYWGAQTQRSFENF+IGG RERMPEA
Sbjct: 27  PMSQISQLHTTTPWLQE-HRVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEA 85

Query: 74  VVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSN 133
           VV AFG+LKK+ A VNE+ G LDP+++  I++AADEV  GKL DHFPLVVFQTGSGTQSN
Sbjct: 86  VVHAFGILKKATATVNEANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSN 145

Query: 134 MNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPEL 193
           MNANEVISNRAIE++GG+ GSK VHPNNH N +QSSNDTFP+VMHIAAV  IT  LLP L
Sbjct: 146 MNANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNL 205

Query: 194 TALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKF 253
           TAL+DS QKKS+EF+ IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI RVE +L  LK 
Sbjct: 206 TALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKL 265

Query: 254 LAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTL 313
           LAQGGTAVGTGLNTK+G+AE +A +V+KETGIDF+TAPNKFEALAAHDAVVE SGALNTL
Sbjct: 266 LAQGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTL 325

Query: 314 ACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNN 373
           A SLFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQVCVQV GN+
Sbjct: 326 AVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNH 385

Query: 374 AAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHE 433
           +AITFAGASGQFELNVFKPVMISNLLSS+ LL+DASYSFRVHCVDGI+AN + I+KLLHE
Sbjct: 386 SAITFAGASGQFELNVFKPVMISNLLSSINLLSDASYSFRVHCVDGIQANRENIAKLLHE 445

Query: 434 SLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGPK 492
           SLMLVTALNPKIGYDAASKVAKNAHK GITLKESALQL +L  +EFD WV+PE MIGPK
Sbjct: 446 SLMLVTALNPKIGYDAASKVAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGPK 504

>TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13
           YPL262W
          Length = 496

 Score =  809 bits (2090), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/476 (80%), Positives = 427/476 (89%), Gaps = 5/476 (1%)

Query: 17  SIRMLSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEAVVR 76
           S+R LS  +      +RIETD FGEIKVPA+KYWGAQT+RSFENF+IGG RERMP+ VV+
Sbjct: 26  SMRCLSDEAG-----FRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVK 80

Query: 77  AFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMNA 136
           AFGVLKKSAAIVNE  GTLDP+ISK IQ+AADEVIQGKL DHFPLVVFQTGSGTQSNMNA
Sbjct: 81  AFGVLKKSAAIVNEGYGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNA 140

Query: 137 NEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTAL 196
           NEVISNRAIE++GG  GSKQVHPNNH NQAQSSND+FP+VMHIAAVTEIT  L+PE+  L
Sbjct: 141 NEVISNRAIELLGGTLGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANL 200

Query: 197 RDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLAQ 256
           RD+ + KS +F+ IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGI R+E SL +LKFLAQ
Sbjct: 201 RDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQ 260

Query: 257 GGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACS 316
           GGTAVGTGLNT++GFAEKIAEQ+SKETG+ FKTAPNKFEALAAHDA+VE SGA+ T+A S
Sbjct: 261 GGTAVGTGLNTRIGFAEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATS 320

Query: 317 LFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAI 376
           LFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGK+NPTQNEA+TQVC Q++GNN  I
Sbjct: 321 LFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGNNQTI 380

Query: 377 TFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHESLM 436
            FAG  GQFELNVFKPVMISNLLSS+RLL D S SFR+HCV+GIKANE+RI+ L+++SLM
Sbjct: 381 IFAGTQGQFELNVFKPVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIADLMNKSLM 440

Query: 437 LVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGPK 492
           LVTALNPKIGYD A+KVAKNAHKKGITLKESA+QLG L E EFDEWV+PEKMIGPK
Sbjct: 441 LVTALNPKIGYDEATKVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMIGPK 496

>Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON}
           YPL262W (REAL)
          Length = 488

 Score =  808 bits (2088), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/495 (78%), Positives = 436/495 (88%), Gaps = 10/495 (2%)

Query: 1   MLRITAAANRNLLPSS---SIRMLSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRS 57
           MLR+T ++ +  + SS   +IR ++++       +R ETDAFGEI VPADKYWGAQTQRS
Sbjct: 1   MLRLTNSSCKAFVQSSYKFNIRRMNST-------FRTETDAFGEINVPADKYWGAQTQRS 53

Query: 58  FENFKIGGARERMPEAVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMD 117
           F+NFKIGGARERMP  +V AFGVLKKSAAIVNESLG LDP+ISK IQ+AADEV  GKL D
Sbjct: 54  FQNFKIGGARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKISKAIQEAADEVASGKLDD 113

Query: 118 HFPLVVFQTGSGTQSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVM 177
           HFPLVVFQTGSGTQSNMNANEVISNRAIEI+GG+ GSK+VHPNNHCNQ+QSSNDTFP+VM
Sbjct: 114 HFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVM 173

Query: 178 HIAAVTEITHSLLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQL 237
           HIAA  +I + L+PEL  L+++ + KS EF  IVKIGRTHLQDATPLTLGQEFSGYVQQ+
Sbjct: 174 HIAASLQIQNELIPELANLKNALEAKSKEFDHIVKIGRTHLQDATPLTLGQEFSGYVQQV 233

Query: 238 TNGIARVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEAL 297
            NGI RV  SL  L FLAQGGTAVGTGLNTK GF  KIAEQ+SKETG+ F+TAPNKFEAL
Sbjct: 234 ENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEAL 293

Query: 298 AAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPT 357
           AAHDA+VECSGALNTLACSLFKIA DIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPT
Sbjct: 294 AAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPT 353

Query: 358 QNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCV 417
           QNEA+TQVCVQVMGNNAAITFAG+ GQFELNVFKPVMI+NLL+S+RL+ DA+YSFRVHCV
Sbjct: 354 QNEALTQVCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDAAYSFRVHCV 413

Query: 418 DGIKANEDRISKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEK 477
           +GIKANE RI +LL +SLMLVTALNPKIGYDAASKVAKNAHKKGITLKESAL+LGVL EK
Sbjct: 414 EGIKANEPRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEK 473

Query: 478 EFDEWVIPEKMIGPK 492
           EFDEWV+PE M+GPK
Sbjct: 474 EFDEWVVPENMLGPK 488

>Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  805 bits (2079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/495 (78%), Positives = 435/495 (87%), Gaps = 10/495 (2%)

Query: 1   MLRITAAANRNLLPSS---SIRMLSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRS 57
           MLR +    + +L SS   ++R ++++       +RIETDAFGEI VPADKYWGAQTQRS
Sbjct: 1   MLRFSNFNCKAVLQSSYKVNLRRMNST-------FRIETDAFGEINVPADKYWGAQTQRS 53

Query: 58  FENFKIGGARERMPEAVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMD 117
           F+NFKIGGARERMP  +V AFGVLKKSAA+VNESLG LDP+ISK IQ+AADEV  GKL D
Sbjct: 54  FQNFKIGGARERMPLPLVHAFGVLKKSAAVVNESLGGLDPKISKAIQQAADEVTSGKLDD 113

Query: 118 HFPLVVFQTGSGTQSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVM 177
           HFPLVVFQTGSGTQSNMNANEVISNRAIEI+GG+ GSK+VHPNNHCNQ+QSSNDTFP+VM
Sbjct: 114 HFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVM 173

Query: 178 HIAAVTEITHSLLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQL 237
           HIAA  +I + L+PELT L+++ + KS EF  IVKIGRTHLQDATPLTLGQEFSGYVQQ+
Sbjct: 174 HIAASLQIQNELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQV 233

Query: 238 TNGIARVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEAL 297
            NGI RV  SL  L FLAQGGTAVGTGLNTK GF  KIAEQ+S ETG+ F+TAPNKFEAL
Sbjct: 234 ENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFDIKIAEQISSETGLKFQTAPNKFEAL 293

Query: 298 AAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPT 357
           AAHDA+VECSGALNTLACSLFKIA DIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPT
Sbjct: 294 AAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPT 353

Query: 358 QNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCV 417
           QNEA+TQVCVQVMGNNAAITFAG+ GQFELNVFKPVMI+NLL+S+RL+ D++YSFRVHCV
Sbjct: 354 QNEALTQVCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDSAYSFRVHCV 413

Query: 418 DGIKANEDRISKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEK 477
           +GIKANE RI +LL +SLMLVTALNPKIGYDAASKVAKNAHKKGITLKESAL+LGVL EK
Sbjct: 414 EGIKANEPRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEK 473

Query: 478 EFDEWVIPEKMIGPK 492
           EFDEWV+PE M+GPK
Sbjct: 474 EFDEWVVPENMLGPK 488

>Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  804 bits (2077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/495 (78%), Positives = 434/495 (87%), Gaps = 10/495 (2%)

Query: 1   MLRITAAANRNLLPSS---SIRMLSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRS 57
           MLR + ++ + +L SS   +IR ++++       +R ETDAFGEI VPADKYWGAQTQRS
Sbjct: 1   MLRFSNSSCKAILQSSYKVNIRRMNST-------FRTETDAFGEINVPADKYWGAQTQRS 53

Query: 58  FENFKIGGARERMPEAVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMD 117
           F+NFKIGGARERMP  +V AFGVLKKSAAIVNESLG LDP++SK IQ+AADEV  GKL D
Sbjct: 54  FQNFKIGGARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKVSKAIQQAADEVAAGKLDD 113

Query: 118 HFPLVVFQTGSGTQSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVM 177
           HFPLVVFQTGSGTQSNMNANEVISNRAIEI+GG+ GSKQVHPNN CNQ+QSSNDTFP+VM
Sbjct: 114 HFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKQVHPNNDCNQSQSSNDTFPTVM 173

Query: 178 HIAAVTEITHSLLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQL 237
           HIAA  +I   L+PELT L+++ + KS EF  IVKIGRTHLQDATPLTLGQEFSGYVQQ+
Sbjct: 174 HIAASLQIEKELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQV 233

Query: 238 TNGIARVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEAL 297
            NGI RV  +L  L FLAQGGTAVGTGLNTK GF  KIAEQ+SKETG+ F+TAPNKFEAL
Sbjct: 234 ENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEAL 293

Query: 298 AAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPT 357
           AAHDA+VECSGALNTLACSLFKIA DIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPT
Sbjct: 294 AAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPT 353

Query: 358 QNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCV 417
           QNEA+TQVCVQVMGNNAAITF G+ GQFELNVFKPVMI+NLL+S+RL+ADAS SFR+HCV
Sbjct: 354 QNEALTQVCVQVMGNNAAITFGGSQGQFELNVFKPVMIANLLNSIRLIADASRSFRIHCV 413

Query: 418 DGIKANEDRISKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEK 477
           +GIKANE RI +LL +SLMLVTALNPKIGYDAASKVAKNAHKKGITLKESAL+LGVL EK
Sbjct: 414 EGIKANEPRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEK 473

Query: 478 EFDEWVIPEKMIGPK 492
           EFDEWV+PE M+GPK
Sbjct: 474 EFDEWVVPENMLGPK 488

>KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.13
           YPL262W
          Length = 498

 Score =  797 bits (2058), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/480 (78%), Positives = 429/480 (89%)

Query: 13  LPSSSIRMLSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPE 72
           L  +++R   ++S++  Q++R+ETD+FGEI VPAD+YWGAQTQRSF+NFKIGG RE++PE
Sbjct: 18  LLRNNLRRNMSASAITNQEFRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDREKIPE 77

Query: 73  AVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQS 132
            VVRAFG+LKKSAA VNE+LGTLD  I+  I+ AADEV +GKL DHFPLVVFQTGSGTQS
Sbjct: 78  PVVRAFGILKKSAATVNENLGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSGTQS 137

Query: 133 NMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPE 192
           NMNANEVISNRAIE++GGE GSKQVHPNNH NQ+QSSNDTFP+VMHIAA TEI + L+PE
Sbjct: 138 NMNANEVISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPE 197

Query: 193 LTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLK 252
           L  L+D+ Q K +EFSSIVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI RV+ SL+HL 
Sbjct: 198 LQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLH 257

Query: 253 FLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNT 312
           FLAQGGTAVGTGLNTKVGF + +AE+VSKETG+ F+TAPNKFEALAAHDA+VE SGALNT
Sbjct: 258 FLAQGGTAVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASGALNT 317

Query: 313 LACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 372
           LACSLFKIA DIRYLGSGPRCGYGEL LP NEPGSSIMPGKVNPTQNEAMTQVCVQVMGN
Sbjct: 318 LACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 377

Query: 373 NAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLH 432
           N+ ITFAG+ GQFELNV+KP+MISNLLSS+RLL DAS SFR+HC++ +KAN+D+I + L+
Sbjct: 378 NSTITFAGSQGQFELNVYKPLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKIDENLN 437

Query: 433 ESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGPK 492
           +SLMLVTALNPKIGYDAA+KVAKNAH K ITLKESAL+LGVL EKEFDEWVIPE MI PK
Sbjct: 438 KSLMLVTALNPKIGYDAAAKVAKNAHHKNITLKESALELGVLTEKEFDEWVIPENMISPK 497

>KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6.13
           YPL262W
          Length = 495

 Score =  787 bits (2032), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/481 (77%), Positives = 426/481 (88%), Gaps = 2/481 (0%)

Query: 13  LPSSSIRMLSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPE 72
           L S + R  + SS   +  +R ETD+FGEI VP DKYWGAQTQRS +NFKIGG RE++P 
Sbjct: 17  LTSYTSRFYTMSS--IKSSFRAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGEREKIPI 74

Query: 73  AVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQS 132
            ++ AFG+LKKSAAIVNE LGTLD E++K I  AADEV QGKL DHFPLVVFQTGSGTQS
Sbjct: 75  PIIEAFGILKKSAAIVNERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQS 134

Query: 133 NMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPE 192
           NMNANEVISNRAIE++GG+ GSK VHPNNH NQ+QSSNDTFP+VMHIAA+ EIT  LLPE
Sbjct: 135 NMNANEVISNRAIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPE 194

Query: 193 LTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLK 252
           L +L++S  KKS+EF+ IVKIGRTHLQDATPLTLGQEFSGYVQQ+TNGI R+E +L+HLK
Sbjct: 195 LNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLK 254

Query: 253 FLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNT 312
           FLAQGGTAVGTGLNTK GF + IAEQ+S+ETGI+F+TAPNKFEALAAHDA+VE SGALNT
Sbjct: 255 FLAQGGTAVGTGLNTKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNT 314

Query: 313 LACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 372
           LACSLFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVC+QVMGN
Sbjct: 315 LACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGN 374

Query: 373 NAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLH 432
           ++ ITFAG+ GQFELNV+KP++ISNLLSS+RLL DASYSFRVHC+DG+KAN + I++ L+
Sbjct: 375 HSTITFAGSQGQFELNVYKPLLISNLLSSIRLLTDASYSFRVHCIDGLKANRENITENLN 434

Query: 433 ESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGPK 492
           +SLMLVTALNP IGYD ASK+AKNAH K ITLKESAL+LG+L E++F EWVIPEKMIGPK
Sbjct: 435 KSLMLVTALNPYIGYDNASKIAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKMIGPK 494

Query: 493 E 493
           +
Sbjct: 495 Q 495

>NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {ON}
           Anc_6.13 YPL262W
          Length = 475

 Score =  755 bits (1950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/464 (76%), Positives = 420/464 (90%)

Query: 29  QQKYRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEAVVRAFGVLKKSAAIV 88
           +  +R+ETD+FGEIKVP++KYWGAQTQRSF+NFKIGG RE++P  +++AFG+LKKSAAIV
Sbjct: 11  ESSFRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAAIV 70

Query: 89  NESLGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEII 148
           N+SLGTLDP I+ PI KA+DEVIQGKL DHFPLVVFQTGSGTQ+NMNANEVISNRA E+I
Sbjct: 71  NQSLGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELI 130

Query: 149 GGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFS 208
           G E GSK++HPNNH NQ+QSSNDTFPSVMHIAAV E+ ++L+P+LT L++S   K+ E++
Sbjct: 131 GAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYA 190

Query: 209 SIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNTK 268
           +IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGI R++ SL+HLKFLAQGGTAVGTGLNTK
Sbjct: 191 NIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTK 250

Query: 269 VGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLG 328
           VGF + IA++VSKETGIDF+TAPNKFEALAAHDA+V  S A+ T+A SLFKIA DIRYLG
Sbjct: 251 VGFDKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLG 310

Query: 329 SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELN 388
           SGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQV +Q+MGNN  I  AG+ GQFELN
Sbjct: 311 SGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFELN 370

Query: 389 VFKPVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHESLMLVTALNPKIGYD 448
           V+KP+MI+NLL+S+RL++DA +SF++HCVDG+KAN D+I++ LH+SLMLVTALNPKIGYD
Sbjct: 371 VYKPLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIGYD 430

Query: 449 AASKVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGPK 492
           AASK+AKNAH K ITLKESAL+LG+L E+EFD+WVIPE MIGPK
Sbjct: 431 AASKLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGPK 474

>TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.13
           YPL262W
          Length = 465

 Score =  746 bits (1925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/461 (74%), Positives = 406/461 (88%)

Query: 33  RIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEAVVRAFGVLKKSAAIVNESL 92
           RIE D FGE++VPA+KYWGAQTQR+  NF IGG RERMPE ++ A+G+LKKS AIVNESL
Sbjct: 5   RIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNESL 64

Query: 93  GTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEIIGGEK 152
           GTLDP+ISK IQ+AADEV +G L +HFPLVVFQTGSGTQ+NMN NEVISNRAIEI+GG+ 
Sbjct: 65  GTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQL 124

Query: 153 GSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFSSIVK 212
           GSK VHPNNH NQ+QS+ND+FP+ MHI+AV E+   LLPEL  LRD+ + KS EF+ IVK
Sbjct: 125 GSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKIVK 184

Query: 213 IGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNTKVGFA 272
           IGRTHLQDATPLTLGQEFSGYVQQ+ NGI RV+ SL +LKF+AQGGTAVGTG+NTK  F 
Sbjct: 185 IGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFD 244

Query: 273 EKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPR 332
             +A+Q+S ETGI+FKTAPNKFEALA+HDA+VECSGALNTLACSLFKI+ DIR+LGSGPR
Sbjct: 245 ILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPR 304

Query: 333 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKP 392
           CGYGELSLPENEPGSSIMPGKVNPTQNEAM Q C+QVMGNN+AITFAGASGQFELN +KP
Sbjct: 305 CGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTYKP 364

Query: 393 VMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHESLMLVTALNPKIGYDAASK 452
           +MISNLL+S+RLL D+  SFR+HC+ GI+ANED+I+KLL+ESLMLVTALNPKIGYDAA+ 
Sbjct: 365 LMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAATA 424

Query: 453 VAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGPKE 493
           +AK+AHK G+TLKE+AL+  +L  ++FDEW++PE M+ P E
Sbjct: 425 IAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHPSE 465

>TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6.13
           YPL262W
          Length = 500

 Score =  741 bits (1913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/476 (72%), Positives = 406/476 (85%), Gaps = 1/476 (0%)

Query: 17  SIRMLSTSSSLAQ-QKYRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEAVV 75
           S  +   S S+A  Q  R ETD+FGEI+VPA+KYWGAQTQRSF NFKIGG RERMPE ++
Sbjct: 24  SFSITPVSHSIADLQGTRTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERERMPEPII 83

Query: 76  RAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMN 135
           RAFG  KK+AAIVN SLGTLD  +   I +AA+EV QG L +HFPLVVFQTGSGTQSNMN
Sbjct: 84  RAFGQQKKAAAIVNNSLGTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGSGTQSNMN 143

Query: 136 ANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 195
           ANEVISNRAIE++GG  GSKQVHPNNH NQ+QSSNDTFP+VMHIAA+TEIT++LLP L  
Sbjct: 144 ANEVISNRAIELLGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIV 203

Query: 196 LRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLA 255
           LR++   K+ EF  I+KIGRTHLQDATPLTLGQEFSGY QQLTN I R+E++L  L+++A
Sbjct: 204 LRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIA 263

Query: 256 QGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLAC 315
           QGGTAVGTGLNTK+GFAE+ A Q+S +T + F T+PNKFE+LAAHDA+V    +LNTLAC
Sbjct: 264 QGGTAVGTGLNTKIGFAEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLAC 323

Query: 316 SLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAA 375
           SLFKI+ DIRYL SGPRCGYGELS+PENEPGSSIMPGKVNPTQNEAM Q CVQVMGNN+ 
Sbjct: 324 SLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNST 383

Query: 376 ITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHESL 435
           I+FAGASGQFELN +KP+MI+NLLSS RLL+DA +SF +HC  GI+AN+D+I +LLHESL
Sbjct: 384 ISFAGASGQFELNTYKPLMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKIDRLLHESL 443

Query: 436 MLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGP 491
           MLVT+LNPKIGYDAASKVAKNAH KGITLK+SAL+L +L+ K+FDEWV PE M+GP
Sbjct: 444 MLVTSLNPKIGYDAASKVAKNAHHKGITLKQSALELDILSSKQFDEWVRPENMLGP 499

>KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 461

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 65/243 (26%), Positives = 97/243 (39%), Gaps = 21/243 (8%)

Query: 135 NANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELT 194
            ANE    R  EIIG     K VH        +S ND   + M I     +  ++LP L+
Sbjct: 89  TANE---RRLGEIIGRGIAGK-VHT------GRSRNDQVATDMRIYCRDILNGTVLPALS 138

Query: 195 ALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFL 254
           +L     ++++E   ++  G THLQ A P+      S Y    T    R++Q +  L   
Sbjct: 139 SLIKVILQRAEEEIDVLMPGYTHLQRAQPIRWAHWLSCYATYFTEDYKRLQQIVERLNVS 198

Query: 255 AQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFK-TAPNKFEALAAHDAVVECSGALNTL 313
             G  A+        G    I  +     G++F     N   A+A  D VVE     +  
Sbjct: 199 PLGAGALA-------GHPYGIDREFLA-AGLNFNGVIGNSLTAVADRDFVVEIMFWGSLF 250

Query: 314 ACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNN 373
              + + A D+  + S    G+ +LS      GSS+MP K NP   E +     +V G  
Sbjct: 251 MNHISRFAEDL-IIYSTAEFGFIQLS-DAYSTGSSLMPQKKNPDSLELLRGKSGRVFGQL 308

Query: 374 AAI 376
           A  
Sbjct: 309 AGF 311

>Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 94/238 (39%), Gaps = 21/238 (8%)

Query: 136 ANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 195
           ANE    R  EIIG +   K VH        +S ND   + + I     +  +L P L  
Sbjct: 91  ANE---RRLGEIIGRDIAGK-VHT------GRSRNDQVVTDLRIYCRDVVNDNLFPALKG 140

Query: 196 LRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLA 255
           L D   K++    +I+  G THLQ A P+      S Y    T    R++Q LH L    
Sbjct: 141 LVDVLIKRAKGEINILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLDQILHRLNQSP 200

Query: 256 QGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTA-PNKFEALAAHDAVVECSGALNTLA 314
            G  A+        G    I  +   E G+ F +   N   A++  D +VE         
Sbjct: 201 LGAGALA-------GHPYGIDREFLAE-GLGFNSVIGNSMVAVSDRDFIVELMFWGTLFM 252

Query: 315 CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 372
             + + A D+  +      G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 253 NHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON}
           Anc_1.354 YHR018C
          Length = 462

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 65/243 (26%), Positives = 96/243 (39%), Gaps = 21/243 (8%)

Query: 135 NANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELT 194
            ANE    R  EIIG +   K VH        +S ND   + + I     +   L P +T
Sbjct: 90  TANE---RRLGEIIGRDIAGK-VHT------GRSRNDQCVTDLRIYCRDVLNEKLFPGMT 139

Query: 195 ALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFL 254
           +L +   K+++E   I+  G THLQ A P+      S Y    T  + R++Q L      
Sbjct: 140 SLIEVLIKRAEEEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDLKRLKQILERFNKS 199

Query: 255 AQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFK-TAPNKFEALAAHDAVVECSGALNTL 313
             G  A+        G    I  +   E G+ F     N   A++  D VVE        
Sbjct: 200 PLGAGALA-------GHPYGIDREFLAE-GLGFDGVIGNSLVAVSDRDFVVELMFWGTLF 251

Query: 314 ACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNN 373
              + + A D+  + S    G+ +LS      GSS+MP K N    E +     +V G+ 
Sbjct: 252 MNHISRFAEDL-VIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGDL 309

Query: 374 AAI 376
           A  
Sbjct: 310 AGF 312

>Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 63/239 (26%), Positives = 93/239 (38%), Gaps = 21/239 (8%)

Query: 135 NANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELT 194
            ANE    R  E+IG +   K VH        +S ND   + + I     +  SL P + 
Sbjct: 90  TANE---RRLGELIGRDIAGK-VHT------GRSRNDQVVTDLRIYCRDVVNDSLFPAMK 139

Query: 195 ALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFL 254
            L D   K+++    I+  G THLQ A P+      S Y    T    R+ Q LH L   
Sbjct: 140 GLVDVLVKRAEGEMDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLVQILHRLNQS 199

Query: 255 AQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTA-PNKFEALAAHDAVVECSGALNTL 313
             G  A+        G    I  +   E G+ F +   N   A++  D +VE        
Sbjct: 200 PLGAGALA-------GHPYGIDREFLAE-GLGFNSVIGNSLVAVSDRDFIVELMFWGTLF 251

Query: 314 ACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 372
              + + A D+  +      G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 252 MNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 93/238 (39%), Gaps = 21/238 (8%)

Query: 136 ANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 195
           ANE    R  E+IG +   K VH        +S ND   + + I     +  +L P L  
Sbjct: 91  ANE---RRLGELIGRDIAGK-VHT------GRSRNDQVVTDLRIYCRDVVNGTLFPALKG 140

Query: 196 LRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLA 255
           L D   K+++    I+  G THLQ A P+      S Y    T    R+ Q LH L    
Sbjct: 141 LVDVLIKRAEGEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLNQSP 200

Query: 256 QGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTA-PNKFEALAAHDAVVECSGALNTLA 314
            G  A+        G    I  +   E G+ F +   N   A++  D +VE         
Sbjct: 201 LGAGAL-------AGHPYGIDREFLAE-GLGFNSVIGNSLVAVSDRDFIVELMFWGTLFM 252

Query: 315 CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 372
             + + A D+  +      G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 253 NHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa]
           {ON} Anc_1.354 YHR018C
          Length = 462

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 65/238 (27%), Positives = 98/238 (41%), Gaps = 21/238 (8%)

Query: 136 ANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 195
           ANE    R  EIIG +   K VH        +S ND   + + I     +   L P LT+
Sbjct: 91  ANE---RRLGEIIGRDIAGK-VHT------GRSRNDQCVTDLRIYCRDVLNEKLFPALTS 140

Query: 196 LRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLA 255
           L     K+ +E   I+  G THLQ A P+      S Y    T  + R++Q L  ++F  
Sbjct: 141 LIQVLIKRGEEEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDLNRLKQIL--VRF-- 196

Query: 256 QGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFK-TAPNKFEALAAHDAVVECSGALNTLA 314
              + +G G     G    I  +   E G++F     N   A++  D VVE         
Sbjct: 197 -NKSPLGAG--ALAGHPYGIDREFLAE-GLEFNGVIGNSLVAVSDRDFVVELMFWSTLFM 252

Query: 315 CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 372
             + + A D+  + S    G+ +L+      GSS+MP K N    E +     +V G+
Sbjct: 253 NHISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 464

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 91/237 (38%), Gaps = 21/237 (8%)

Query: 136 ANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 195
           ANE    R  EIIG E   K VH        +S ND   + M I     +   LLP L A
Sbjct: 92  ANE---RRLGEIIGREISGK-VHT------GRSRNDQVATDMRIYCRDILNEVLLPALQA 141

Query: 196 LRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLA 255
                  ++ E   ++  G THLQ A P+      S Y    T    R++Q +  L    
Sbjct: 142 FIKVLTTRAKEEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYNRLKQIVERLNKSP 201

Query: 256 QGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFK-TAPNKFEALAAHDAVVECSGALNTLA 314
            G  A+        G    I  +     G+ F+    N   A++  D VVE         
Sbjct: 202 LGAGALA-------GHPYGIDREFLAR-GLGFQGVIGNSLTAVSDRDFVVEIMFWGTLFM 253

Query: 315 CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 371
             + + + D+  + S    G+ +LS      GSS+MP K NP   E +     +V G
Sbjct: 254 NHISRFSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNPDSLELLRGKAGRVFG 308

>KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.354
           YHR018C
          Length = 462

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 63/243 (25%), Positives = 91/243 (37%), Gaps = 21/243 (8%)

Query: 135 NANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELT 194
            ANE    R  EIIG        H     +  +S ND   + M I     +   LLP + 
Sbjct: 90  TANE---RRLGEIIGR-------HIAGKVHTGRSRNDQVVTDMRIYCRDILNEKLLPFMA 139

Query: 195 ALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFL 254
            L     K+++     +  G THLQ A P+      S Y    T    R++Q L  L   
Sbjct: 140 DLIKVLVKRAENEIDTLMPGYTHLQRAQPIRWAHWLSSYATYFTEDYKRLKQILERLNVS 199

Query: 255 AQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDF-KTAPNKFEALAAHDAVVECSGALNTL 313
             G  A+        G    I  +   E G++F     N   A++  D VVE        
Sbjct: 200 PLGAGALA-------GHPYGIDREFLAE-GLNFGGVIGNSLVAVSDRDFVVELMFWGTLF 251

Query: 314 ACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNN 373
              + + A D+  + S    G+ +LS      GSS+MP K N    E +     +V G+ 
Sbjct: 252 MNHISRFAEDL-IIYSTAEFGFVKLS-DSYSTGSSLMPQKKNADSLELLRGKSGRVFGDL 309

Query: 374 AAI 376
           A  
Sbjct: 310 AGF 312

>YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}
           ARG4Argininosuccinate lyase, catalyzes the final step in
           the arginine biosynthesis pathway
          Length = 463

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 93/239 (38%), Gaps = 21/239 (8%)

Query: 135 NANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELT 194
            ANE    R  E+IG +   K VH        +S ND   + + I     +  +L P L 
Sbjct: 90  TANE---RRLGELIGRDIAGK-VHT------GRSRNDQVVTDLRIYCRDIVNDTLFPALK 139

Query: 195 ALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFL 254
            L +   K+++    ++  G THLQ A P+      S Y    T    R+ Q LH L   
Sbjct: 140 GLVEVLIKRAEGEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLNQS 199

Query: 255 AQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTA-PNKFEALAAHDAVVECSGALNTL 313
             G  A+        G    I  +   E G+ F +   N   A++  D +VE        
Sbjct: 200 PLGAGALA-------GHPYGIDREFLAE-GLGFNSVIGNSLVAVSDRDFIVELMFWGTLF 251

Query: 314 ACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 372
              + + A D+  +      G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 252 MNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly
           similar to uniprot|P04076 Saccharomyces cerevisiae
           YHR018C ARG4 Argininosuccinate lyase catalyzes the final
           step in the arginine biosynthesis pathway
          Length = 462

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 96/244 (39%), Gaps = 25/244 (10%)

Query: 136 ANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 195
           ANE    R  EIIG +   K VH        +S ND   + M I     +   LLP L  
Sbjct: 91  ANE---RRLGEIIGRDIAGK-VHT------GRSRNDQVVTDMRIFCRDTVNEKLLPGLKE 140

Query: 196 LRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLA 255
           L     K++++    +  G THLQ A P+      S Y    T  + R+ Q L       
Sbjct: 141 LVSVMVKRAEKEIGYLMPGYTHLQRAQPIRWSHWLSSYATYFTEDLKRLRQLLERFNQSP 200

Query: 256 QGGTAVG---TGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNT 312
            G  A+     G++      E +AE++  +  I      N   A++  D VVE       
Sbjct: 201 LGAGALAGHPYGIDR-----EFLAEELGFQGVI-----GNSLVAVSDRDFVVELMFWGTL 250

Query: 313 LACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 372
               + + A D+  + S    G+ +L+      GSS+MP K N    E +     +V G+
Sbjct: 251 FMNHISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

Query: 373 NAAI 376
            A  
Sbjct: 309 LAGF 312

>TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.354
           YHR018C
          Length = 466

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 90/237 (37%), Gaps = 21/237 (8%)

Query: 136 ANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 195
           ANE    R  EIIG        H     +  +S ND   + + I     +   LLP +  
Sbjct: 91  ANE---RRLGEIIG-------THIAGKVHTGRSRNDQCVTDLRIYCRDILVEKLLPFMID 140

Query: 196 LRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLA 255
           L     K+++    I+  G THLQ A P+      S Y    T    R++Q L  L    
Sbjct: 141 LVQVITKRAENEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQVLERLNKCP 200

Query: 256 QGGTAVGTGLNTKVGFAEKIAEQ-VSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLA 314
            G  A+        G    I  Q +S E G +     N   A++  D +V+         
Sbjct: 201 LGAGAIA-------GHPYGIDRQYLSDELGFN-SIIGNSLVAVSDRDFIVDIMFWSTLFM 252

Query: 315 CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 371
             + + + D+  + S    G+ +LS      GSS+MP K N    E +     +V G
Sbjct: 253 NHISRFSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFG 307

>TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.354
           YHR018C
          Length = 465

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 90/241 (37%), Gaps = 19/241 (7%)

Query: 136 ANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 195
           ANE    R  EIIG     K VH        +S ND   + + I     +   L P+L A
Sbjct: 91  ANE---RRLGEIIGRNIAGK-VHT------GRSRNDQCVTDLRIYCRDLLNDKLFPDLQA 140

Query: 196 LRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLA 255
           L D   K+  E   ++  G THLQ A P+      S Y    T    R+ Q +  +    
Sbjct: 141 LVDVMIKRGKEEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDFKRLRQIMDRIN--- 197

Query: 256 QGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLAC 315
           Q     G       G      E ++   G D     N   A++  D +VE          
Sbjct: 198 QSPLGAGALAGHPYGIDR---EFLAAGLGFD-GVIGNSLVAVSDRDFIVELMFWGTLFMN 253

Query: 316 SLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAA 375
            + + A D+  + S    G+ +L+      GSS+MP K N    E +     +V G+ A 
Sbjct: 254 HISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGDLAG 311

Query: 376 I 376
            
Sbjct: 312 F 312

>Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]
           {ON} complement(330965..332347) [1383 nt, 461 aa]
          Length = 460

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 65/242 (26%), Positives = 92/242 (38%), Gaps = 21/242 (8%)

Query: 136 ANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 195
           ANE    R  E+IG +   K VH        +S ND   + + I     I   LLP L +
Sbjct: 89  ANE---RRLGELIGTDISGK-VHT------GRSRNDQCVTDLRIYCRDIIQDKLLPSLKS 138

Query: 196 LRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLA 255
           L     K+ +    I+  G THLQ A P+      S Y    T    R++Q L  L    
Sbjct: 139 LIQVLVKRGEGEIGILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQLLDRLNVSP 198

Query: 256 QGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFK-TAPNKFEALAAHDAVVECSGALNTLA 314
            G  A+        G    I  +     G+ F     N   A++  D VVE         
Sbjct: 199 LGAGALA-------GHPYGIDREFLA-NGLGFNGVIGNSLVAVSDRDFVVELLFWGTLFM 250

Query: 315 CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNA 374
             + + A D+  + S    G+  LS      GSS+MP K N    E +     +V GN +
Sbjct: 251 NHISRFAEDL-IIYSTAEFGFITLS-DAYSTGSSLMPQKKNSDSLELLRGKSGRVFGNLS 308

Query: 375 AI 376
            +
Sbjct: 309 GL 310

>Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 86/186 (46%), Gaps = 19/186 (10%)

Query: 189 LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 248
           ++P+L  + +   K + E+  +  +G TH Q A   TLG+  + ++Q+L   +   E++ 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFERAR 187

Query: 249 HHLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 300
           + +      GT        A+  G + KV   E + E+V++  G D K  P   +   + 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDERVTELLGFD-KVYPVTGQTY-SR 242

Query: 301 DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 360
              ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243 KIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 361 AMTQVC 366
              +VC
Sbjct: 300 ---RVC 302

>YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}
           ADE13Adenylosuccinate lyase, catalyzes two steps in the
           'de novo' purine nucleotide biosynthetic pathway;
           expression is repressed by adenine and activated by
           Bas1p and Pho2p; mutations in human ortholog ADSL cause
           adenylosuccinase deficiency
          Length = 482

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 86/186 (46%), Gaps = 19/186 (10%)

Query: 189 LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 248
           ++P+L  + +   K + E+  +  +G TH Q A   TLG+  + ++Q+L   +   E++ 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 249 HHLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 300
           + +      GT        A+  G + KV   E + E+V++  G D K  P   +   + 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDERVTELLGFD-KVYPVTGQTY-SR 242

Query: 301 DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 360
              ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243 KIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 361 AMTQVC 366
              +VC
Sbjct: 300 ---RVC 302

>Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 85/186 (45%), Gaps = 19/186 (10%)

Query: 189 LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 248
           ++P+L  + +   K + E+  +  +G TH Q A   TLG+  + ++Q+L   +   E++ 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 249 HHLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 300
           + +      GT        A+  G + KV   E + E+V++  G D K  P   +   + 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDERVTELLGFD-KVYPVTGQTY-SR 242

Query: 301 DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 360
              ++    L++ A +  K+A DIR L +       E    + + GSS M  K NP + E
Sbjct: 243 KIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNPMRCE 299

Query: 361 AMTQVC 366
              +VC
Sbjct: 300 ---RVC 302

>CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359w ADE13
          Length = 482

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 87/192 (45%), Gaps = 31/192 (16%)

Query: 189 LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 248
           ++P+L  + +   K + E+  +  +G TH Q A   TLG+  + ++Q+L   +   E++ 
Sbjct: 128 VIPKLVNVINRLAKFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 249 HHLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDF------KTAPNKF 294
           + +      GT        A+  G + KV   E++ E+V++  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EELDERVTELLGFDTVYPVTGQTYSRKI 244

Query: 295 EALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 354
           +        ++    L++ A S  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 355 NPTQNEAMTQVC 366
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018c ARLY
          Length = 461

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 94/237 (39%), Gaps = 21/237 (8%)

Query: 136 ANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 195
           ANE    R  E+IG +   K VH        +S ND   + M I     +   + P + +
Sbjct: 92  ANE---RRLGELIGRDIAGK-VHT------GRSRNDQVVTDMRIYCREILNEKIFPAMKS 141

Query: 196 LRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLA 255
           L +    ++++   I+  G THLQ A P+      S Y    T  + R+EQ    L    
Sbjct: 142 LINVLVNRAEKEIDILMPGYTHLQRAQPIRWAHWLSSYATYFTEDLKRLEQIAERLN--- 198

Query: 256 QGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFK-TAPNKFEALAAHDAVVECSGALNTLA 314
              + +G+G     G    I  Q   E G+ F     N   A++  D VVE         
Sbjct: 199 --KSPLGSG--ALAGHPYGIDRQFLAE-GLGFNGVIGNSLVAVSDRDFVVELMFWATLFM 253

Query: 315 CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 371
             + + + D+  + S    G+ +LS      GSS+MP K N    E +     +V G
Sbjct: 254 NHVSRFSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFG 308

>TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 85/192 (44%), Gaps = 31/192 (16%)

Query: 189 LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 248
           ++P+L  + D   K + E+  +  +G TH Q A   TLG+  + ++Q+L   +    ++ 
Sbjct: 128 IIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRSTLWIQELLWDLRNFVRAR 187

Query: 249 HHLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDF------KTAPNKF 294
           + L      GT        A+  G + KV   E++ E+V++  G D       +T   K 
Sbjct: 188 NDLGLRGVKGTTGTQASFLALFHGNHDKV---EELDERVTELLGFDTVYPVTGQTYSRKI 244

Query: 295 EALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 354
           +        ++    L + A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 355 NPTQNEAMTQVC 366
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {ON}
           similar to Ashbya gossypii AEL019W
          Length = 470

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 70/288 (24%), Positives = 110/288 (38%), Gaps = 40/288 (13%)

Query: 92  LGTLDPE----ISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEI 147
           +G LD E    I K + +   E   GK  +H            +    ANE    R  E+
Sbjct: 52  IGLLDVEELSLIHKGLLEIESEWSSGKFEEH---------PDDEDIHTANE---RRLGEL 99

Query: 148 IGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEF 207
           IG     K VH        +S ND   + M I     +   +LP +++       ++ E 
Sbjct: 100 IGTAVAGK-VHT------GRSRNDQVATDMRIYCREILNEKILPAVSSFIRVLINRAREE 152

Query: 208 SSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVG---TG 264
             ++  G THLQ A P+      S Y    T    R+ Q +  L     G  A+     G
Sbjct: 153 VDVLMPGYTHLQRAQPIRWSHWLSCYATYFTEDYNRLRQVVERLNQSPLGAGALAGHPYG 212

Query: 265 LNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDI 324
           ++ K      +AEQ+    GI      N   A++  D V+E     +     + + A D+
Sbjct: 213 IDRKY-----LAEQLGF-NGI----IGNSLVAVSDRDFVIEIMFWGSLFMNHISRFAEDL 262

Query: 325 RYLGSGPRCGYGELSLPE-NEPGSSIMPGKVNPTQNEAMTQVCVQVMG 371
               +     +G ++L +    GSS+MP K NP   E +     +V G
Sbjct: 263 IIYSTAE---FGFINLADAYSTGSSLMPQKKNPDSLELLRGKSGRVFG 307

>Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 85/186 (45%), Gaps = 19/186 (10%)

Query: 189 LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 248
           ++P+L  + +   K + E+  +  +G TH Q A   TLG+  + ++Q+L   +   E++ 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 249 HHLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 300
           + +      GT        A+  G + KV   E +  +V++  G D K  P   +   + 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDARVTELLGFD-KVYPVTGQTY-SR 242

Query: 301 DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 360
              ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243 KIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 361 AMTQVC 366
              +VC
Sbjct: 300 ---RVC 302

>AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR018C (ARG4)
          Length = 469

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 58/242 (23%), Positives = 90/242 (37%), Gaps = 19/242 (7%)

Query: 135 NANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELT 194
            ANE    R  EIIG        H +   +  +S ND   + M +     +   + P L 
Sbjct: 90  TANE---RRLGEIIGR-------HISGKVHTGRSRNDQVATDMRLYCREMLQDKVEPALF 139

Query: 195 ALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFL 254
            L      ++ E   ++  G THLQ A P+      S Y         R+++ +  L   
Sbjct: 140 ELIKVLLHRAREEIDVLMPGYTHLQRAQPIRWSHWLSCYATYFVEDFKRLKEVIARLN-- 197

Query: 255 AQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLA 314
            Q     G       G      E ++ E G D     N   A++  D VVE     +   
Sbjct: 198 -QSPLGAGALAGHPYGIDR---EYLACELGFD-GVIGNSMTAVSDRDFVVEIMSWGSLFM 252

Query: 315 CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNA 374
             + ++A D+  + S    G+ +L+      GSS+MP K NP   E +     +V G  A
Sbjct: 253 NHISRLAEDL-IIYSTAEFGFVKLA-DAYSTGSSLMPQKRNPDSLELLRGKSGRVFGQLA 310

Query: 375 AI 376
             
Sbjct: 311 GF 312

>TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.354
           YHR018C
          Length = 463

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 95/240 (39%), Gaps = 25/240 (10%)

Query: 136 ANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 195
           ANE    R  EIIG  K S +VH        +S ND   + + I     ++  LL  L  
Sbjct: 91  ANE---RRLGEIIG-TKISGKVHT------GRSRNDQCVTDLRIYCREYLSDKLLKNLET 140

Query: 196 LRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLA 255
           L +    +++E    +  G THLQ A P+      S Y         R+ Q    L    
Sbjct: 141 LINVLINRAEEEIEFIMPGYTHLQRAQPIRWSHWLSSYATYFLEDYKRLVQLKERLNKSP 200

Query: 256 QGGTAVG---TGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNT 312
            G  A+     G++      E +AE++  ++ I      N   A++  D VVE       
Sbjct: 201 LGAGALAGHPYGID-----REYLAEKLGFDSVI-----GNSLVAVSDRDFVVEILFWSTL 250

Query: 313 LACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 372
               + + A D+  + S    G+ +LS      GSS+MP K N    E +     +V GN
Sbjct: 251 FMNHISRFAEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGN 308

>Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar to
           Ashbya gossypii ABL006C
          Length = 482

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 88/194 (45%), Gaps = 35/194 (18%)

Query: 189 LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 248
           L+P+L  + +     + ++  +  +G TH Q A   TLG+  + ++Q+L   +    ++ 
Sbjct: 128 LIPKLVNVINRLSTFAIKYKDLPVLGWTHYQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 249 HHLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDF------KTAPNKF 294
           + + F    GT        A+  G + KV   E + ++V++ +G D       +T   K 
Sbjct: 188 NDIGFRGVKGTTGTQASFLALFHGDHDKV---EALDKRVAELSGFDIIYPVTGQTYSRKV 244

Query: 295 EALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLP--ENEPGSSIMPG 352
           +        ++  G L++ A +  K+A DIR L +       EL  P   ++ GSS M  
Sbjct: 245 D--------IDVLGPLSSFAATSHKLATDIRLLAN-----LKELEEPFEASQIGSSAMAY 291

Query: 353 KVNPTQNEAMTQVC 366
           K NP + E   +VC
Sbjct: 292 KRNPMRCE---RVC 302

>NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 87/194 (44%), Gaps = 35/194 (18%)

Query: 189 LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 248
           ++P+L  + D   K + E+  +  +G TH Q A   TLG+  + ++Q+L   +    ++ 
Sbjct: 128 VIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRAR 187

Query: 249 HHLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDF------KTAPNKF 294
           + +      GT        A+  G + KV   E + ++V++  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKV---EALDKRVTELLGFDTVYPVTGQTYSRKI 244

Query: 295 EALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLP--ENEPGSSIMPG 352
           +        ++    L++ A +  K+A DIR L +       EL  P  +++ GSS M  
Sbjct: 245 D--------IDVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAY 291

Query: 353 KVNPTQNEAMTQVC 366
           K NP + E   +VC
Sbjct: 292 KRNPMRCE---RVC 302

>Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359W
           (ADE13) - Adenylosuccinate Lyase [contig 198] FULL
          Length = 482

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 82/189 (43%), Gaps = 25/189 (13%)

Query: 189 LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 248
           L+P+L  + D   K + E+  +  +G TH Q A   TLG+  + ++Q+L   +    ++ 
Sbjct: 128 LIPKLVNVIDRLSKFAMEWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 249 HHLKFLAQGGTAVGTG-----LNTKVGFAEKIAEQVSKETGIDF------KTAPNKFEAL 297
           + +      GT    G      ++     E + ++V++  G D       +T   K +  
Sbjct: 188 NDIGLRGVKGTTGTQGSFLALFHSDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID-- 245

Query: 298 AAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPT 357
                 ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246 ------IDVLAPLSSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPM 296

Query: 358 QNEAMTQVC 366
           + E   +VC
Sbjct: 297 RCE---RVC 302

>NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 84/192 (43%), Gaps = 31/192 (16%)

Query: 189 LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 248
           ++P+L  + D   K + E+  +  +G TH Q A   TLG+  + ++Q+L   +    ++ 
Sbjct: 128 IIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 249 HHLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDF------KTAPNKF 294
           + +      GT        A+  G + KV   E + ++V++  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKV---EALDKRVTELLGFDTVYPVTGQTYSRKI 244

Query: 295 EALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 354
           +        ++    L + A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLASFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKR 293

Query: 355 NPTQNEAMTQVC 366
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]
           {ON} YHR018C (ARG4) - argininosuccinate lyase [contig
           260] FULL
          Length = 465

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 68/284 (23%), Positives = 106/284 (37%), Gaps = 50/284 (17%)

Query: 109 EVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQS 168
           E+I+G+   +     F    G +    ANE    R  EIIG        H     +  +S
Sbjct: 70  EIIRGEWASN----SFVEKDGDEDIHTANE---RRLGEIIGR-------HIAGKVHTGRS 115

Query: 169 SNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQ 228
            ND   + M I    E   +L   L  L  +  ++S++    +  G THLQ A P+    
Sbjct: 116 RNDQVATDMRIYC-REALDNLAKILEDLIGAILQRSEQEIDALMPGYTHLQRAQPIRWSH 174

Query: 229 EFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTG--------LNTKVGFAEKIAEQVS 280
             + Y    T    R++Q    L     G  A+           L  ++GF++ I     
Sbjct: 175 WLNLYATYFTEDFKRLKQIRERLNVSPLGCGALAGHPYGIDREFLAERLGFSDVIG---- 230

Query: 281 KETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLF-----KIANDIRYLGSGPRCGY 335
                      N  +A++  D VVE         CSLF     + + D+  + S     +
Sbjct: 231 -----------NSLQAVSDRDFVVEI-----MFWCSLFMNHISRFSEDL-IIYSTAEFNF 273

Query: 336 GELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFA 379
            +LS      GSS+MP K NP   E +     +V G+ A    +
Sbjct: 274 VKLS-DAYSTGSSLMPQKKNPDSLELLRGKSGRVFGSLAGFMMS 316

>ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 82/186 (44%), Gaps = 19/186 (10%)

Query: 189 LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 248
           ++P+L  + D   K +  +  +  +G TH Q A   TLG+  + ++Q L   +   +++ 
Sbjct: 128 IIPKLINVIDRLSKFALNYKDVPVLGWTHFQPAQLTTLGKRVTLWIQDLLWDLRNFDRAR 187

Query: 249 HHLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 300
           + +      GT        A+  G + KV   E++ ++V++  G  F+T         + 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EELDQRVTELLG--FETVYPVTGQTYSR 242

Query: 301 DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 360
              ++    L + A +  K+A DIR L +       E    + + GSS M  K NP + E
Sbjct: 243 KIDIDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNPMRCE 299

Query: 361 AMTQVC 366
              +VC
Sbjct: 300 ---RVC 302

>Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON}
           (40749..42197) [1449 nt, 483 aa]
          Length = 482

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 84/192 (43%), Gaps = 31/192 (16%)

Query: 189 LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 248
           ++P+L  + D   K + E+  +  +G TH Q A   T+G+  + ++Q+L   +    ++ 
Sbjct: 128 IIPKLVNVIDRLAKFASEYKDLPVLGWTHFQPAQLTTMGKRATLWIQELLWDLRNFVRAR 187

Query: 249 HHLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDF------KTAPNKF 294
           + +      GT        A+  G + KV   E + ++V +  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDDDKV---EALDKRVVELLGFDTVYPVTGQTYSRKI 244

Query: 295 EALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 354
           +        ++    L++ A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 355 NPTQNEAMTQVC 366
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 85/192 (44%), Gaps = 31/192 (16%)

Query: 189 LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 248
           ++P+L  + D   K + ++  +  +G TH Q A   TLG+  + ++Q+L   +    ++ 
Sbjct: 128 VIPKLVNVIDRLSKFALQYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFVRAR 187

Query: 249 HHLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDF------KTAPNKF 294
           + +      GT        A+  G + KV   E + ++V++  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKV---EALDKRVTELLGFDTVYPVTGQTYSRKI 244

Query: 295 EALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 354
           +        ++    L++ A S  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 355 NPTQNEAMTQVC 366
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]
           {ON} highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 465

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 68/272 (25%), Positives = 107/272 (39%), Gaps = 40/272 (14%)

Query: 109 EVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQS 168
           E+I+G+   +     F    G +    ANE    R  EIIG        H     +  +S
Sbjct: 70  EIIRGEWASN----SFVEKDGDEDIHTANE---RRLGEIIGR-------HIAGKVHTGRS 115

Query: 169 SNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQ 228
            ND   + M I    E   ++   L  L  +  +++++    +  G THLQ A P+    
Sbjct: 116 RNDQVATDMRIYC-REALDNMAKILKDLVGAILQRAEQEIDALMPGYTHLQRAQPIRWSH 174

Query: 229 EFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVG---TGLNTKVGFAEKIAEQVSKETGI 285
             + Y    T    R++Q    L     G  A+     G++      E IAE++    G 
Sbjct: 175 WLNLYATYFTEDFKRLKQIRERLNVSPLGCGALAGHPYGIDR-----EHIAERL----GF 225

Query: 286 DFKTAPNKFEALAAHDAVVECSGALNTLACSLF-----KIANDIRYLGSGPRCGYGELSL 340
           D     N  +A++  D VVE         CSLF     + + D+  + S     + +LS 
Sbjct: 226 D-GVIGNSLQAVSDRDFVVEI-----LFWCSLFMNHISRFSEDL-IIYSTAEFNFVKLS- 277

Query: 341 PENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 372
                GSS+MP K NP   E +     +V G+
Sbjct: 278 DAYSTGSSLMPQKKNPDSLELLRGKSGRVFGS 309

>KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 84/192 (43%), Gaps = 31/192 (16%)

Query: 189 LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 248
           L+P+L  + +   K +     +  +G TH Q A   TLG+  + ++Q+L   +   E++ 
Sbjct: 128 LIPKLVNVINRLCKFAMANKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 249 HHLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDF------KTAPNKF 294
           + +      GT        A+  G + KV   EK+ E+V +  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHNKV---EKLDERVVELLGFDTVYPVTGQTYSRKI 244

Query: 295 EALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 354
           +        ++    L++ A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDAFAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 355 NPTQNEAMTQVC 366
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 51/213 (23%), Positives = 94/213 (44%), Gaps = 33/213 (15%)

Query: 189 LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 248
           ++P+L  + +     + E+  +  +G TH Q A   TLG+  + ++Q+L   +   E++ 
Sbjct: 128 VIPKLVNVINRLANFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 249 HHLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDF------KTAPNKF 294
           + +      GT        A+  G + KV   E++ E+V +  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EELDERVVELLGFDTVYPVTGQTYSRKI 244

Query: 295 EALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 354
           +        ++    L + A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVVSPLVSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 355 NPTQNEAMTQVC--VQVMGNNAAITFAGASGQF 385
           NP + E   +VC   + +G+  + T   AS Q+
Sbjct: 294 NPMRCE---RVCSLARHLGSLLSDTVQTASVQW 323

>KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]
           {ON} highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 83/186 (44%), Gaps = 19/186 (10%)

Query: 189 LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 248
           L+P+L  + +   K + E+  +  +G TH Q A   TLG+  + ++Q+L   +    ++ 
Sbjct: 128 LIPKLVNVINRLSKFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 249 HHLKFLAQGGTAVGTGLNTKVGF------AEKIAEQVSKETGIDFKTAPNKFEALAAHDA 302
           + +      GT  GT  +    F       E + ++V++  G  F T         +   
Sbjct: 188 NDIGLRGVKGTT-GTQASFLTLFHGDHDKVEALDKRVAELLG--FSTVYPVTGQTYSRKI 244

Query: 303 VVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLP--ENEPGSSIMPGKVNPTQNE 360
            ++    L++ A +  K+A DIR L +       EL  P  +++ GSS M  K NP + E
Sbjct: 245 DIDVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 361 AMTQVC 366
              +VC
Sbjct: 300 ---RVC 302

>SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 85/192 (44%), Gaps = 31/192 (16%)

Query: 189 LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 248
           L+P+L  + +   + + E+  +  +G TH Q A   TLG+  + ++Q+L   +    ++ 
Sbjct: 128 LIPKLVNVINRLSQFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 249 HHLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDF------KTAPNKF 294
           + +      GT        A+  G + KV   E + ++V++  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKV---EALDKRVTELLGFDTVYPVTGQTYSRKI 244

Query: 295 EALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 354
           +        ++    L++ A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLSSFAATAHKMATDIRLLANLKEM---EEPFEKSQIGSSAMAYKR 293

Query: 355 NPTQNEAMTQVC 366
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR359W
           (ADE13)
          Length = 482

 Score = 38.1 bits (87), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 43/190 (22%), Positives = 82/190 (43%), Gaps = 27/190 (14%)

Query: 189 LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 248
           ++P+L  + +   K + E+  +  +G TH Q A   TLG+  + ++Q+L   +    ++ 
Sbjct: 128 IIPKLVNVINRLSKFACEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRAR 187

Query: 249 HHLKFLAQGGTAVGTGLNTKVGF------AEKIAEQVSKETGIDF------KTAPNKFEA 296
           + +      GT  GT  +    F       E + ++V++  G D       +T   K + 
Sbjct: 188 NDIGLRGVKGT-TGTQASFLALFHGDHDRVEALDKRVTELLGFDIVYPVTGQTYSRKID- 245

Query: 297 LAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNP 356
                  ++  G+ ++   +  K+A DIR L +       E    + + GSS M  K NP
Sbjct: 246 -------IDILGSGSSFEATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNP 295

Query: 357 TQNEAMTQVC 366
            + E   +VC
Sbjct: 296 MRCE---RVC 302

>KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 37.7 bits (86), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 84/192 (43%), Gaps = 31/192 (16%)

Query: 189 LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 248
           L+P+L  + +   + + ++  +  +G TH Q A   TLG+  + ++Q+L   +    ++ 
Sbjct: 128 LIPKLVNVINRLSQFALQWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 249 HHLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDF------KTAPNKF 294
           + +      GT        A+  G + KV   E + ++V++  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKV---EALDKRVTELLGFDTVYPVTGQTYSRKI 244

Query: 295 EALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 354
           +        ++    L + A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLCSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKR 293

Query: 355 NPTQNEAMTQVC 366
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 43/192 (22%), Positives = 84/192 (43%), Gaps = 31/192 (16%)

Query: 189 LLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSL 248
           ++P+L  + +     + ++  +  +G TH Q A   TLG+  + ++Q+L   +    ++ 
Sbjct: 128 IIPKLVNVINRLSDFALKYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 249 HHLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETGIDF------KTAPNKF 294
           + +      GT        A+  G + KV   E + ++V++  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKV---EALDKRVTELLGFDTVYPVTGQTYSRKI 244

Query: 295 EALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 354
           +        ++    L++ A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLSPLSSFAATAHKMATDIRLLANLKEM---EEPFEKSQIGSSAMAYKR 293

Query: 355 NPTQNEAMTQVC 366
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W
           (REAL)
          Length = 850

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 43/92 (46%), Gaps = 6/92 (6%)

Query: 84  SAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNR 143
           S A+ ++ L   DP  +K + + +D+   G     F L     G G ++  +  E   N+
Sbjct: 641 SKAMRDDELKASDPLQTKELHEMSDKFESGMKKGKFRLSKGFGGKGLENIKSKREEAQNK 700

Query: 144 AIEIIGGEKGSKQVH------PNNHCNQAQSS 169
            +E   G+K + Q+       PN H N+A+SS
Sbjct: 701 ELEHKKGQKNNDQLENKSDHSPNEHANEAESS 732

>KNAG0D03480 Chr4 complement(625236..628724) [3489 bp, 1162 aa] {ON}
           Anc_4.117 YGL006W
          Length = 1162

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 47/96 (48%), Gaps = 24/96 (25%)

Query: 31  KYRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEAVVRAFG----------- 79
           KY ++TD    IKVP ++  G Q  RS + ++  G   R+PE + ++FG           
Sbjct: 50  KY-LKTDLETGIKVPLNETEGTQNHRSTDRYRKYG-DNRIPERLPKSFGKLIWEAFNDKT 107

Query: 80  -VLKKSAAIVNESLGT---------LDPEISKPIQK 105
            +L  +AAIV+ +LG           DPE   PI+K
Sbjct: 108 MLLLTAAAIVSFALGMYEYFYTPVEYDPE-GNPIKK 142

>TDEL0G04710 Chr7 (860069..861289) [1221 bp, 406 aa] {ON} 
          Length = 406

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 4/43 (9%)

Query: 64  GGARERMPEA----VVRAFGVLKKSAAIVNESLGTLDPEISKP 102
           GG + R+P A    +VR   VLK+ A  VNES      E+ KP
Sbjct: 281 GGVQRRLPTAHIHPLVRVHPVLKRKALFVNESFSRRIVELKKP 323

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.130    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,420,904
Number of extensions: 1988811
Number of successful extensions: 5873
Number of sequences better than 10.0: 71
Number of HSP's gapped: 6037
Number of HSP's successfully gapped: 71
Length of query: 493
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 379
Effective length of database: 40,409,475
Effective search space: 15315191025
Effective search space used: 15315191025
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)