Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E00924g6.12ON97975145e-69
KLTH0C11484g6.12ON89942621e-30
Kwal_56.223596.12ON91932584e-30
Ecym_30156.12ON70782088e-23
KLLA0D00880g6.12ON71781968e-21
ACR014C6.12ON70781932e-20
YEL059C-A (SOM1)6.12ON74811472e-13
Kpol_1032.36.12ON78881446e-13
Smik_5.286.12ON74811447e-13
Suva_5.96.12ON73801403e-12
Skud_5.306.12ON74801351e-11
TDEL0G045906.12ON74811272e-10
ZYRO0F00528g6.12ON77851263e-10
TPHA0M002206.12ON78601124e-08
KNAG0E009306.12ON109721074e-07
NCAS0F002106.12ON7990942e-05
KAFR0L003506.12ON7155872e-04
TBLA0G009906.12ON7890680.14
Skud_15.1486.45ON54842650.98
ZYRO0C07194g6.45ON55828651.2
Suva_15.1596.45ON55028622.6
Smik_4.1472.369ON52527613.5
TDEL0C047703.335ON72653613.8
YOL013C (HRD1)6.45ON55128604.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E00924g
         (97 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E00924g Chr5 (70494..70787) [294 bp, 97 aa] {ON} similar to...   202   5e-69
KLTH0C11484g Chr3 complement(944502..944771) [270 bp, 89 aa] {ON...   105   1e-30
Kwal_56.22359 s56 (64674..64949) [276 bp, 91 aa] {ON} YEL059C-A ...   103   4e-30
Ecym_3015 Chr3 (30115..30327) [213 bp, 70 aa] {ON} similar to As...    85   8e-23
KLLA0D00880g Chr4 (82211..82426) [216 bp, 71 aa] {ON} uniprot|P7...    80   8e-21
ACR014C Chr3 complement(382776..382988) [213 bp, 70 aa] {ON} Syn...    79   2e-20
YEL059C-A Chr5 complement(42400..42624) [225 bp, 74 aa] {ON}  SO...    61   2e-13
Kpol_1032.3 s1032 (3019..3255) [237 bp, 78 aa] {ON} (3019..3255)...    60   6e-13
Smik_5.28 Chr5 complement(44691..44912) [222 bp, 74 aa] {ON} YEL...    60   7e-13
Suva_5.9 Chr5 complement(18353..18571) [219 bp, 73 aa] {ON} YEL0...    59   3e-12
Skud_5.30 Chr5 complement(41436..41657) [222 bp, 74 aa] {ON} YEL...    57   1e-11
TDEL0G04590 Chr7 complement(838052..838276) [225 bp, 74 aa] {ON}...    54   2e-10
ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to...    53   3e-10
TPHA0M00220 Chr13 (44225..44461) [237 bp, 78 aa] {ON} Anc_6.12 Y...    48   4e-08
KNAG0E00930 Chr5 complement(176364..176693) [330 bp, 109 aa] {ON...    46   4e-07
NCAS0F00210 Chr6 (32317..32556) [240 bp, 79 aa] {ON} Anc_6.12 YE...    41   2e-05
KAFR0L00350 Chr12 (63897..64112) [216 bp, 71 aa] {ON} Anc_6.12 Y...    38   2e-04
TBLA0G00990 Chr7 (251428..251664) [237 bp, 78 aa] {ON} Anc_6.12 ...    31   0.14 
Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {...    30   0.98 
ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {...    30   1.2  
Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {...    28   2.6  
Smik_4.147 Chr4 complement(274906..276483) [1578 bp, 525 aa] {ON...    28   3.5  
TDEL0C04770 Chr3 (861756..863936) [2181 bp, 726 aa] {ON} Anc_3.3...    28   3.8  
YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON} ...    28   4.4  

>SAKL0E00924g Chr5 (70494..70787) [294 bp, 97 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A SOM1
          Protein whose overexpression suppresses the imp1
          mutation may be required for the function of the Imp1p
          mitochondrial inner membrane peptidase and/or the
          protein sorting machinery
          Length = 97

 Score =  202 bits (514), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 97/97 (100%), Positives = 97/97 (100%)

Query: 1  MAPPTPVFGKDELESLLKKVKPPCTLKSLIQNECTFNGEEYICVPFKRLFKECLLDSKTK 60
          MAPPTPVFGKDELESLLKKVKPPCTLKSLIQNECTFNGEEYICVPFKRLFKECLLDSKTK
Sbjct: 1  MAPPTPVFGKDELESLLKKVKPPCTLKSLIQNECTFNGEEYICVPFKRLFKECLLDSKTK 60

Query: 61 DGRTSRTVRIEITDRHTNDGILEDQMVKRFWEADLHQ 97
          DGRTSRTVRIEITDRHTNDGILEDQMVKRFWEADLHQ
Sbjct: 61 DGRTSRTVRIEITDRHTNDGILEDQMVKRFWEADLHQ 97

>KLTH0C11484g Chr3 complement(944502..944771) [270 bp, 89 aa] {ON}
          similar to uniprot|Q05676 Saccharomyces cerevisiae
          YEL059C-A SOM1 Protein whose overexpression suppresses
          the imp1 mutation may be required for the function of
          the Imp1p mitochondrial inner membrane peptidase and/or
          the protein sorting machinery
          Length = 89

 Score =  105 bits (262), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 63/94 (67%), Gaps = 9/94 (9%)

Query: 1  MAPPTPVFGKDELESLLKKVKPPCTLKSLIQNECTFNGEEYICVPFKRLFKECLLDSKTK 60
          MAPPT VFGK+EL+ + +K   PC LK+L+QNEC FNG EY+C PFKRLFKEC       
Sbjct: 1  MAPPTLVFGKEELKGIWEKAAEPCFLKALVQNECEFNGHEYVCTPFKRLFKEC------- 53

Query: 61 DGRTSRTVRIEITDRHTNDGILEDQMVKRFWEAD 94
           G   R VRIE+TD+ TN  +  D  V RFWE+ 
Sbjct: 54 -GAGKRIVRIEVTDQDTNH-LAFDATVTRFWESS 85

>Kwal_56.22359 s56 (64674..64949) [276 bp, 91 aa] {ON} YEL059C-A
          (SOM1) - involved in mitochondrial inner peptidase
          function [contig 186] FULL
          Length = 91

 Score =  103 bits (258), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 50/93 (53%), Positives = 64/93 (68%), Gaps = 9/93 (9%)

Query: 1  MAPPTPVFGKDELESLLKKVKPPCTLKSLIQNECTFNGEEYICVPFKRLFKECLLDSKTK 60
          MAPPT VFGK+ELE LL+ V   C  KSL Q+EC F+G +Y+CVPFKR+FKEC +D K  
Sbjct: 1  MAPPTVVFGKEELEPLLRNVMATCIFKSLTQSECNFDGHQYVCVPFKRVFKECKVDGK-- 58

Query: 61 DGRTSRTVRIEITDRHTNDGILEDQMVKRFWEA 93
                ++RIE+TDR+TN     D+MV  FW +
Sbjct: 59 ------SIRIEVTDRNTNKA-KADEMVDSFWNS 84

>Ecym_3015 Chr3 (30115..30327) [213 bp, 70 aa] {ON} similar to
          Ashbya gossypii ACR014C
          Length = 70

 Score = 84.7 bits (208), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 42/78 (53%), Positives = 53/78 (67%), Gaps = 9/78 (11%)

Query: 1  MAPPTPVFGKDELESLLKKVKPPCTLKSLIQNECTFNGEEYICVPFKRLFKECLLDSKTK 60
          MAPPTP+  +DE+E +L + K  C L SLIQNEC F+G  Y+C+PFKRLF+EC L+    
Sbjct: 1  MAPPTPIITRDEVEPILSRTKD-CILASLIQNECHFDGHNYVCIPFKRLFEECTLN---- 55

Query: 61 DGRTSRTVRIEITDRHTN 78
               R VRIE+TD  TN
Sbjct: 56 ----KRRVRIEVTDISTN 69

>KLLA0D00880g Chr4 (82211..82426) [216 bp, 71 aa] {ON}
          uniprot|P78699 Kluyveromyces lactis KLLA0D00880g SOM1
          Protein SOM1 mitochondrial precursor
          Length = 71

 Score = 80.1 bits (196), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 38/78 (48%), Positives = 56/78 (71%), Gaps = 8/78 (10%)

Query: 1  MAPPTPVFGKDELESLLKKVKPPCTLKSLIQNECTFNGEEYICVPFKRLFKECLLDSKTK 60
          MAPPT + G D  + +L++ +  C+LKSL+QNEC FNG +Y+C PFKRLF++C++    K
Sbjct: 1  MAPPTKILGLDTQQRMLQRGEN-CSLKSLVQNECAFNGNDYVCTPFKRLFEQCMV----K 55

Query: 61 DGRTSRTVRIEITDRHTN 78
          DG   R + IE+T+ +TN
Sbjct: 56 DG---RVLNIEVTNLNTN 70

>ACR014C Chr3 complement(382776..382988) [213 bp, 70 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YEL059C-A
          (SOM1)
          Length = 70

 Score = 79.0 bits (193), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 51/78 (65%), Gaps = 9/78 (11%)

Query: 1  MAPPTPVFGKDELESLLKKVKPPCTLKSLIQNECTFNGEEYICVPFKRLFKECLLDSKTK 60
          MAPPTPV  ++E+   L   +  C L SL QNEC F+G  Y+CVPF+RLF+EC L+    
Sbjct: 1  MAPPTPVLTREEVAPALATSRD-CVLASLTQNECHFDGRGYVCVPFQRLFRECTLN---- 55

Query: 61 DGRTSRTVRIEITDRHTN 78
               R VRIEIT+R+TN
Sbjct: 56 ----KRRVRIEITERNTN 69

>YEL059C-A Chr5 complement(42400..42624) [225 bp, 74 aa] {ON}
          SOM1Subunit of the mitochondrial inner membrane
          peptidase, which is required for maturation of
          mitochondrial proteins of the intermembrane space;
          Som1p facilitates cleavage of a subset of substrates;
          contains twin cysteine-x9-cysteine motifs
          Length = 74

 Score = 61.2 bits (147), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 45/81 (55%), Gaps = 9/81 (11%)

Query: 1  MAPPTPVFGKDELESLLKKV--KPPCTLKSLIQNECTFNGEEYICVPFKRLFKECLLDSK 58
          MAPPT +  +D+  + L  +  +  C LK L+Q EC F G EY+C PFKRLF+ C+   K
Sbjct: 1  MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKRLFEHCIAPDK 60

Query: 59 TKDGRTSRTVRIEITDRHTND 79
          +           E+TD +TN 
Sbjct: 61 S-------ATNYEVTDTYTNS 74

>Kpol_1032.3 s1032 (3019..3255) [237 bp, 78 aa] {ON} (3019..3255)
          [237 nt, 79 aa]
          Length = 78

 Score = 60.1 bits (144), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 35/88 (39%), Positives = 49/88 (55%), Gaps = 21/88 (23%)

Query: 1  MAPPTPVFGKDELE------SLLKKVKPPCTLKSLIQNECTFNGE---EYICVPFKRLFK 51
          MAPPTP+  ++E+       +++   K  CTL S+ Q +C F      EYIC+PFKRLF+
Sbjct: 1  MAPPTPIQSREEVLRGKKCLTMVDNKKGKCTLTSITQFQCRFENSYEGEYICLPFKRLFE 60

Query: 52 ECLLDSKTKDGRTSRTVRIEITDRHTND 79
          EC              +RIE+TDR TN+
Sbjct: 61 EC------------SGIRIEVTDRFTNN 76

>Smik_5.28 Chr5 complement(44691..44912) [222 bp, 74 aa] {ON}
          YEL059C-A (REAL)
          Length = 74

 Score = 60.1 bits (144), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 44/81 (54%), Gaps = 9/81 (11%)

Query: 1  MAPPTPVFGKDELESLLKKV--KPPCTLKSLIQNECTFNGEEYICVPFKRLFKECLLDSK 58
          MAPPT +  +D+  + L  +  +  C LK L+Q EC F G +Y+C PFKRLF+ C+   K
Sbjct: 1  MAPPTTIRSRDQALAPLMALDSQASCQLKELVQWECQFKGADYVCSPFKRLFEHCVEHGK 60

Query: 59 TKDGRTSRTVRIEITDRHTND 79
                      E+TD +TN 
Sbjct: 61 P-------ATNYEVTDTYTNS 74

>Suva_5.9 Chr5 complement(18353..18571) [219 bp, 73 aa] {ON}
          YEL059C-A (REAL)
          Length = 73

 Score = 58.5 bits (140), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 45/80 (56%), Gaps = 9/80 (11%)

Query: 1  MAPPTPVFGKDELESLLKKV--KPPCTLKSLIQNECTFNGEEYICVPFKRLFKECLLDSK 58
          MAPPT +  +D+  + L  +  +  C LK L+Q EC F G +Y+C PF+RLF+ C     
Sbjct: 1  MAPPTTIRARDQALAPLATLDSRTHCHLKELVQWECQFKGADYVCSPFRRLFEHC----- 55

Query: 59 TKDGRTSRTVRIEITDRHTN 78
          T  G  +     E+TD +TN
Sbjct: 56 TAPGEAA--TNYEVTDTYTN 73

>Skud_5.30 Chr5 complement(41436..41657) [222 bp, 74 aa] {ON}
          YEL059C-A (REAL)
          Length = 74

 Score = 56.6 bits (135), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 43/80 (53%), Gaps = 9/80 (11%)

Query: 1  MAPPTPVFGKDELESLLKKVKPP--CTLKSLIQNECTFNGEEYICVPFKRLFKECLLDSK 58
          MAPPT +  +D+  + L  +     C LK L+Q EC F   +Y+C PFKRLF+ C+   K
Sbjct: 1  MAPPTTIRSRDQALAPLAALDSHTRCQLKELVQWECQFREADYVCFPFKRLFERCIAPDK 60

Query: 59 TKDGRTSRTVRIEITDRHTN 78
          +           E+TD +TN
Sbjct: 61 S-------ATDYEVTDTYTN 73

>TDEL0G04590 Chr7 complement(838052..838276) [225 bp, 74 aa] {ON}
          Anc_6.12 YEL059C-A
          Length = 74

 Score = 53.5 bits (127), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 42/81 (51%), Gaps = 11/81 (13%)

Query: 1  MAPPTPVFGKDELESLLKKVKPPCTLKSLIQNECTFNGEE---YICVPFKRLFKECLLDS 57
          MAPPTPV  ++EL  + +     C LKSL Q +C         Y CVPFKRLF+EC    
Sbjct: 1  MAPPTPVLAREELPEIPQSKN--CVLKSLTQFQCQLRPAGSGLYECVPFKRLFQEC---- 54

Query: 58 KTKDGRTSRTVRIEITDRHTN 78
            +D       RIE+T   TN
Sbjct: 55 --RDPSGRFKSRIEVTSPLTN 73

>ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A
          Length = 77

 Score = 53.1 bits (126), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 46/85 (54%), Gaps = 18/85 (21%)

Query: 1  MAPPTPVFGKDELESLLKKV-----KPPCTLKSLIQNECTFNGE-EYICVPFKRLFKECL 54
          MAPPTP+   +++    ++V     K  C LKSL Q+ C      EYICVPFKR+F++CL
Sbjct: 1  MAPPTPILTSEQVSRERERVQILKEKNKCELKSLTQHLCHAEAPGEYICVPFKRVFEKCL 60

Query: 55 LDSKTKDGRTSRTVRIEITDRHTND 79
            +            +E+TD  TND
Sbjct: 61 GHA------------LEVTDADTND 73

>TPHA0M00220 Chr13 (44225..44461) [237 bp, 78 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 78

 Score = 47.8 bits (112), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 33/60 (55%), Gaps = 7/60 (11%)

Query: 1  MAPPTPVFGKDELESLLKKVKP----PCTLKSLIQNECTF---NGEEYICVPFKRLFKEC 53
          MAP TPV  ++ + + L+  K      C LK+L Q EC F       YIC PFKRLF+ C
Sbjct: 1  MAPATPVVDREAVAATLQASKQRNRQECELKALTQYECQFVDLESNRYICRPFKRLFEVC 60

>KNAG0E00930 Chr5 complement(176364..176693) [330 bp, 109 aa] {ON}
          Anc_6.12 YEL059C-A
          Length = 109

 Score = 45.8 bits (107), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 2/72 (2%)

Query: 1  MAPPTPVFGKDELESLLKKVKPPCTLKSLIQNECTFNGEEYICVPFKRLFKECLLDSKTK 60
          MAP   V  ++++   L + +  C LK L+Q  C  +G ++ C PF+RLF++C     T 
Sbjct: 1  MAPNVRVLTRNDVP--LPQPQDGCVLKELVQFRCENDGTQWQCAPFRRLFEQCPSQEGTN 58

Query: 61 DGRTSRTVRIEI 72
           G+   T R E+
Sbjct: 59 KGKCVATKRYEV 70

>NCAS0F00210 Chr6 (32317..32556) [240 bp, 79 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 79

 Score = 40.8 bits (94), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 42/90 (46%), Gaps = 24/90 (26%)

Query: 1  MAPPTPVFGKDEL--ESLLKKVKPP---------CTLKSLIQNECTF-NGEEYICVPFKR 48
          MAPP  VFGKD++  ++ L   +           C    L Q +C      +YIC PFKR
Sbjct: 1  MAPPVVVFGKDDIRVKTALSNNRTGETDAETGDGCRQFQLTQFQCQLLEDGQYICFPFKR 60

Query: 49 LFKECLLDSKTKDGRTSRTVRIEITDRHTN 78
          +F+EC            + VR E+T+  +N
Sbjct: 61 VFQEC------------QGVRTEVTNVDSN 78

>KAFR0L00350 Chr12 (63897..64112) [216 bp, 71 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 71

 Score = 38.1 bits (87), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 1  MAPPTPVFGKDELESLLKKVKPPCTLKSLIQNECTFN-GEEYICVPFKRLFKECL 54
          MAP   V   D  E  +K  +  C L SL+Q  C +  G    C PFKR+F ECL
Sbjct: 1  MAPMIRVMDGDAAEREVKGAEG-CQLYSLVQYNCEYRVGGTLECFPFKRMFLECL 54

>TBLA0G00990 Chr7 (251428..251664) [237 bp, 78 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 78

 Score = 30.8 bits (68), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 39/90 (43%), Gaps = 25/90 (27%)

Query: 1  MAPPTPVFGKDELESL-----------LKKVKPPCTLKSLIQNECTFNGEEYI-CVPFKR 48
          MAPP  +  K+EL+ L            KK   P    S+ Q EC  N +  I C PFKR
Sbjct: 1  MAPPVTIQTKEELDILEKVNRKNRKDDTKKSAKPKKY-SITQYECFDNDKGQIECFPFKR 59

Query: 49 LFKECLLDSKTKDGRTSRTVRIEITDRHTN 78
          +F++         G   R    EITD  TN
Sbjct: 60 IFQQV--------GEYRR----EITDETTN 77

>Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {ON}
           YOL013C (REAL)
          Length = 548

 Score = 29.6 bits (65), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 24/42 (57%)

Query: 10  KDELESLLKKVKPPCTLKSLIQNECTFNGEEYICVPFKRLFK 51
           KD LE+LL+ +    T+K+LI +  +FN      V F+ L +
Sbjct: 126 KDRLEALLQSINDSTTMKNLILSRFSFNLVLLAVVDFQILIR 167

>ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013C HRD1 Ubiquitin-protein ligase required for
           endoplasmic reticulum-associated degradation (ERAD) of
           misfolded proteins genetically linked to the unfolded
           protein response (UPR) regulated through association
           with Hrd3p contains an H2 ring finger
          Length = 558

 Score = 29.6 bits (65), Expect = 1.2,   Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 10  KDELESLLKKVKPPCTLKSLIQNECTFN 37
           KD LE+LL+ +    TLKSLI    +FN
Sbjct: 127 KDRLEALLQSIHESTTLKSLICTRFSFN 154

>Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score = 28.5 bits (62), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 19/28 (67%)

Query: 10  KDELESLLKKVKPPCTLKSLIQNECTFN 37
           KD LE+LL+ +    TLK+LI +  +FN
Sbjct: 126 KDRLEALLQSINDSTTLKTLIFSRFSFN 153

>Smik_4.147 Chr4 complement(274906..276483) [1578 bp, 525 aa] {ON}
           YDL088C (REAL)
          Length = 525

 Score = 28.1 bits (61), Expect = 3.5,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 16/27 (59%)

Query: 22  PPCTLKSLIQNECTFNGEEYICVPFKR 48
           P C L++L +N   F+G    C+P+ R
Sbjct: 360 PSCALRALQENGSIFHGALIGCIPYSR 386

>TDEL0C04770 Chr3 (861756..863936) [2181 bp, 726 aa] {ON} Anc_3.335
           YBR094W
          Length = 726

 Score = 28.1 bits (61), Expect = 3.8,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 3/53 (5%)

Query: 5   TPVFGKDELESLLK-KVKPPCTLKSLIQNEC--TFNGEEYICVPFKRLFKECL 54
           TP+    +  S LK +++ PC L++  +  C  T + +EYI +P K  F++ L
Sbjct: 301 TPLRATFQSTSTLKGELELPCPLETQFEGVCAITIDPQEYIYLPLKSAFQKWL 353

>YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON}
           HRD1Ubiquitin-protein ligase; required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins; genetically linked to the unfolded protein
           response (UPR); regulated through association with
           Hrd3p; contains an H2 ring finger; likely plays a
           general role in targeting proteins that persistently
           associate with and potentially obstruct the ER-localized
           translocon
          Length = 551

 Score = 27.7 bits (60), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 19/28 (67%)

Query: 10  KDELESLLKKVKPPCTLKSLIQNECTFN 37
           KD LE+LL+ +    T+K+LI +  +FN
Sbjct: 126 KDRLEALLQSINDSTTMKTLIFSRFSFN 153

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,214,223
Number of extensions: 424463
Number of successful extensions: 909
Number of sequences better than 10.0: 25
Number of HSP's gapped: 893
Number of HSP's successfully gapped: 25
Length of query: 97
Length of database: 53,481,399
Length adjustment: 68
Effective length of query: 29
Effective length of database: 45,684,111
Effective search space: 1324839219
Effective search space used: 1324839219
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)