Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E00902g6.11ON54454428330.0
Ecym_30146.11ON55154418300.0
Kwal_56.223556.11ON54154218040.0
KLTH0C11506g6.11ON54454117860.0
ACR015W6.11ON55254417070.0
Kpol_1032.26.11ON53954015860.0
KLLA0D00858g6.11ON54153715750.0
TPHA0M002106.11ON54552115020.0
TBLA0G009806.11ON55853214740.0
Smik_5.296.11ON55555614720.0
ZYRO0F00506g6.11ON55055914550.0
Suva_5.106.11ON55355014500.0
Skud_5.316.11ON55755914480.0
YEL058W (PCM1)6.11ON55755614450.0
NCAS0F002006.11ON54955314420.0
TDEL0G046006.11ON52853414390.0
NDAI0K028906.11ON56153314110.0
CAGL0B03597g6.11ON54054713940.0
KAFR0L003406.11ON54054613670.0
KNAG0E009406.11ON53852412561e-168
CAGL0M02981g8.840ON61769960.005
TDEL0B005708.840ON630101900.026
NCAS0C004108.840ON62548890.032
KLLA0D01573g8.840ON60766870.051
Kpol_1068.88.840ON63222850.090
TBLA0B032508.840ON64363850.11
Ecym_46118.840ON63079830.18
ABL126W8.840ON62446820.21
KNAG0J002708.840ON62519820.22
Kwal_27.102588.840ON62022820.22
YMR278W (PGM3)8.840ON62219820.23
Suva_13.4668.840ON62219820.24
Skud_13.4508.840ON62219820.25
TPHA0I002508.840ON62919810.27
NDAI0K004108.840ON62624810.30
Smik_13.4918.840ON62219800.35
ZYRO0G14190g8.840ON61019800.38
KLTH0C03872g8.840ON62141790.49
KAFR0B039208.840ON62423780.60
SAKL0D01474g8.840ON62418780.76
NDAI0I028803.514ON761186770.93
Skud_4.6925.523ON646122761.1
TPHA0K006907.418ON2785123707.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E00902g
         (544 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...  1095   0.0  
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...   709   0.0  
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...   699   0.0  
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...   692   0.0  
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...   662   0.0  
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...   615   0.0  
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...   611   0.0  
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...   583   0.0  
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...   572   0.0  
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)   571   0.0  
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...   565   0.0  
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)   563   0.0  
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)   562   0.0  
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...   561   0.0  
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...   560   0.0  
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...   558   0.0  
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....   548   0.0  
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...   541   0.0  
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...   531   0.0  
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...   488   e-168
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...    42   0.005
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...    39   0.026
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...    39   0.032
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...    38   0.051
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...    37   0.090
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...    37   0.11 
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...    37   0.18 
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...    36   0.21 
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...    36   0.22 
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...    36   0.22 
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...    36   0.23 
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...    36   0.24 
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...    36   0.25 
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...    36   0.27 
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...    36   0.30 
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...    35   0.35 
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...    35   0.38 
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...    35   0.49 
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...    35   0.60 
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...    35   0.76 
NDAI0I02880 Chr9 complement(679180..681465) [2286 bp, 761 aa] {O...    34   0.93 
Skud_4.692 Chr4 (1224822..1226762) [1941 bp, 646 aa] {ON} YDR419...    34   1.1  
TPHA0K00690 Chr11 complement(135928..144285) [8358 bp, 2785 aa] ...    32   7.1  

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score = 1095 bits (2833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/544 (97%), Positives = 532/544 (97%)

Query: 1   MVNIQLLEELYDKHCKXXXXXXXXXXXXRYKADVLDTVMFTTGILAAIRSIYLKGQYVGV 60
           MVNIQLLEELYDKHCK            RYKADVLDTVMFTTGILAAIRSIYLKGQYVGV
Sbjct: 1   MVNIQLLEELYDKHCKTGFTYTYGTAGFRYKADVLDTVMFTTGILAAIRSIYLKGQYVGV 60

Query: 61  MITASHNPPQDNGVKIVDPKGEMLDQAWEPFATELANSASKGKQELIKALDKLITKLGID 120
           MITASHNPPQDNGVKIVDPKGEMLDQAWEPFATELANSASKGKQELIKALDKLITKLGID
Sbjct: 61  MITASHNPPQDNGVKIVDPKGEMLDQAWEPFATELANSASKGKQELIKALDKLITKLGID 120

Query: 121 DTESAKITISRDSRESGPRLLQAVIDGTKVLKNVQVVDFNLLTTPQLHFLTYQYNQGSSS 180
           DTESAKITISRDSRESGPRLLQAVIDGTKVLKNVQVVDFNLLTTPQLHFLTYQYNQGSSS
Sbjct: 121 DTESAKITISRDSRESGPRLLQAVIDGTKVLKNVQVVDFNLLTTPQLHFLTYQYNQGSSS 180

Query: 181 KVEESTYYSAFSSAWTKICGLHDINSLPYRVIIDAANGIGGPKVSEMLLKNKFFSSTVSV 240
           KVEESTYYSAFSSAWTKICGLHDINSLPYRVIIDAANGIGGPKVSEMLLKNKFFSSTVSV
Sbjct: 181 KVEESTYYSAFSSAWTKICGLHDINSLPYRVIIDAANGIGGPKVSEMLLKNKFFSSTVSV 240

Query: 241 INNQWQSPELLNESCGADYVKTNQHFPKGVSGNSENECIYCSFDGDADRIVFYYHDEKSK 300
           INNQWQSPELLNESCGADYVKTNQHFPKGVSGNSENECIYCSFDGDADRIVFYYHDEKSK
Sbjct: 241 INNQWQSPELLNESCGADYVKTNQHFPKGVSGNSENECIYCSFDGDADRIVFYYHDEKSK 300

Query: 301 FNLLDGDKISTLFAKFFKELLVAAGAENELKLGVVQTAYANGSSTEYLSSILEVPVSCTA 360
           FNLLDGDKISTLFAKFFKELLVAAGAENELKLGVVQTAYANGSSTEYLSSILEVPVSCTA
Sbjct: 301 FNLLDGDKISTLFAKFFKELLVAAGAENELKLGVVQTAYANGSSTEYLSSILEVPVSCTA 360

Query: 361 TGVKHLHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKLKEPQDEKTAKALKTLYLF 420
           TGVKHLHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKLKEPQDEKTAKALKTLYLF
Sbjct: 361 TGVKHLHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKLKEPQDEKTAKALKTLYLF 420

Query: 421 TNLINQTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLVKVIVPDRSVFKTSNAE 480
           TNLINQTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLVKVIVPDRSVFKTSNAE
Sbjct: 421 TNLINQTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLVKVIVPDRSVFKTSNAE 480

Query: 481 RQLVSPKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAATKEKADRLAASVSDLVS 540
           RQLVSPKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAATKEKADRLAASVSDLVS
Sbjct: 481 RQLVSPKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAATKEKADRLAASVSDLVS 540

Query: 541 RSVS 544
           RSVS
Sbjct: 541 RSVS 544

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/544 (61%), Positives = 419/544 (77%), Gaps = 5/544 (0%)

Query: 1   MVNIQLLEELYDKHCKXXXXXXXXXXXXRYKADVLDTVMFTTGILAAIRSIYLKGQYVGV 60
           M  ++ + +LYDKHC             RYKA++LDTV+FTTG+LA +RS++LKGQYVG 
Sbjct: 1   MSVVEEVSKLYDKHCCSRFKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGA 60

Query: 61  MITASHNPPQDNGVKIVDPKGEMLDQAWEPFATELANSASKGKQELIKALDKLITKLGID 120
           MITASHNPPQDNGVK+VDPKGEML Q WE +ATELAN AS GK + +  L +L+ + GI 
Sbjct: 61  MITASHNPPQDNGVKLVDPKGEMLKQEWEVYATELANCASDGKHQFLHRLQELMNQFGIK 120

Query: 121 DTESAKITISRDSRESGPRLLQAVIDGTKVLKNVQVVDFNLLTTPQLHFLTYQYNQGSSS 180
               A+I ++RDSRESG RLL+A++DGT V  NV +VD+++LTTPQLHFLTY  N+   S
Sbjct: 121 ADSEARIVVARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTPQLHFLTYHLNRQMES 180

Query: 181 K----VEESTYYSAFSSAWTKICGLHDINSLPYRVIIDAANGIGGPKVSEMLLKNKFFSS 236
           +    V E+ YYS F SA  ++  L +I  LPY ++IDAANG+GG K  E+ +KN FF  
Sbjct: 181 ERVIEVNEAFYYSHFLSALKELTELFNIPGLPYPLVIDAANGVGGAKAEELFMKNTFFKD 240

Query: 237 TVSVINNQWQSPELLNESCGADYVKTNQHFPKGVSGNSENECIYCSFDGDADRIVFYYHD 296
           + ++IN  W   +LLN  CGADYVKTNQ  P+G+S  ++   ++CSFDGDADR++FYY D
Sbjct: 241 STTIINGNWSQHDLLNSFCGADYVKTNQCLPQGISAATDINSLHCSFDGDADRVIFYYRD 300

Query: 297 EKSKFNLLDGDKISTLFAKFFKELLVAAGAENELKLGVVQTAYANGSSTEYLSSILEVPV 356
               F+LLDGDKISTLFAKFF+ +L  AG ++ +KLGVVQTAYANGSST YLS +L VPV
Sbjct: 301 VDGMFHLLDGDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANGSSTRYLSEVLIVPV 360

Query: 357 SCTATGVKHLHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKLKEPQDEKTAK-ALK 415
           SCT TGVK+LH +A+ NYD+GIYFEANGHGTVIFS+ F+ T+ K+LKE      +K ALK
Sbjct: 361 SCTPTGVKYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRLKEGSLSAESKMALK 420

Query: 416 TLYLFTNLINQTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLVKVIVPDRSVFK 475
           TL  F+ LINQTVGDA+SDM+AVLAVLCILKW+PQ+WD EYTDLPN L+KV+VPDRS+FK
Sbjct: 421 TLQSFSKLINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPNTLMKVVVPDRSLFK 480

Query: 476 TSNAERQLVSPKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAATKEKADRLAASV 535
           T+NAERQLVSPKGLQ +ID  ++ +++ RSFVRASGTEDAVR+YAEAATKE+AD L+  +
Sbjct: 481 TTNAERQLVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAEAATKEQADDLSIKI 540

Query: 536 SDLV 539
           S LV
Sbjct: 541 SQLV 544

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score =  699 bits (1804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/542 (61%), Positives = 420/542 (77%), Gaps = 3/542 (0%)

Query: 1   MVNIQLLEELYDKHCKXXXXXXXXXXXXRYKADVLDTVMFTTGILAAIRSIYLKGQYVGV 60
           M++ + L+ LY+ HC             RYKADVLDTVMFTTG++A +RSI+L+G+ VGV
Sbjct: 1   MLDTKALKSLYEAHCSTGFHYAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVGV 60

Query: 61  MITASHNPPQDNGVKIVDPKGEMLDQAWEPFATELANSASKGKQELIKALDKLITKLGID 120
           MITASHNPP+DNGVKIVDPKGEML+Q+WE +AT+LANSAS+G  E + ++++L+TKL + 
Sbjct: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWEVYATDLANSASQGFSEFVASVERLMTKLEVG 120

Query: 121 DTESAKITISRDSRESGPRLLQAVIDGTKVLKNVQVVDFNLLTTPQLHFLTYQYNQ-GSS 179
             +   I ++RDSRESGPRLL A + G KVL NV+V D  LLTTPQLHFLT + N+    
Sbjct: 121 SNDHGSIVVARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQLHFLTSKSNELPKG 180

Query: 180 SKVEESTYYSAFSSAWTKICGLHDINSLPYRVIIDAANGIGGPKVSEMLLKNKFFSSTVS 239
           +++ +S YY  F SAW +I  L  I+SLPY++ IDAANGIG P V+EML ++KFF    +
Sbjct: 181 TEIGKSLYYDNFLSAWVEIAELCKIDSLPYKLEIDAANGIGAPVVTEMLSQHKFFKGAFA 240

Query: 240 VINNQWQSPELLNESCGADYVKTNQHFPKGVSGNSENECIYCSFDGDADRIVFYYHDEKS 299
           V+N++W++P+ LN  CGAD+VKTNQ  P G++   E   I CSFDGDADRIVFYY  +  
Sbjct: 241 VVNDEWETPDSLNHLCGADFVKTNQKLPHGIAPGGERNRICCSFDGDADRIVFYYCGKNG 300

Query: 300 KFNLLDGDKISTLFAKFFKELLVAAGAENELKLGVVQTAYANGSSTEYLSSILEVPVSCT 359
            F+LLDGDK++TLFAKFF+ELL  AG ++EL+LGVVQTAYANGSST Y+  +L + V+CT
Sbjct: 301 DFHLLDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANGSSTAYIEQVLGISVTCT 360

Query: 360 ATGVKHLHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKLKEPQDEKTA-KALKTLY 418
            TGVKHLHHEA+  YDIG+YFEANGHGTV+FS +F   ID+KL E  +   A K+LK L+
Sbjct: 361 PTGVKHLHHEAV-KYDIGVYFEANGHGTVVFSSKFLDVIDRKLSEKLESDAAQKSLKVLH 419

Query: 419 LFTNLINQTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLVKVIVPDRSVFKTSN 478
           LF  LINQTVGDAISDMLAVLAVL ILKWSP+KWD+EYTDLPNKL+KV+VPDR+VFKT N
Sbjct: 420 LFAKLINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPNKLIKVLVPDRTVFKTKN 479

Query: 479 AERQLVSPKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAATKEKADRLAASVSDL 538
           AERQLVSP G+QEKID+ V  F  GRSFVRASGTEDAVRVYAEAAT ++ + L+  V  L
Sbjct: 480 AERQLVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAEAATPQETEALSQQVEKL 539

Query: 539 VS 540
           ++
Sbjct: 540 LA 541

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score =  692 bits (1786), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/541 (60%), Positives = 417/541 (77%), Gaps = 3/541 (0%)

Query: 1   MVNIQLLEELYDKHCKXXXXXXXXXXXXRYKADVLDTVMFTTGILAAIRSIYLKGQYVGV 60
           M++ + LE LY+ HCK            RYKADVLDTVMFTTG+LA +RSIYL+G+ VGV
Sbjct: 1   MLDTKTLETLYETHCKSGFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVGV 60

Query: 61  MITASHNPPQDNGVKIVDPKGEMLDQAWEPFATELANSASKGKQELIKALDKLITKLGID 120
           MITASHNPP+DNGVKIVDPKGEML+Q+WE +AT+LANSA++     +  L  L+++LG+D
Sbjct: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWESYATDLANSATQSFTAFLAYLQNLVSELGLD 120

Query: 121 DTESAKITISRDSRESGPRLLQAVIDGTKVLKNVQVVDFNLLTTPQLHFLTYQYNQ-GSS 179
                 + ++RDSRESGPRLL A+++G++VL N+++ D+ LLTTPQLHFLT + N+  + 
Sbjct: 121 TDALGSLAVARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQLHFLTSKRNELPND 180

Query: 180 SKVEESTYYSAFSSAWTKICGLHDINSLPYRVIIDAANGIGGPKVSEMLLKNKFFSSTVS 239
           + ++   YY  F SAW  I  L  I SLPY++ IDAANGIG P+V EML  +KFF     
Sbjct: 181 TAIDRFFYYKEFLSAWDDITALCGIQSLPYKLEIDAANGIGAPRVKEMLSTHKFFDGVFR 240

Query: 240 VINNQWQSPELLNESCGADYVKTNQHFPKGVSGNSENECIYCSFDGDADRIVFYYHDEKS 299
           V+N+ W++P  LN  CGADYVKTNQ  P G+  N++ + I CSFDGDADRIVFY+ D + 
Sbjct: 241 VVNDDWETPASLNHLCGADYVKTNQRLPYGIQANNDCQRICCSFDGDADRIVFYFCDSEG 300

Query: 300 KFNLLDGDKISTLFAKFFKELLVAAGAENELKLGVVQTAYANGSSTEYLSSILEVPVSCT 359
           +F LLDGDK++TLFAKFF+++L +A  +  L LGVVQTAYANGSST Y+  +L +PV+CT
Sbjct: 301 QFRLLDGDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGSSTHYIERVLGIPVTCT 360

Query: 360 ATGVKHLHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKL-KEPQDEKTAKALKTLY 418
            TGVKHLHHEAI NYDIG+YFEANGHGTV+FS +F + ++  L  + Q + + ++L+ L 
Sbjct: 361 PTGVKHLHHEAI-NYDIGVYFEANGHGTVVFSKKFDEVVNSGLSNKHQSDSSLQSLEVLS 419

Query: 419 LFTNLINQTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLVKVIVPDRSVFKTSN 478
            F NLINQTVGDAISDM+ VLAVL ILKW+PQKW+QEYTDLPNKLVKV+VPDR+VFKT+N
Sbjct: 420 KFANLINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNKLVKVLVPDRTVFKTTN 479

Query: 479 AERQLVSPKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAATKEKADRLAASVSDL 538
           AERQL+SP GLQ KI++ V E+   RSFVRASGTEDAVRVYAEA+T+E+AD LA+ VS +
Sbjct: 480 AERQLLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEASTREEADSLASRVSQV 539

Query: 539 V 539
           V
Sbjct: 540 V 540

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/544 (56%), Positives = 407/544 (74%), Gaps = 2/544 (0%)

Query: 1   MVNIQLLEELYDKHCKXXXXXXXXXXXXRYKADVLDTVMFTTGILAAIRSIYLKGQYVGV 60
           M  +Q + +LYD+H              R +A+VL  V+F TG+LA +RS+YL G YVGV
Sbjct: 1   MRTVQEMVKLYDRHRGCGRVYAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVGV 60

Query: 61  MITASHNPPQDNGVKIVDPKGEMLDQAWEPFATELANSASKGKQELIKALDKLITKLGID 120
           M+TASHNPP+DNGVK+VDP GEML   WE  AT LAN AS+G+QEL+ AL  L+ +LG+D
Sbjct: 61  MLTASHNPPEDNGVKLVDPHGEMLAAEWEKHATALANCASQGQQELLDALHMLVDRLGLD 120

Query: 121 DTESAKITISRDSRESGPRLLQAVIDGTKVLKNVQVVDFNLLTTPQLHFLTYQYNQ-GSS 179
               A++ ++RDSR SGP+LL A++DGT++L++V+VVD  +LTTPQLHFLT   N+ GS+
Sbjct: 121 LALRARVVVARDSRASGPQLLDALLDGTRMLEDVEVVDCGMLTTPQLHFLTCACNERGSA 180

Query: 180 SKVEESTYYSAFSSAWTKICGLHDINSLPYRVIIDAANGIGGPKVSEMLLKNKFFSSTVS 239
           + V E  YY+ F +A  ++  LH + +LP+ +++D ANG+G  K  E+  ++  F + VS
Sbjct: 181 AGVREDLYYAHFVAALEELAALHGLETLPFPLVVDTANGVGALKARELFRRSPLFKNRVS 240

Query: 240 VINNQWQSPELLNESCGADYVKTNQHFPKGVSGNSENECIYCSFDGDADRIVFYYHDEKS 299
           +IN+ W   ELLN  CGADYVKT Q  P+G+S +   E ++CS+DGDADR++FYY D + 
Sbjct: 241 IINDNWSQHELLNSGCGADYVKTKQCLPQGISADLLRESLFCSYDGDADRVIFYYIDGQE 300

Query: 300 KFNLLDGDKISTLFAKFFKELLVAAGAENELKLGVVQTAYANGSSTEYLSSILEVPVSCT 359
           +F+LLDGDKISTL AKF +  L+ AG  +++ LGVVQTAYANGSST YLS +LEVPVSCT
Sbjct: 301 RFHLLDGDKISTLIAKFLQSALLTAGINDDVCLGVVQTAYANGSSTRYLSEVLEVPVSCT 360

Query: 360 ATGVKHLHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKLKEPQDEKTAK-ALKTLY 418
            TGVKHLH EA+  YD+GIYFEANGHGTVIFS+ F  T+++ L+ P     A+ +L+TL 
Sbjct: 361 PTGVKHLHREAVQKYDVGIYFEANGHGTVIFSEHFTLTVERALENPALSAKARLSLQTLK 420

Query: 419 LFTNLINQTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLVKVIVPDRSVFKTSN 478
            F NLINQT+GDAI+DMLAV+A+L IL WSP+ WD++YTDLPN LVKV+VPDRS+FKT+N
Sbjct: 421 TFANLINQTIGDAIADMLAVIAILSILHWSPEDWDKQYTDLPNNLVKVVVPDRSMFKTTN 480

Query: 479 AERQLVSPKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAATKEKADRLAASVSDL 538
           AE+QL SP GLQE ID  V  ++ GRSFVRASGTEDAVR+YAEAA++++AD LA  VS L
Sbjct: 481 AEQQLTSPAGLQELIDDIVMVYDSGRSFVRASGTEDAVRIYAEAASQQQADELATKVSTL 540

Query: 539 VSRS 542
           V  S
Sbjct: 541 VVES 544

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score =  615 bits (1586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/540 (56%), Positives = 395/540 (73%), Gaps = 9/540 (1%)

Query: 9   ELYDKHCKXXXXXXXXXXXX-RYKADVLDTVMFTTGILAAIRSIYLKGQYVGVMITASHN 67
           +L++K+C              R  A +L+TVMFTTGI+A +RSI L G+ VGVMITASHN
Sbjct: 4   KLFEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITASHN 63

Query: 68  PPQDNGVKIVDPKGEMLDQAWEPFATELANSASKGKQELIKA-LDKLITKLGIDDTESAK 126
           PP+DNGVKIV+P G MLDQ+WEP ATELAN A+    + +KA +++ + K   +     +
Sbjct: 64  PPEDNGVKIVEPNGAMLDQSWEPMATELANIAANSTFDDLKAYVEEKVKKFSPESGSKVQ 123

Query: 127 --ITISRDSRESGPRLLQAVIDGTKVLKNVQVVDFNLLTTPQLHFLTYQYNQGSSSKVEE 184
             + + RDSRESG  LL+ ++   +   N +++++ LLTTPQLHFLT + N   S  V+E
Sbjct: 124 PVVVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEINVKKSYAVQE 183

Query: 185 STYYSAFSSAWTKICGLHDINSL-PYRVIIDAANGIGGPKVSEMLLKNKFFSSTVSVINN 243
           S+YY+ F  +W KI  LH+I  L    + ID ANGIGGPK+ E LLK+  F+S V+++NN
Sbjct: 184 SSYYNYFIESWNKITALHNITDLYCSSLTIDTANGIGGPKIQE-LLKSWPFASKVTLVNN 242

Query: 244 QWQSPELLNESCGADYVKTNQHFPKGVSGNSENECIYCSFDGDADRIVFYYHDEKSKFNL 303
           +W+ P+LLN++CGAD+VKTNQ  P GVSGNS    +YCS+DGDADRIVFY+ D+  +F+L
Sbjct: 243 EWEKPDLLNKNCGADFVKTNQKLPNGVSGNSTENDLYCSYDGDADRIVFYFQDQDKQFHL 302

Query: 304 LDGDKISTLFAKFFKELLVAAGAENELKLGVVQTAYANGSSTEYLSSILEVPVSCTATGV 363
           LDGDKISTLFAK   +LL  A   +++ LGVVQTAYANGSST YL   L VPVSC  TGV
Sbjct: 303 LDGDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQGTLNVPVSCAKTGV 362

Query: 364 KHLHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKLKEPQDEKTAKALKTLYLFTNL 423
           KHLHHEA+ NYDIG+YFEANGHGT+IFSD F++  +K+LK   +   + A+ TL   ++L
Sbjct: 363 KHLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKELKANSE---SIAVNTLVALSHL 419

Query: 424 INQTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLVKVIVPDRSVFKTSNAERQL 483
           INQTVGDAISDML VL+VL I+K S Q+WD EYTDLPN L KVIVPDRSVF T++ ER+L
Sbjct: 420 INQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVFITTDQERKL 479

Query: 484 VSPKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAATKEKADRLAASVSDLVSRSV 543
           +SP+GLQ KID  + EF +GRSFVRASGTEDAVRVYAEA+++E+A  L A V+ LV  SV
Sbjct: 480 LSPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELNALVTKLVKESV 539

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score =  611 bits (1575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/537 (57%), Positives = 390/537 (72%), Gaps = 6/537 (1%)

Query: 7   LEELYDKHCKXXXXXXXXXXXXRYKADVLDTVMFTTGILAAIRSIYLKGQYVGVMITASH 66
             +LY+++CK            R    VLDTVMFTTGI+A +RSIYLK ++VGVMITASH
Sbjct: 3   FRDLYEQYCKQGHAYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITASH 62

Query: 67  NPPQDNGVKIVDPKGEMLDQAWEPFATELANSASKGKQELIKALDKLITKLGIDDTESAK 126
           NPP+DNGVK+V+P GEML Q WEP AT+LAN+AS    +L   L  +I +L ID T+ A 
Sbjct: 63  NPPEDNGVKVVEPYGEMLVQNWEPIATKLANAASSSFTQLESTLQSIIAELNIDTTQLAN 122

Query: 127 ITISRDSRESGPRLLQAVIDGTKVLKNVQVVDFNLLTTPQLHFLTYQYNQGSS-SKVEES 185
           IT++RDSRESGPRLL A+  G  V   V+++DF LLTTPQLHFL Y  N  S  S+V +S
Sbjct: 123 ITVARDSRESGPRLLAALKAGISVFPAVKIIDFELLTTPQLHFLVYSLNTSSQPSQVRDS 182

Query: 186 TYYSAFSSAWTKICGLHDINSLPYRVIIDAANGIGGPKVSEMLLK-NKFFSSTVSVINNQ 244
           TYY  F S W ++  L+++  LP+ + ID ANGIG  KV +++ +      ++++ +N +
Sbjct: 183 TYYDHFVSIWNQLTQLYEVTELPFHLTIDCANGIGADKVKQLISQAGHMLENSLTAVNGE 242

Query: 245 WQSPELLNESCGADYVKTNQHFPKGVSGNSENECIYCSFDGDADRIVFYYHDEK-SKFNL 303
            ++ +LLNESCGAD+VKTNQ FP     N +   +YCSFDGDADR+VFYY D K +KF+L
Sbjct: 243 TKTFQLLNESCGADFVKTNQTFPANC--NPKPSQLYCSFDGDADRVVFYYVDGKENKFHL 300

Query: 304 LDGDKISTLFAKFFKELLVAAGAENELKLGVVQTAYANGSSTEYLSSILEVPVSCTATGV 363
           LDGDKI+TL AK   +LL   G  + LKLGVVQTAYANGSST+Y++  L++PVSCT TGV
Sbjct: 301 LDGDKIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYITDKLKIPVSCTKTGV 360

Query: 364 KHLHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKLKEPQ-DEKTAKALKTLYLFTN 422
           KHLHHEA+  YDIGIYFEANGHGTVIFS EF +T+D +L+E   +E+  K+L +L L + 
Sbjct: 361 KHLHHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGNEQQYKSLLSLKLLSQ 420

Query: 423 LINQTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLVKVIVPDRSVFKTSNAERQ 482
           LINQTVGDAISDMLAV+A L I    P+ WD  Y DLPN+L KVIVPDRSVF ++NAERQ
Sbjct: 421 LINQTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVIVPDRSVFVSTNAERQ 480

Query: 483 LVSPKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAATKEKADRLAASVSDLV 539
           L+SP+GLQ KID  V +F + RSFVRASGTEDAVRVYAEA T E A  LA  V +LV
Sbjct: 481 LLSPEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTESAIELATKVGELV 537

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score =  583 bits (1502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/521 (57%), Positives = 371/521 (71%), Gaps = 10/521 (1%)

Query: 29  RYKADVLDTVMFTTGILAAIRSIYLKGQYVGVMITASHNPPQDNGVKIVDPKGEMLDQAW 88
           R  A VLDTVM TTG+LA +RSI L G+ VGVMITASHN P DNGVKIV+P G MLDQ+W
Sbjct: 29  RDDATVLDTVMVTTGLLACLRSIALDGKAVGVMITASHNQPCDNGVKIVEPDGSMLDQSW 88

Query: 89  EPFATELANSAS--KGKQELIKALDKLITKLGIDDTESAKITISRDSRESGPRLLQAVID 146
           EPFATELAN AS     QE    L +   +  +D   +  + + RDSR+SGPRLLQ +  
Sbjct: 89  EPFATELANKASFCHSTQEFKLYLQEKFAQYKVDSGITPVLVVGRDSRDSGPRLLQCLNS 148

Query: 147 GTKVLKNVQVVDFNLLTTPQLHFLTYQYNQGSS-SKVEESTYYSAFSSAWTKICGLHDIN 205
               L   +++D+ LLTTPQLHFLT   N   S + V E  YYS F  AW  I  LH I 
Sbjct: 149 LAVPLMKPKIIDYGLLTTPQLHFLTNAINTTKSRAPVTEDDYYSFFMDAWVSITALHGIK 208

Query: 206 SLPY-RVIIDAANGIGGPKVSEMLLKNKFFSSTVSVINNQWQSPELLNESCGADYVKTNQ 264
            L   R+ IDAANGIGGPKVS+ L +    +   +++NN WQ+P LLN  CGADYVKTNQ
Sbjct: 209 VLQSPRLYIDAANGIGGPKVSK-LFEVWPQAGQFTLVNNHWQTPTLLNNDCGADYVKTNQ 267

Query: 265 HFPKGV--SGNSENECIYCSFDGDADRIVFYYHDEKSKFNLLDGDKISTLFAKFFKELLV 322
             PK +  + +S+   +YCSFDGDADRIVFYY D ++ F+LLDGDKISTLFA F  + L 
Sbjct: 268 RLPKNIDPAADSDPATLYCSFDGDADRIVFYYQDAQNSFHLLDGDKISTLFALFISKQLK 327

Query: 323 AAGAENELKLGVVQTAYANGSSTEYLSSILEVPVSCTATGVKHLHHEAIHNYDIGIYFEA 382
            AG   ++ +GVVQTAYANG+ST YL ++L +PVSC  TGVKHLHHEAI NYD+GIYFEA
Sbjct: 328 KAGLTEKISMGVVQTAYANGNSTNYLENVLNIPVSCAKTGVKHLHHEAITNYDVGIYFEA 387

Query: 383 NGHGTVIFSDEFHKTIDKKLKEPQDEKTAKALKTLYLFTNLINQTVGDAISDMLAVLAVL 442
           NGHGT++FS++F +T +  LKE  +   +  +KTL  F +LINQTVGDAISDML VLAVL
Sbjct: 388 NGHGTIMFSNKFFETCESLLKENNE---SLEVKTLLSFAHLINQTVGDAISDMLGVLAVL 444

Query: 443 CILKWSPQKWDQEYTDLPNKLVKVIVPDRSVFKTSNAERQLVSPKGLQEKIDSTVQEFEH 502
            I+K +P  WD+EYTDLPN L KV+VPDRS+F T++ ER+L++P+G Q KID+ V ++++
Sbjct: 445 SIMKLTPSAWDKEYTDLPNLLTKVVVPDRSLFTTTDQERKLLTPEGAQTKIDAIVAKYKN 504

Query: 503 GRSFVRASGTEDAVRVYAEAATKEKADRLAASVSDLVSRSV 543
           GRSFVRASGTEDAVRVYAEA+T + A  L   VS  V  SV
Sbjct: 505 GRSFVRASGTEDAVRVYAEASTPQDAAALNEEVSKAVLASV 545

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/532 (56%), Positives = 383/532 (71%), Gaps = 22/532 (4%)

Query: 29  RYKADVLDTVMFTTGILAAIRSIYLKGQYVGVMITASHNPPQDNGVKIVDPKGEMLDQAW 88
           R KA +LDTVMFTTG +A +RS+   G+ VGVM+TASHNPP DNGVKIV+P G ML Q W
Sbjct: 33  RDKAAILDTVMFTTGFVACLRSLSHDGKAVGVMVTASHNPPVDNGVKIVEPNGSMLSQDW 92

Query: 89  EPFATELANSASKGK-QELIKALDKLITKLGIDDTESAKITISRDSRESGPRLLQAVIDG 147
           EP AT+LAN AS+GK  EL++ ++  + +L  +  +   + + RDSRES   LL+ + +G
Sbjct: 93  EPIATDLANLASQGKIDELVQFVNAKLIEL--NSNKVPTLIVGRDSRESSTSLLECLKEG 150

Query: 148 TKVLKNVQVVDFNLLTTPQLHFLTYQYNQGSSSKVEESTYYSAFSSAWTKICGLHDINSL 207
           +  L + ++VD+ LLTTPQLHFLT  YN       +E+ YY  F++AW ++  +++  S 
Sbjct: 151 SLKLFDAKIVDYELLTTPQLHFLTNAYNL-EKDLPKETDYYHHFNNAWDQLISINNDASS 209

Query: 208 PYR-----VIIDAANGIGGPKVSEMLLKNKFFSSTVSVINNQWQSPELLNESCGADYVKT 262
                   +IID+ANGIGGPK+ E LLK    +  V +INN W+ PE LN +CGADYVKT
Sbjct: 210 STSNKIESLIIDSANGIGGPKM-ENLLKYWKTNYKVRLINNNWKRPESLNNNCGADYVKT 268

Query: 263 NQHFPKGVSGNSENE----CIYCSFDGDADRIVFYYHDEKSK-FNLLDGDKISTLFAKFF 317
           NQ  P G++ +  NE     I+CSFDGDADR+VFYY D +S  FNLLDGDKISTLFA F 
Sbjct: 269 NQKLPNGITTDIINESSKNVIHCSFDGDADRVVFYYQDPQSNTFNLLDGDKISTLFANFI 328

Query: 318 KELLVAAGA--ENELKLGVVQTAYANGSSTEYLSSILEVPVSCTATGVKHLHHEAIHNYD 375
              L  AG   ENE+KLGVVQTAYANGSST YL   L++PV+C  TGVKHLHHEA   YD
Sbjct: 329 SMQLKLAGIDYENEIKLGVVQTAYANGSSTNYLQQNLKIPVACAKTGVKHLHHEACTRYD 388

Query: 376 IGIYFEANGHGTVIFSDEFHKTIDKKLK-EPQDEKTAK--ALKTLYLFTNLINQTVGDAI 432
           IG+YFEANGHGT+IFS+ F+K I++K+  E Q E T K  ALKTL + + LINQTVGDAI
Sbjct: 389 IGVYFEANGHGTIIFSENFYKIINQKINAESQIENTPKLRALKTLKVLSALINQTVGDAI 448

Query: 433 SDMLAVLAVLCILKWSPQKWDQEYTDLPNKLVKVIVPDRSVFKTSNAERQLVSPKGLQEK 492
           SDM+ V+AVL IL W+PQ W++EYTDLPNKL K++VPDRSVF+T++ ER+L SP GLQ K
Sbjct: 449 SDMMGVMAVLAILNWTPQIWNKEYTDLPNKLAKLVVPDRSVFETTDQERKLTSPAGLQSK 508

Query: 493 IDSTVQEFEHGRSFVRASGTEDAVRVYAEAATKEKADRLAASVSDLVSRSVS 544
           I+  V ++E+GRSFVRASGTEDAVRVYAEA+  +  ++L   V D  + SV+
Sbjct: 509 INKIVAKYENGRSFVRASGTEDAVRVYAEAS--DDVNKLCQEVLDATAESVN 558

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/556 (53%), Positives = 381/556 (68%), Gaps = 19/556 (3%)

Query: 2   VNIQLLEELYDKHCKXXXXXXXXXXX-XRYKADVLDTVMFTTGILAAIRSIYLKGQYVGV 60
           ++ + L ELYDK C+             R  A  LDTVMFTTGILA +RS+ L+GQYVGV
Sbjct: 3   IDYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGV 62

Query: 61  MITASHNPPQDNGVKIVDPKGEMLDQAWEPFATELANSASKGK--QELIKALDKLIT--K 116
           MITASHNP QDNGVKIV+P G ML   WEP+A +LAN+AS     +E    L +LI   K
Sbjct: 63  MITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEK 122

Query: 117 LGIDDTESAKITISRDSRESGPRLLQAVIDGTKVLKNVQVVDFNLLTTPQLHFLTYQYNQ 176
           +G+D +    I + RDSRES P LL+ +      + + QV+D   +TTPQLH++T   N+
Sbjct: 123 IGLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLSNK 182

Query: 177 -----GSSSKVEESTYYSAFSSAWTKICGLHDIN---SLPYRVIIDAANGIGGPKVSEML 228
                GS+    E  YYS F  A+ ++   ++I    S+P R+ IDAANGIGGP++ ++L
Sbjct: 183 REREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVP-RLFIDAANGIGGPQLKKLL 241

Query: 229 LKNKFF--SSTVSVINNQWQSPELLNESCGADYVKTNQHFPKGVSGNSENECIYCSFDGD 286
               +      + VIN++   PELLN  CGADYVKTNQ  PKG+S +S ++ +YCSFDGD
Sbjct: 242 TSKDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSS-HDSLYCSFDGD 300

Query: 287 ADRIVFYYHDEKSKFNLLDGDKISTLFAKFFKELLVAAGAENELKLGVVQTAYANGSSTE 346
           ADR+VFYY D +S+F+LLDGDKISTLFAKF  + L  A  EN L++GVVQTAYANGSST 
Sbjct: 301 ADRVVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTN 360

Query: 347 YLSSILEVPVSCTATGVKHLHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKLKEPQ 406
           Y+ + L  PVSCT TGVKHLHHEA   YDIGIYFEANGHGT+IFS++FH+ I  +L   +
Sbjct: 361 YIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSRAR 420

Query: 407 DEKTAKALKTLYLFTNLINQTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLVKV 466
            +    ALKTL  F+ LINQTVGDA+SDMLAVLA L I+K +P  WD+EYTDLPNKLVK 
Sbjct: 421 GDML--ALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKC 478

Query: 467 IVPDRSVFKTSNAERQLVSPKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAATKE 526
           IVPDRS+F+T + ER+L +P GLQ KID  + ++  GRSFVRASGTEDAVR+YAE     
Sbjct: 479 IVPDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSS 538

Query: 527 KADRLAASVSDLVSRS 542
           + D+    + +LV  S
Sbjct: 539 QLDQFCNEIVELVKAS 554

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score =  565 bits (1455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/559 (53%), Positives = 382/559 (68%), Gaps = 27/559 (4%)

Query: 1   MVNIQLLEELYDKHCKXXXXXXXXXXXX-RYKADVLDTVMFTTGILAAIRSIYLKGQYVG 59
           M+ +  L +L D++C              R  A  LDTV+F TGILA +RS+ LKG  +G
Sbjct: 1   MLAVDTLTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIG 60

Query: 60  VMITASHNPPQDNGVKIVDPKGEMLDQAWEPFATELANS-ASKGK-QELIKALDKLITKL 117
           VM+TASHNPP DNGVK+V+P G M+ ++WEP ATELAN+ A KG   E  +A    + + 
Sbjct: 61  VMVTASHNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQRE 120

Query: 118 GIDDTESAK----------ITISRDSRESGPRLLQAVIDGTKVLKNVQVVDFNLLTTPQL 167
                +SA           + + RDSRESGP+LL  ++   K L + ++ D  LLTTPQL
Sbjct: 121 LKGQLQSANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTPQL 180

Query: 168 HFLTYQYNQGSSSKVEESTYYSAFSSAWTKICGLHDIN-SLPY--RVIIDAANGIGGPKV 224
           HFLT +  +G ++ V ES YY  F  AW  +  LH I  SLP    + IDAANGIG PKV
Sbjct: 181 HFLTSETAKGVAN-VTESRYYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANGIGAPKV 239

Query: 225 SEMLLKNKFFSSTVSVINNQWQSPELLNESCGADYVKTNQHFPKGVSGNSENECIYCSFD 284
            E LL        V  IN++W +PELLN  CGAD+VK+NQ  P G +   ++  + CS+D
Sbjct: 240 QE-LLSQWACRGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGFN---DSTGLGCSYD 295

Query: 285 GDADRIVFYYHDEKSKFNLLDGDKISTLFAKFFKELLVAAGAENELKLGVVQTAYANGSS 344
           GDADR+VFYY +E ++F LLDGD+IS LFA FF  +L  AG ++EL LGVVQTAYANG+S
Sbjct: 296 GDADRVVFYYINEANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTAYANGNS 355

Query: 345 TEYLSSILEVPVSCTATGVKHLHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKLKE 404
           TEYL   L+VPVSC  TGVKHLHHEA+  YDIGIYFEANGHGT+IFS +F+K I +    
Sbjct: 356 TEYLQKTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVIKE---- 411

Query: 405 PQDEKTAKALKTLYLFTNLINQTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLV 464
            Q E++  A++TL  F+ LINQTVGDAISDML VLA L I KW+P+ W QE+TDLPN+L 
Sbjct: 412 -QKERSV-AVETLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLPNRLA 469

Query: 465 KVIVPDRSVFKTSNAERQLVSPKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAAT 524
           KV+VPDRSVF T++ ER+L  P+GLQ+KID  V+ F+ GRSFVRASGTEDAVRVYAEAA+
Sbjct: 470 KVVVPDRSVFITTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYAEAAS 529

Query: 525 KEKADRLAASVSDLVSRSV 543
            E  ++L+ +V +LV +SV
Sbjct: 530 LEDVEKLSNTVKELVVKSV 548

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score =  563 bits (1450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/550 (54%), Positives = 371/550 (67%), Gaps = 17/550 (3%)

Query: 7   LEELYDKHC-KXXXXXXXXXXXXRYKADVLDTVMFTTGILAAIRSIYLKGQYVGVMITAS 65
           L +LY++ C              R  A  LDTVMFTTGILA +RS+ L+GQYVGVMITAS
Sbjct: 8   LRKLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMITAS 67

Query: 66  HNPPQDNGVKIVDPKGEMLDQAWEPFATELANSASKGK--QELIKALDKLITKLGIDDTE 123
           HNP QDNGVKIV+P G ML  AWEP+A +LAN+AS      E    L KLI    ID   
Sbjct: 68  HNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEHEKIDLDA 127

Query: 124 SAKITISRDSRESGPRLLQAVIDGTKVLKNVQVVDFNLLTTPQLHFLTYQYNQ-----GS 178
           +  + + RDSRES P LL+ +      + +  VVD   +TTPQLH++T   N+     GS
Sbjct: 128 APHVVVGRDSRESSPFLLRCLTSTMASVFHAHVVDLGCVTTPQLHYVTNLSNKRQREGGS 187

Query: 179 SSKVEESTYYSAFSSAWTKI---CGLHDINSLPYRVIIDAANGIGGPKVSEMLLKNKFF- 234
           +    E  YYS F +A+ ++   C +    S+P ++ +D ANGIGGP++ ++L    +  
Sbjct: 188 AQVATEQDYYSFFINAFNELFTTCQIEKRLSVP-KLFVDTANGIGGPQLKKLLASKDWAV 246

Query: 235 -SSTVSVINNQWQSPELLNESCGADYVKTNQHFPKGVSGNSENECIYCSFDGDADRIVFY 293
            S  + ++N++   P+LLN  CGADYVKTNQ  PKG+S +S +  +YCSFDGDADR+VFY
Sbjct: 247 PSDEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLSPSSPDS-LYCSFDGDADRVVFY 305

Query: 294 YHDEKSKFNLLDGDKISTLFAKFFKELLVAAGAENELKLGVVQTAYANGSSTEYLSSILE 353
           Y D +SKF+LLDGDKISTLFAKF  + L  A   + LK+GVVQTAYANGSST Y+   L 
Sbjct: 306 YVDPESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVVQTAYANGSSTSYIKDTLH 365

Query: 354 VPVSCTATGVKHLHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKLKEPQDEKTAKA 413
            PVSCT TGVKHLHHEA   YDIGIYFEANGHGT+IFS +FH+TI+ +L   Q   +  A
Sbjct: 366 CPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFHQTIESELSRAQ--GSLLA 423

Query: 414 LKTLYLFTNLINQTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLVKVIVPDRSV 473
           L TL  F NLINQTVGDAISDMLAVLA L IL  +P  WD+EYTDLPNKLVK IVPDRS+
Sbjct: 424 LNTLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLVKCIVPDRSI 483

Query: 474 FKTSNAERQLVSPKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAATKEKADRLAA 533
           F+T++ ER+L +P GLQ KIDS + ++  GRSFVRASGTEDAVRVYAE     K D+   
Sbjct: 484 FQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQDPTKLDQFCN 543

Query: 534 SVSDLVSRSV 543
            V + V  SV
Sbjct: 544 EVVEYVKSSV 553

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score =  562 bits (1448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/559 (53%), Positives = 376/559 (67%), Gaps = 21/559 (3%)

Query: 2   VNIQLLEELYDKHCKXXXXXXXXXXX-XRYKADVLDTVMFTTGILAAIRSIYLKGQYVGV 60
           ++ + L +LYD+ C+             R  A  LDTVMFTTGILA +RS+ L+GQYVGV
Sbjct: 3   IDYEQLRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGV 62

Query: 61  MITASHNPPQDNGVKIVDPKGEMLDQAWEPFATELANSASKGK--QELIKALDKLITKLG 118
           MITASHNP QDNGVKIV+P G ML  +WEP+A +LAN+AS     +E    L KLI    
Sbjct: 63  MITASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIELEK 122

Query: 119 IDDTES---AKITISRDSRESGPRLLQAVIDGTKVLKNVQVVDFNLLTTPQLHFLTYQYN 175
           ID   S     I + RDSRES P LL+ +      + + +V+D   +TTPQLH++T   N
Sbjct: 123 IDLGASNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHARVLDLGCVTTPQLHYITDLSN 182

Query: 176 ----QGSSS--KVEESTYYSAFSSAWTKICGLHDIN---SLPYRVIIDAANGIGGPKVSE 226
               +G S+     E  YYS F  A+ ++   +D+    S+P ++ ID ANGIGGP++ +
Sbjct: 183 RREREGDSALAAATEQDYYSFFIGAFNELFTTYDMEKRLSVP-KLFIDTANGIGGPQLKK 241

Query: 227 MLLKNKFF--SSTVSVINNQWQSPELLNESCGADYVKTNQHFPKGVSGNSENECIYCSFD 284
           +L    +   S  + +IN++   P+LLN  CGADYVKTNQ  PKG+S +S  E +YCSFD
Sbjct: 242 LLASKDWVVPSDQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSPSS-FESLYCSFD 300

Query: 285 GDADRIVFYYHDEKSKFNLLDGDKISTLFAKFFKELLVAAGAENELKLGVVQTAYANGSS 344
           GDADR+VFYY D + KF+LLDGDKISTLFAKF  + L  A  E  LK+GVVQTAYANGSS
Sbjct: 301 GDADRVVFYYVDSELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYANGSS 360

Query: 345 TEYLSSILEVPVSCTATGVKHLHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKLKE 404
           T Y+   L  PVSCT TGVKHLHHEA   YDIGIYFEANGHGT+IFS++FH+TI+ +L +
Sbjct: 361 TAYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIESELSK 420

Query: 405 PQDEKTAKALKTLYLFTNLINQTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLV 464
           P       ALKTL  F  LINQTVGDA+SDMLAVLA L ILK +P  WD+EY DLPNKLV
Sbjct: 421 PNGHTL--ALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLPNKLV 478

Query: 465 KVIVPDRSVFKTSNAERQLVSPKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAAT 524
           K IVPDRS+F+T++ ER+L +P GLQ KIDS + ++  GRSFVRASGTEDAVRVYAE   
Sbjct: 479 KCIVPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYAECQD 538

Query: 525 KEKADRLAASVSDLVSRSV 543
             K D+    +   V  SV
Sbjct: 539 MSKLDQFCNEIVGYVKASV 557

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/556 (54%), Positives = 379/556 (68%), Gaps = 17/556 (3%)

Query: 2   VNIQLLEELYDKHCKXXXXXXXXXXX-XRYKADVLDTVMFTTGILAAIRSIYLKGQYVGV 60
           V+ + L +LYD  C+             R  A  LDTVMF+TGILA +RS+ L+GQYVGV
Sbjct: 3   VDYEQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYVGV 62

Query: 61  MITASHNPPQDNGVKIVDPKGEMLDQAWEPFATELANSASKGK--QELIKALDKLIT--K 116
           MITASHNP QDNGVKIV+P G ML   WEP+A +LAN+AS     +E    L KLI   K
Sbjct: 63  MITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEHEK 122

Query: 117 LGIDDTESAKITISRDSRESGPRLLQAVIDGTKVLKNVQVVDFNLLTTPQLHFLTYQYN- 175
           + ++ T    I + RDSRES P LL+ +      + + QV+D   +TTPQLH++T   N 
Sbjct: 123 IDLNTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDLSNR 182

Query: 176 ---QGSSSKVE-ESTYYSAFSSAWTKICGLHDIN---SLPYRVIIDAANGIGGPKVSEML 228
              +G ++ V  E  YYS F  A+ ++   + +    S+P ++ ID ANGIGGP++ ++L
Sbjct: 183 RKLEGDTAPVATEQDYYSFFIGAFNELFATYQLEKRLSVP-KLFIDTANGIGGPQLKKLL 241

Query: 229 LKNKF--FSSTVSVINNQWQSPELLNESCGADYVKTNQHFPKGVSGNSENECIYCSFDGD 286
               +   +  V VIN++   PELLN  CGADYVKTNQ  PKG+S +S +  +YCSFDGD
Sbjct: 242 ASEDWDVPAEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSSFDS-LYCSFDGD 300

Query: 287 ADRIVFYYHDEKSKFNLLDGDKISTLFAKFFKELLVAAGAENELKLGVVQTAYANGSSTE 346
           ADR+VFYY D  SKF+LLDGDKISTLFAKF  + L  A  E+ LK+GVVQTAYANGSST 
Sbjct: 301 ADRVVFYYVDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSSTA 360

Query: 347 YLSSILEVPVSCTATGVKHLHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKLKEPQ 406
           Y+ + L  PVSCT TGVKHLHHEA   YDIGIYFEANGHGT+IFS++FH+TI  +L + +
Sbjct: 361 YIKNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELSKSK 420

Query: 407 DEKTAKALKTLYLFTNLINQTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLVKV 466
                 AL+TL  F+ LINQTVGDAISDMLAVLA L ILK SP  WD+EYTDLPNKLVK 
Sbjct: 421 LNGDTLALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKLVKC 480

Query: 467 IVPDRSVFKTSNAERQLVSPKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAATKE 526
           IVPDRS+F+T++ ER+L++P GLQ+KID  V ++  GRSFVRASGTEDAVRVYAE     
Sbjct: 481 IVPDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAECKDSS 540

Query: 527 KADRLAASVSDLVSRS 542
           K  +    V + V  S
Sbjct: 541 KLGQFCDEVVEHVKAS 556

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/553 (53%), Positives = 374/553 (67%), Gaps = 25/553 (4%)

Query: 6   LLEELYDKHCKXXXXXXXXXXX-XRYKADVLDTVMFTTGILAAIRSIYLKGQYVGVMITA 64
           +L+++Y+  C              R KA  LDTVMF TGI+A  RS+ L G  VGVM+TA
Sbjct: 7   VLQQVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPVGVMVTA 66

Query: 65  SHNPPQDNGVKIVDPKGEMLDQAWEPFATELANSASKGKQELIKALDKLI-----TKLGI 119
           SHNPP DNGVK+V+P G ML Q WEP  T+LAN A+    E  K  D ++      K   
Sbjct: 67  SHNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAANESFE--KVYDFILEVSKDPKFPF 124

Query: 120 DDTESAKITISRDSRESGPRLLQAVIDGTKVLKNVQVVDFNLLTTPQLHFLT----YQYN 175
            + + + I I  DSRES PRL + +++    + N  + ++ L+TTPQLHF+T     +YN
Sbjct: 125 QENKPSLI-IGHDSRESSPRLTKLLVNTAVEIYNADIHNYGLVTTPQLHFITSLWNAKYN 183

Query: 176 QGSSSKVEESTYYSAFSSAWTKICGLHDINSLPY--RVIIDAANGIGGPKVSEMLLK-NK 232
           + ++  +    YY+ F+++W+K   L+D NS      +IID+ANGIGGPKV++++     
Sbjct: 184 KNTNDVISVDNYYNYFNASWSKFQELYDFNSFKSFENLIIDSANGIGGPKVTDLISTWPS 243

Query: 233 FFSSTVSVINNQWQSPELLNESCGADYVKTNQHFPKGVSGNSENECIYCSFDGDADRIVF 292
                VS+INN W++P LLN  CGADYVKTNQ  PKG+  N  N  ++CSFDGDADRIVF
Sbjct: 244 TLRGNVSIINNSWENPNLLNNDCGADYVKTNQKLPKGIQ-NPSNLNLHCSFDGDADRIVF 302

Query: 293 YYHDE-KSKFNLLDGDKISTLFAKFFKELLVAAGAENELKLGVVQTAYANGSSTEYLSSI 351
           YY  E   KF+LLDGDKI+TLFAKF   LL      ++LKLGVVQTAYANGSST YL+++
Sbjct: 303 YYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSSTNYLTNV 362

Query: 352 LEVPVSCTATGVKHLHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKLKEPQDEKTA 411
           L+VPVSCT TGVKHLHHEA   YDIGIYFEANGHGTV+FS+ F + +       Q+E   
Sbjct: 363 LKVPVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQVL-------QNEPKT 415

Query: 412 KALKTLYLFTNLINQTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLVKVIVPDR 471
            A +TL LF  +INQTVGDA++DML V+ VL + K +P +WDQ Y DLPNKL KVIVPDR
Sbjct: 416 TATQTLLLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNKLAKVIVPDR 475

Query: 472 SVFKTSNAERQLVSPKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAATKEKADRL 531
           SVF T+N ERQL SP GLQEKID  V +  +GRSFVRASGTEDAVRVYAEAAT+E+ ++L
Sbjct: 476 SVFITTNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEAATQEETEKL 535

Query: 532 AASVSDLVSRSVS 544
           +  V   V  SVS
Sbjct: 536 SQEVCKFVLSSVS 548

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score =  558 bits (1439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/534 (54%), Positives = 369/534 (69%), Gaps = 15/534 (2%)

Query: 7   LEELYDKHCKXXXXXXXXXXXX-RYKADVLDTVMFTTGILAAIRSIYLKGQYVGVMITAS 65
           LE L +++C              R  ++ LDTVMF TGI+A +RS  L G+ VGVMITAS
Sbjct: 5   LESLIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMITAS 64

Query: 66  HNPPQDNGVKIVDPKGEMLDQAWEPFATELANSASKGKQELIKALDKLITKLGIDDTESA 125
           HNP  DNGVK+V+P G ML Q+WE  ATELAN  +    E IKA  K+      + +   
Sbjct: 65  HNPSGDNGVKVVEPDGSMLIQSWESTATELANLLANRPLEDIKA--KVGQLTSGESSVRP 122

Query: 126 KITISRDSRESGPRLLQAVIDGTKVLKNVQVVDFNLLTTPQLHFLTYQYNQGSSSKVEES 185
           ++ + RDSR SGP LL  ++     L + ++ D+ LLTTPQLHFLT +    + + V+E 
Sbjct: 123 QLIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTTPQLHFLTNE-TMITGAHVDEQ 181

Query: 186 TYYSAFSSAWTKICGLHDINSLPYRVIIDAANGIGGPKVSEMLLKNKFFSSTVSVINNQW 245
            Y++ F  AW +I  L  +  LP  V++D ANGIGGPK+S  LL    F+   SVIN++ 
Sbjct: 182 AYFAHFLGAWDQIAALQPVK-LP-NVVVDCANGIGGPKMSA-LLTQWGFAKQCSVINDKC 238

Query: 246 QSPELLNESCGADYVKTNQHFPKGVSGNSENECIYCSFDGDADRIVFYYHDEKSKFNLLD 305
             PELLN  CGAD+VKT+Q  P GV  N+ +  +YCSFDGDADR+VFYY D+   F+LLD
Sbjct: 239 DEPELLNHGCGADFVKTSQRLPNGVKPNAND--LYCSFDGDADRVVFYYLDQNLGFHLLD 296

Query: 306 GDKISTLFAKFFKELLVAAGAENELKLGVVQTAYANGSSTEYLSSILEVPVSCTATGVKH 365
           GDKISTLFA F  +LL     ++ L +GVVQTAYANGSST+YL   L+VPVSCT TGVKH
Sbjct: 297 GDKISTLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQDNLQVPVSCTKTGVKH 356

Query: 366 LHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKLKEPQDEKTAKALKTLYLFTNLIN 425
           LHHEA++NYDIGIYFEANGHGTV+FS++FH+T+     +  +      LK L     LIN
Sbjct: 357 LHHEAVNNYDIGIYFEANGHGTVMFSNKFHETVTNHADQTPE------LKILKYLAKLIN 410

Query: 426 QTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLVKVIVPDRSVFKTSNAERQLVS 485
           QTVGDAISDM+AVLAVL IL+WSP +WD+E+TDLPNKL KV+V DRS F T++ ER+LVS
Sbjct: 411 QTVGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRSAFTTTDQERRLVS 470

Query: 486 PKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAATKEKADRLAASVSDLV 539
           P GLQ+KID  V   + GRSFVRASGTEDAVRVYAEAAT+ + D+L++ V DLV
Sbjct: 471 PAGLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQLSSIVGDLV 524

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score =  548 bits (1411), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/533 (55%), Positives = 372/533 (69%), Gaps = 25/533 (4%)

Query: 29  RYKADVLDTVMFTTGILAAIRSIYL----KGQYVGVMITASHNPPQDNGVKIVDPKGEML 84
           R  A  LDTVMFTTGI+A +RS+ L    K   +GVM+TASHNPP+DNGVKI++P G ML
Sbjct: 35  RDNAKRLDTVMFTTGIVACLRSLTLQTSNKHSAIGVMVTASHNPPEDNGVKIIEPNGSML 94

Query: 85  DQAWEPFATELANSASKGK-----QELIKALDKLITKLGIDDTESAKITISRDSRESGPR 139
            Q WEP AT+ AN A+        Q LI ++  L   L I   +   + +  DSR+S P 
Sbjct: 95  LQEWEPKATQFANIAANESFDEFYQLLIDSIVTLENDLNIK--QPPTLILGHDSRDSSPT 152

Query: 140 LLQAVIDGTKVLKNVQVVDFNLLTTPQLHFLTYQYNQGSSSKVEESTYYSAFSSAWTKIC 199
           L+  +I    ++ N +++++N +TTPQLHFLT      ++   EE  YY  F+   +++ 
Sbjct: 153 LMNHIIKSATLIFNAKIINYNYVTTPQLHFLTNL--TNTTGTAEEINYYDHFNKYLSQLQ 210

Query: 200 GLHDINSLPY-RVIIDAANGIGGPKVSEMLL-KNKF----FSSTVSVINNQWQSPELLNE 253
            L+   +LP+  +IIDAANGIG P+V ++L  KNKF      + + +INN  ++P LLN 
Sbjct: 211 SLYPPFNLPFDNLIIDAANGIGAPQVEKLLFTKNKFPPLNIKNPIKIINNDSKNPNLLNM 270

Query: 254 SCGADYVKTNQHFPKGVSGNSE-NECIYCSFDGDADRIVFYYHDEKSK-FNLLDGDKIST 311
           +CGADYVKTNQ  P+G+  + + N  ++CS+DGDADRIVFYY D  +  FNLLDGDKI+T
Sbjct: 271 NCGADYVKTNQKLPQGIPKDIDANSTLFCSYDGDADRIVFYYIDPMTNNFNLLDGDKIAT 330

Query: 312 LFAKFFKELLVAAGAENELKLGVVQTAYANGSSTEYLSSILEVPVSCTATGVKHLHHEAI 371
           LFAKFF  LL  A   + LKLGVVQTAYANGSST Y+SS L+VPVSCT TGVKHLHHEAI
Sbjct: 331 LFAKFFSNLLTIAKLNHILKLGVVQTAYANGSSTNYISSKLKVPVSCTKTGVKHLHHEAI 390

Query: 372 HNYDIGIYFEANGHGTVIFSDEFHKTIDKKLKEPQDEKTAKALKTLYLFTNLINQTVGDA 431
             YDIGIYFEANGHGTVIFSD+FH  +  KLKE     +++ +KTL LF+ LINQTVGDA
Sbjct: 391 TKYDIGIYFEANGHGTVIFSDKFHSEL-TKLKE---SGSSREIKTLLLFSELINQTVGDA 446

Query: 432 ISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLVKVIVPDRSVFKTSNAERQLVSPKGLQE 491
           +SDMLAV+AVL IL+ SP  WD+EY DLPNKL KVIVPDRS F T++ ER+LV PKGLQ 
Sbjct: 447 MSDMLAVIAVLSILQLSPNSWDKEYKDLPNKLAKVIVPDRSKFITTDQERKLVEPKGLQP 506

Query: 492 KIDSTVQEFEHGRSFVRASGTEDAVRVYAEAATKEKADRLAASVSDLVSRSVS 544
            ++  V     GRSFVRASGTEDAVRVYAEA T+E+ + L+  V  LV  SV+
Sbjct: 507 LLEEAVASVSLGRSFVRASGTEDAVRVYAEAKTQEETEWLSKKVCQLVIESVT 559

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score =  541 bits (1394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/547 (52%), Positives = 365/547 (66%), Gaps = 24/547 (4%)

Query: 9   ELYDKHC-KXXXXXXXXXXXXRYKADVLDTVMFTTGILAAIRSIYLKGQYVGVMITASHN 67
           +LY+K+C              R  A +LD+VMFTTG++AA+RSI  +   VGVMITASHN
Sbjct: 4   QLYNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHN 63

Query: 68  PPQDNGVKIVDPKGEMLDQAWEPFATELANSASKGKQELIKALDKLITKLGIDDTESAKI 127
           PP+DNGVKIV+  G ML Q WEP AT LANS +         L+ ++ +L I    + +I
Sbjct: 64  PPRDNGVKIVESDGSMLLQDWEPLATRLANSVAD-YHTFESTLNAIMQELNISPGHAPQI 122

Query: 128 TISRDSRESGPRLLQAVIDGTK-VLKNVQVVDFNLLTTPQLHFLTYQYNQGSSSKVEEST 186
            +  DSRES PRLL  ++DG K V  + ++ +  LLTTPQLHFLT      ++    E  
Sbjct: 123 VVGHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQLHFLT------ANPAHFEDY 176

Query: 187 YYSAFSSAWTKICGLHDINSLPY--RVIIDAANGIGGPKVSEMLLKN--------KFFSS 236
           YY  F  AW ++  L+ I       +++ID ANGIGGP+  +ML  +        K    
Sbjct: 177 YYRYFLDAWNQLFELYGIEGFKSFDKLVIDTANGIGGPQFLKMLSYSQTDLPHLQKIRLH 236

Query: 237 TVSVINNQWQSPELLNESCGADYVKTNQHFPKGVSGNSENECIYCSFDGDADRIVFYYHD 296
            + + NN W +P +LN  CGAD+VKTNQ  P+G++ +  N  +YCSFDGDADR+VFYY D
Sbjct: 237 QIDITNNSWLNPSMLNSGCGADFVKTNQRLPEGINADPRN--LYCSFDGDADRVVFYYVD 294

Query: 297 EKSKFNLLDGDKISTLFAKFFKELLVAAGAENELKLGVVQTAYANGSSTEYLSSILEVPV 356
           +   F+LLDGDKISTL A F   LL  AG   ELKLGVVQTAYANGSST Y++  L+VPV
Sbjct: 295 DSLTFHLLDGDKISTLLAYFINALLKEAGLAEELKLGVVQTAYANGSSTTYVTKKLQVPV 354

Query: 357 SCTATGVKHLHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKLKEPQDEKTAKALKT 416
           S   TGVKHLHHEA+ NYDIG+YFEANGHGTVIFS  F++ I+ +L +   +K+   L+ 
Sbjct: 355 SIAKTGVKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAKNAHDKSTLTLRL 414

Query: 417 LYLFTNLINQTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLVKVIVPDRSVFKT 476
           L   + LINQT+GDAISDMLA++ VL IL WSP  WD EYTDLPNKL KV+VPDRS+F T
Sbjct: 415 L---SRLINQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVVPDRSIFIT 471

Query: 477 SNAERQLVSPKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAATKEKADRLAASVS 536
           ++ ER+LVSP GLQ+KID  V +   GRSF+RASGTEDAVRVYAEA T E  ++L+  V+
Sbjct: 472 TDQERRLVSPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEATEKLSTEVT 531

Query: 537 DLVSRSV 543
           D +  +V
Sbjct: 532 DALIETV 538

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score =  531 bits (1367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/546 (50%), Positives = 364/546 (66%), Gaps = 10/546 (1%)

Query: 1   MVNIQLLEELYDKHCKXXXXXXXXXXX-XRYKADVLDTVMFTTGILAAIRSIYLKGQYVG 59
           M +I  LE  + K+C              R  A  LDTVMFTTGI+A +RS+ L+G+Y+G
Sbjct: 1   MFDITQLEPAFIKYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIG 60

Query: 60  VMITASHNPPQDNGVKIVDPKGEMLDQAWEPFATELANSASKGK-QELIKALDKLITKLG 118
           VMITASHNPPQDNGVKIV+P G ML ++WE  AT+LAN AS G     +  L ++I KL 
Sbjct: 61  VMITASHNPPQDNGVKIVEPSGAMLIESWEQIATDLANIASHGNFTAFVMHLSQVIAKLN 120

Query: 119 IDDTESAKITISRDSRESGPRLLQAVIDGTKVLKNVQVVDFNLLTTPQLHFLTYQYNQGS 178
           ID+T + ++ +  DSRES P L++ +     V   + V++  L+TTPQLH+LT   N   
Sbjct: 121 IDETTTPRLIVGHDSRESSPYLMECLQAAAPVFDTI-VINHTLITTPQLHYLTMLQND-- 177

Query: 179 SSKVEESTYYSAFSSAWTKICGLH-DINSLPYRVIIDAANGIGGPKVSEMLLKNKFFSST 237
              V E  YY  FS++W  +  L+ D+N     +I+D ANG+G  + S+ L      ++ 
Sbjct: 178 --VVTEVDYYKFFSTSWNNLFSLYPDLNLTFNNLIVDGANGVGSVQFSKFLPYLPQLATL 235

Query: 238 VSVINNQWQSPELLNESCGADYVKTNQHFPKGVSGNSENECIYCSFDGDADRIVFYYHDE 297
            ++IN++   P++LN  CGAD+VKTNQ  P G+  N     +Y SFDGDADRIVFYY D 
Sbjct: 236 TTIINDKHNVPQMLNVDCGADFVKTNQKLPNGIV-NPNPSDLYASFDGDADRIVFYYVDN 294

Query: 298 KSKFNLLDGDKISTLFAKFFKELLVAAGAENELKLGVVQTAYANGSSTEYLSSILEVPVS 357
             KF+LLDGDKIST+  K    +L  +   N++ LGVVQTAYANGSST+Y++  L+VPV 
Sbjct: 295 NKKFHLLDGDKISTILTKCLISMLRESELLNDINLGVVQTAYANGSSTKYITKSLKVPVE 354

Query: 358 CTATGVKHLHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKLKE-PQDEKTAKALKT 416
           CT TGVKHLHH A   +DIGIYFEANGHGTV+FS++F++ + K +      EK  KA  +
Sbjct: 355 CTKTGVKHLHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDNGSSSEKIHKARLS 414

Query: 417 LYLFTNLINQTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLVKVIVPDRSVFKT 476
           L+ F+ LINQTVGD+++D+LAV+A L IL+ SP  WD EY DLPN L K  V +R VFKT
Sbjct: 415 LFYFSKLINQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLTKCTVLNRFVFKT 474

Query: 477 SNAERQLVSPKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAATKEKADRLAASVS 536
           ++ ER+L SP GLQEKID+ V +++ GRSFVRASGTEDAVR+YAEA TK + + L+  V+
Sbjct: 475 TDMERKLTSPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKTKAEVEALSKEVT 534

Query: 537 DLVSRS 542
            LV  S
Sbjct: 535 QLVENS 540

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score =  488 bits (1256), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 259/524 (49%), Positives = 344/524 (65%), Gaps = 23/524 (4%)

Query: 29  RYKADVLDTVMFTTGILAAIRSIYLKGQYVGVMITASHNPPQDNGVKIVDPKGEMLDQAW 88
           R KA VLDTVMF TG +A +RS  L G  VGVM+TASHNPP+DNGVK+VDP+G ML + W
Sbjct: 29  RDKAAVLDTVMFATGCVAVLRSWRLNGAQVGVMVTASHNPPEDNGVKVVDPEGGMLPEQW 88

Query: 89  EPFATELANSASKGKQELIKALDKLITKLGIDDTESAKITISRDSRESGPRLLQAVIDGT 148
           EP AT LAN A+ G  +        + + G + T  A++ +  D+RES PRLL+ ++D  
Sbjct: 89  EPLATRLANLAANGTFDQWWEYWTSLVEEG-NYTGGARLCVGHDTRESSPRLLKNLMDAA 147

Query: 149 KVLK--NVQVVDFNLLTTPQLHFLTYQYNQGSSSKVEESTYYSAFSSAWTKICGLHDINS 206
             +   ++ +    +   PQLH+LT     G +   + + Y   F   W K+     + +
Sbjct: 148 LAVSGGSITISKPWITNHPQLHYLTSLQRDGVT---DAAAYNDHFQGCWQKLFP-DGVVA 203

Query: 207 LPY-RVIIDAANGIGGPKVSEMLLKNKFFSSTVSVINNQWQSPELLNESCGADYVKTNQH 265
            P+ R+ ID ANG+G  ++ +         +   ++N  + +PE LN  CGAD+VKTN  
Sbjct: 204 WPFDRLFIDTANGVGAVQLQQFFKGWAVDQNKFRLLNTDYGTPENLNVKCGADFVKTNHR 263

Query: 266 FP------KGVSGNSENECIYCSFDGDADRIVFYYHDEKSKFNLLDGDKISTLFAKFFKE 319
            P      +G SG   +  +YCSFDGDADRIVFY+   K +F+LLDGDKISTLFAKF  +
Sbjct: 264 LPSEVPDQRGTSGALPD--LYCSFDGDADRIVFYFVKNK-QFHLLDGDKISTLFAKFIGQ 320

Query: 320 LLVAAGAENELKLGVVQTAYANGSSTEYLSSILEVPVSCTATGVKHLHHEAIHNYDIGIY 379
           L   AGA+++L +GVVQTAYANG+ST Y++S L +P +CT TGVKHLHH A   YDIGIY
Sbjct: 321 LTARAGADDKLTVGVVQTAYANGNSTRYIASELGIPSACTKTGVKHLHHVAKTQYDIGIY 380

Query: 380 FEANGHGTVIFSDEFHKTIDKKLKEPQDEKTAKALKTLYLFTNLINQTVGDAISDMLAVL 439
           FEANGHGTV+FSD+F++ +           T  A  TLY F+ LINQTVGDAI+DML VL
Sbjct: 381 FEANGHGTVVFSDKFNEVVAGV------ASTNDAASTLYHFSKLINQTVGDAIADMLGVL 434

Query: 440 AVLCILKWSPQKWDQEYTDLPNKLVKVIVPDRSVFKTSNAERQLVSPKGLQEKIDSTVQE 499
           AVL  L+W+P+ W  EYTDLPN L KV+VPDRS+F+T++ ER+LVSP+GLQEKID+ V  
Sbjct: 435 AVLIKLQWTPEVWGAEYTDLPNLLTKVVVPDRSIFETTDQERRLVSPEGLQEKIDACVGR 494

Query: 500 FEHGRSFVRASGTEDAVRVYAEAATKEKADRLAASVSDLVSRSV 543
           F+  RSFVRASGTE+AVR+Y EA   ++   L+  V++ V  SV
Sbjct: 495 FKRARSFVRASGTENAVRIYCEAEDPQEVQELSKQVTEAVLNSV 538

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 36/69 (52%), Gaps = 18/69 (26%)

Query: 58  VGVMITASHNPPQDNGVKIVDPKG------------EMLDQAWEPFATE------LANSA 99
           VGVMITASHNP  DNG K+    G            E ++   EP++T+      L+N+ 
Sbjct: 148 VGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGIAETINNNLEPWSTDWNFTKILSNAE 207

Query: 100 SKGKQELIK 108
           + GK E ++
Sbjct: 208 TDGKIEYVR 216

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 51/101 (50%), Gaps = 13/101 (12%)

Query: 55  GQYVGVMITASHNPPQDNGVKIVDPKGEMLDQAWEPFATELANSASKGKQELIKA--LDK 112
           G  VGVMITASHNP  DNG K+    G    Q   P  +E+A S  +      KA   D+
Sbjct: 156 GASVGVMITASHNPKMDNGYKVYYSNG---CQIIPPHDSEIAQSIEENLTLWPKAWKWDE 212

Query: 113 LITKLGIDD---TESAKITISRDSRESGPRLLQAVIDGTKV 150
           L+ K G+D      + +  I R +++ G    Q+++D T +
Sbjct: 213 LL-KEGLDTKCLVYAGEEMIERYTKKMG----QSLVDRTTI 248

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 27/48 (56%), Gaps = 12/48 (25%)

Query: 58  VGVMITASHNPPQDNGVK--------IVDPK----GEMLDQAWEPFAT 93
           VGVMITASHNP  DNG K        I+ P      EM+ +  EP++T
Sbjct: 153 VGVMITASHNPKMDNGYKVYYDNACQIIPPHDKNIAEMIQKNLEPWST 200

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 47/95 (49%), Gaps = 10/95 (10%)

Query: 457 TDLPNKLVKVIVPDRSVFKTSNAERQL----VSPKGLQEKIDSTVQEFEH----GRSFVR 508
           +++ N+L+  +  D +V   SN +  +    V P      +++   EF +     R  +R
Sbjct: 517 SEIGNELIVTVFRDLTVGYQSNTKDNIPNLPVDPTSQMITVEAKPSEFSNLEGTVRLTMR 576

Query: 509 ASGTEDAVRVYAEAATK--EKADRLAASVSDLVSR 541
            SGTE  ++VY EA +K  E A  LA S  D++ R
Sbjct: 577 GSGTEPKLKVYIEACSKSEESATNLARSTWDILKR 611

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score = 38.1 bits (87), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 12/66 (18%)

Query: 55  GQYVGVMITASHNPPQDNGVK--------IVDPKGEMLDQA----WEPFATELANSASKG 102
           G  VG+MITASHNP  DNG K        I+ P  +++ ++     EPF++    +    
Sbjct: 151 GASVGIMITASHNPKMDNGYKVYYTNGCQIIPPHDKLIAESIIHNLEPFSSPQTGTIIDC 210

Query: 103 KQELIK 108
           K+++ K
Sbjct: 211 KEKMTK 216

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score = 37.4 bits (85), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 16/22 (72%), Positives = 17/22 (77%)

Query: 55  GQYVGVMITASHNPPQDNGVKI 76
           G  VGVMITASHNP  DNG K+
Sbjct: 154 GASVGVMITASHNPKMDNGYKV 175

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 30/63 (47%), Gaps = 18/63 (28%)

Query: 58  VGVMITASHNPPQDNGVKIVDPKG------------EMLDQAWEPFATE------LANSA 99
           VGVM+TASHNP  DNG K+    G            + +D   EP+         +AN+ 
Sbjct: 166 VGVMVTASHNPKMDNGYKVYYSNGCQIIPPHDSGISQCIDANLEPWENSWNYKEIMANAE 225

Query: 100 SKG 102
           SKG
Sbjct: 226 SKG 228

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 33/79 (41%), Gaps = 27/79 (34%)

Query: 55  GQYVGVMITASHNPPQDNGVKIVDPKGEML-------------------DQAWEPFATEL 95
           G   G+MITASHNP  DNG K+    G  +                   DQAW+  A +L
Sbjct: 160 GASCGIMITASHNPKMDNGYKVYYSNGCQITPPHDKKIASEIDANLVPWDQAWD--AQKL 217

Query: 96  ANSASKG------KQELIK 108
              A         KQELIK
Sbjct: 218 IEDARNNNRLHDVKQELIK 236

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 24/46 (52%)

Query: 36  DTVMFTTGILAAIRSIYLKGQYVGVMITASHNPPQDNGVKIVDPKG 81
           D  + T  +  AI ++       GVMITASHNP  DNG K+    G
Sbjct: 137 DVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANG 182

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 15/19 (78%), Positives = 16/19 (84%)

Query: 58  VGVMITASHNPPQDNGVKI 76
           VGVMITASHNP  DNG K+
Sbjct: 154 VGVMITASHNPKMDNGYKV 172

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 16/22 (72%)

Query: 55  GQYVGVMITASHNPPQDNGVKI 76
           G   GVMITASHNP  DNG K+
Sbjct: 152 GASAGVMITASHNPKMDNGYKV 173

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/19 (78%), Positives = 16/19 (84%)

Query: 58  VGVMITASHNPPQDNGVKI 76
           VGVMITASHNP  DNG K+
Sbjct: 151 VGVMITASHNPKMDNGYKV 169

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 15/19 (78%), Positives = 16/19 (84%)

Query: 58  VGVMITASHNPPQDNGVKI 76
           VGVMITASHNP  DNG K+
Sbjct: 151 VGVMITASHNPKMDNGYKV 169

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 15/19 (78%), Positives = 16/19 (84%)

Query: 58  VGVMITASHNPPQDNGVKI 76
           VGVMITASHNP  DNG K+
Sbjct: 151 VGVMITASHNPKMDNGYKV 169

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 14/19 (73%), Positives = 16/19 (84%)

Query: 58  VGVMITASHNPPQDNGVKI 76
           +GVMITASHNP  DNG K+
Sbjct: 157 IGVMITASHNPEMDNGYKV 175

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 15/24 (62%), Positives = 17/24 (70%)

Query: 58  VGVMITASHNPPQDNGVKIVDPKG 81
           +GVMITASHNP  DNG K+    G
Sbjct: 154 IGVMITASHNPKMDNGYKVYYSNG 177

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 14/19 (73%), Positives = 16/19 (84%)

Query: 58  VGVMITASHNPPQDNGVKI 76
           VGVM+TASHNP  DNG K+
Sbjct: 151 VGVMVTASHNPKMDNGYKV 169

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score = 35.4 bits (80), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 15/19 (78%), Positives = 16/19 (84%)

Query: 58  VGVMITASHNPPQDNGVKI 76
           VGVMITASHNP  DNG K+
Sbjct: 147 VGVMITASHNPKLDNGYKV 165

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score = 35.0 bits (79), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 3/41 (7%)

Query: 36  DTVMFTTGILAAIRSIYLKGQYVGVMITASHNPPQDNGVKI 76
           D V+ T  +   I  +   G   G+MITASHNP  DNG K+
Sbjct: 137 DVVVHTPMVPFGIDHLRASG---GIMITASHNPKMDNGYKV 174

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score = 34.7 bits (78), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 16/23 (69%)

Query: 59  GVMITASHNPPQDNGVKIVDPKG 81
           GVMITASHNP  DNG K+    G
Sbjct: 158 GVMITASHNPKDDNGYKVYYSNG 180

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score = 34.7 bits (78), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 15/18 (83%)

Query: 59  GVMITASHNPPQDNGVKI 76
           G+MITASHNP  DNG K+
Sbjct: 156 GIMITASHNPKMDNGYKV 173

>NDAI0I02880 Chr9 complement(679180..681465) [2286 bp, 761 aa] {ON}
           Anc_3.514 YGL205W
          Length = 761

 Score = 34.3 bits (77), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 70/186 (37%), Gaps = 32/186 (17%)

Query: 154 VQVVDFNLLTTPQLHFLTYQYNQGSSSKVEESTYYSAFSSAWTKICGLHDINSLPYRVII 213
           +Q++D+ L     L  LT  Y    ++     TYYS                   Y+V  
Sbjct: 378 LQLIDYPLHQYRVLPQLTIPYLVSPAAFKLMDTYYSTLDEL--------------YKVSS 423

Query: 214 DAANGIGGPKVSEMLLKNKFFSSTVSVINNQWQSPELLNE---SCGADYVKTNQHFPKGV 270
            +     G KV    LKN F  S      N W    L++E   +CG         F KG 
Sbjct: 424 SSPANANGLKVVSEKLKNLFIDSASLKATNTWLISTLIDELRQTCGGHGYSQYNAFGKGY 483

Query: 271 SGNSENECIYCSFDGD--------ADRIVFYYHDE--KSKF-NLLDGDKISTLFAKFFKE 319
               ++  + C+++GD        A  I+  + D   K KF N LD D  + L  KF  +
Sbjct: 484 ----DDWVVQCTWEGDNNILSLTSAKSILKKFVDSATKGKFNNSLDEDSFNYLNPKFIMK 539

Query: 320 LLVAAG 325
           +   +G
Sbjct: 540 VFTPSG 545

>Skud_4.692 Chr4 (1224822..1226762) [1941 bp, 646 aa] {ON} YDR419W
           (REAL)
          Length = 646

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 52/122 (42%), Gaps = 21/122 (17%)

Query: 45  LAAIRSIYLKGQYVGVMITASHNPPQDNGVK-------IVDPKGEMLDQAWEPFATELAN 97
           L+ IR ++++G Y       SH PP    +K       + +P+G  +   W+     L +
Sbjct: 201 LSTIREVFIEGNYD----INSHLPPIPEKIKSLNFEGDVFNPQGRNVITDWDDVILALGS 256

Query: 98  SASKGKQELIKALDKLITKLGIDDTESAKITISRDSRESGPRLLQAVIDGTKVLKNVQVV 157
            A+KG ++ I+ +    T  G+  T++     S   +           D   ++KN  V+
Sbjct: 257 QATKGVRDTIENILGYTTSCGLSRTKNVSKLASNYKKP----------DAQTIVKNDCVL 306

Query: 158 DF 159
           DF
Sbjct: 307 DF 308

>TPHA0K00690 Chr11 complement(135928..144285) [8358 bp, 2785 aa] {ON}
            Anc_7.418 YBL088C
          Length = 2785

 Score = 31.6 bits (70), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 61/123 (49%), Gaps = 17/123 (13%)

Query: 390  FSDEFHKTIDKKLKEPQDEKTAKALKTLYLFTNLINQTVGDAISDMLAVLAVLCILKWSP 449
             SD  H  IDK +   QD     A+KT +L  ++I  T   + S + +   ++    WS 
Sbjct: 2005 LSDFVHGAIDKNM--IQD-----AVKTSFLIEDIIKSTNAFSTSMLNSAKYIIANAMWS- 2056

Query: 450  QKWDQEYTDLPNKLVKVIVPDRSVFKTSN---AERQLVSPKGLQEKIDSTVQEFEHGRSF 506
                 E+T +P +L+K ++ ++SV +TS      + L S  G  E+I +T+ ++    S+
Sbjct: 2057 ----LEHTKIPIELLKNVLSNKSVTRTSKDLEDYKPLFSISG--EQIKATLVKWSSESSY 2110

Query: 507  VRA 509
             RA
Sbjct: 2111 ERA 2113

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,258,884
Number of extensions: 2478601
Number of successful extensions: 7426
Number of sequences better than 10.0: 52
Number of HSP's gapped: 7534
Number of HSP's successfully gapped: 53
Length of query: 544
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 429
Effective length of database: 40,294,809
Effective search space: 17286473061
Effective search space used: 17286473061
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)