Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E00880g6.10ON63658526470.0
TPHA0M002006.10ON63458621270.0
Kpol_1045.776.10ON65059921070.0
ACR016W6.10ON64059021030.0
Kwal_56.223506.10ON65859420970.0
TBLA0G011106.10ON63858920680.0
KLLA0D00836g6.10ON64059020500.0
TDEL0G046106.10ON63358620180.0
KLTH0C11528g6.10ON64259020000.0
ZYRO0F00484g6.10ON64359019760.0
NCAS0D021906.10ON64559319310.0
CAGL0A01067g6.10ON64159319090.0
KAFR0B065006.10ON63660617960.0
NDAI0I027506.10ON66360917410.0
KNAG0E027806.10ON65057615050.0
Skud_16.146.10ON65258114190.0
YPL263C (KEL3)6.10ON65158014130.0
Suva_16.426.10ON65458514090.0
Smik_6.4716.10ON65158013840.0
Kpol_1050.695.88ON10842531942e-14
NCAS0F005205.88ON10862591611e-10
KAFR0B043205.88ON9862261493e-09
SAKL0H02618g5.88ON10852551485e-09
ZYRO0B08228g5.88ON12932561451e-08
Skud_8.2225.88ON11692541451e-08
KLLA0E15511g5.88ON9052521432e-08
Kwal_14.10195.88ON9782551422e-08
Smik_8.2425.88ON11682541413e-08
Suva_15.3575.88ON11722551404e-08
KNAG0K005605.88ON11042561404e-08
YHR158C (KEL1)5.88ON11642541395e-08
KLTH0C01474g5.88ON10562511371e-07
CAGL0I02090g5.88ON11362571361e-07
TDEL0G011205.88ON10092501352e-07
TPHA0H010805.88ON8282531342e-07
CAGL0F07997g5.88ON9362561314e-07
NDAI0D026005.88ON11672251315e-07
TPHA0A051705.88ON10162511243e-06
Suva_7.5305.88ON8942571216e-06
YGR238C (KEL2)5.88ON8822231191e-05
Kpol_1010.625.88ON9732581182e-05
Ecym_20615.88ON13622501182e-05
TBLA0C065305.88ON11722721163e-05
ADL149W5.88ON12112531163e-05
Smik_16.685.88ON8941421111e-04
Skud_7.5725.88ON8832231111e-04
YOL141W (PPM2)3.15ON69595830.21
TBLA0A043207.9ON838100790.60
ZYRO0C00550g7.9ON84871771.0
NCAS0A076407.9ON91386752.0
ZYRO0C03344g3.15ON65894752.1
Kwal_55.207568.157ON157554716.2
CAGL0K02101g8.157ON163396716.9
Kpol_1014.253.15ON62987707.4
YDL074C (BRE1)4.268ON70045707.6
Smik_7.758.157ON1483142708.7
NCAS0B054408.157ON1550117709.3
KAFR0I029103.15ON691136699.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E00880g
         (636 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON...  1024   0.0  
TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON...   823   0.0  
Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON} (1807...   816   0.0  
ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic ho...   814   0.0  
Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON...   812   0.0  
TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {O...   801   0.0  
KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON...   794   0.0  
TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.1...   781   0.0  
KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} simila...   775   0.0  
ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON...   765   0.0  
NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {O...   748   0.0  
CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} simila...   739   0.0  
KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6...   696   0.0  
NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {O...   675   0.0  
KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {O...   584   0.0  
Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}...   551   0.0  
YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}  K...   548   0.0  
Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}...   547   0.0  
Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C ...   537   0.0  
Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]...    79   2e-14
NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5....    67   1e-10
KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {O...    62   3e-09
SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} simil...    62   5e-09
ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} simil...    60   1e-08
Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {O...    60   1e-08
KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} simi...    60   2e-08
Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C...    59   2e-08
Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {O...    59   3e-08
Suva_15.357 Chr15 complement(617637..618952,619001..621203) [351...    59   4e-08
KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {O...    59   4e-08
YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON} ...    58   5e-08
KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} simil...    57   1e-07
CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa] ...    57   1e-07
TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5....    57   2e-07
TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {O...    56   2e-07
CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {...    55   4e-07
NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {...    55   5e-07
TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]...    52   3e-06
Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON...    51   6e-06
YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}  ...    50   1e-05
Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa] ...    50   2e-05
Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar t...    50   2e-05
TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]...    49   3e-05
ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic h...    49   3e-05
Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C...    47   1e-04
Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON...    47   1e-04
YOL141W Chr15 (56452..58539) [2088 bp, 695 aa] {ON}  PPM2AdoMet-...    37   0.21 
TBLA0A04320 Chr1 (1068199..1070715) [2517 bp, 838 aa] {ON} Anc_7...    35   0.60 
ZYRO0C00550g Chr3 (39312..41858) [2547 bp, 848 aa] {ON} similar ...    34   1.0  
NCAS0A07640 Chr1 complement(1521774..1524515) [2742 bp, 913 aa] ...    33   2.0  
ZYRO0C03344g Chr3 complement(259809..261785) [1977 bp, 658 aa] {...    33   2.1  
Kwal_55.20756 s55 (545793..550520) [4728 bp, 1575 aa] {ON} YGL19...    32   6.2  
CAGL0K02101g Chr11 (182946..187847) [4902 bp, 1633 aa] {ON} simi...    32   6.9  
Kpol_1014.25 s1014 complement(42216..44105) [1890 bp, 629 aa] {O...    32   7.4  
YDL074C Chr4 complement(324047..326149) [2103 bp, 700 aa] {ON}  ...    32   7.6  
Smik_7.75 Chr7 (119160..123611) [4452 bp, 1483 aa] {ON} YGL197W ...    32   8.7  
NCAS0B05440 Chr2 (1017388..1022040) [4653 bp, 1550 aa] {ON}            32   9.3  
KAFR0I02910 Chr9 complement(582726..584801) [2076 bp, 691 aa] {O...    31   9.4  

>SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 636

 Score = 1024 bits (2647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/585 (86%), Positives = 504/585 (86%)

Query: 52  LANFKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGEXXXXXXXXXAFYN 111
           LANFKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGE         AFYN
Sbjct: 52  LANFKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGENTNSTNSTTAFYN 111

Query: 112 DLFTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL 171
           DLFTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL
Sbjct: 112 DLFTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL 171

Query: 172 LDCNTKEWTKIEQKNGPTARSGHRLTVWKNYFILHGGFRDLGTMTTYLSDCWLFDITTYK 231
           LDCNTKEWTKIEQKNGPTARSGHRLTVWKNYFILHGGFRDLGTMTTYLSDCWLFDITTYK
Sbjct: 172 LDCNTKEWTKIEQKNGPTARSGHRLTVWKNYFILHGGFRDLGTMTTYLSDCWLFDITTYK 231

Query: 232 WKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKSD 291
           WKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKSD
Sbjct: 232 WKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKSD 291

Query: 292 IGAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFYNDLFTFQI 351
           IGAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFYNDLFTFQI
Sbjct: 292 IGAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFYNDLFTFQI 351

Query: 352 ETNRWYSASLRPQRKAAKATSKNNRNKDKELEDILNQILEKANLNDDENEKETIGDVXXX 411
           ETNRWYSASLRPQRKAAKATSKNNRNKDKELEDILNQILEKANLNDDENEKETIGDV   
Sbjct: 352 ETNRWYSASLRPQRKAAKATSKNNRNKDKELEDILNQILEKANLNDDENEKETIGDVLKE 411

Query: 412 XXXXXXXXXXXXXXXKKEYPIRIQLPHPRFNASTAVVDDTLFIFGGVWEIGEKDYSIDSF 471
                          KKEYPIRIQLPHPRFNASTAVVDDTLFIFGGVWEIGEKDYSIDSF
Sbjct: 412 LDEEDSDSAEELNSEKKEYPIRIQLPHPRFNASTAVVDDTLFIFGGVWEIGEKDYSIDSF 471

Query: 472 YAIDLNRLDGIKIYWEDLRDIEMAKELGXXXXXXXXXXXXXXXXXXXXXXITDQKLVAXX 531
           YAIDLNRLDGIKIYWEDLRDIEMAKELG                      ITDQKLVA  
Sbjct: 472 YAIDLNRLDGIKIYWEDLRDIEMAKELGDEEEDFEDNEEDDEEDDDDEEEITDQKLVAED 531

Query: 532 XXXXXXXXXXXXXXXXXXRPWLPHPKPFETLRGFYVRTGADFLEWAISSNRDARGKHLKK 591
                             RPWLPHPKPFETLRGFYVRTGADFLEWAISSNRDARGKHLKK
Sbjct: 532 DDEEEEEEDEYEPEIPDPRPWLPHPKPFETLRGFYVRTGADFLEWAISSNRDARGKHLKK 591

Query: 592 KSFDLCQDRWWERRDQVRIEEDKXXXXXXXXXXXXKDTSKSKKRR 636
           KSFDLCQDRWWERRDQVRIEEDK            KDTSKSKKRR
Sbjct: 592 KSFDLCQDRWWERRDQVRIEEDKLEELGGIGEVVEKDTSKSKKRR 636

>TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON}
           Anc_6.10 YPL263C
          Length = 634

 Score =  823 bits (2127), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/586 (66%), Positives = 456/586 (77%), Gaps = 5/586 (0%)

Query: 52  LANFKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGEXXXXXXXXXAFYN 111
           LANFK+EQE+FE++ V +VD+PTRRINS M+ANP HGK+ELLLFGGE          FYN
Sbjct: 53  LANFKKEQEQFEQINVESVDKPTRRINSCMIANPNHGKKELLLFGGENTSQEQGVTHFYN 112

Query: 112 DLFTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL 171
           DL+T++ D D W+KI+SQNSPMPRSSAA+AAHPSG+ L+HGGEFSSPKQNTFYHYSDTWL
Sbjct: 113 DLYTFTPDNDLWKKITSQNSPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTWL 172

Query: 172 LDCNTKEWTKIEQKNGPTARSGHRLTVWKNYFILHGGFRDLGTMTTYLSDCWLFDITTYK 231
           LDC T+EWTK+EQKNGP+ARSGHR+TVWKNYFILHGGFRDLG+ T+YL+D WLFDIT+YK
Sbjct: 173 LDCTTREWTKVEQKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFDITSYK 232

Query: 232 WKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKSD 291
           W+Q++FPPNHP+PDARSGHSL+PT +GAVLWGGYCKVKAGKGLQKGKIL DCWYLKMK+D
Sbjct: 233 WRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAGKGLQKGKILGDCWYLKMKAD 292

Query: 292 IGAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFYNDLFTFQI 351
             A+RWERRKKQGFQPSPRVGCSMVHHKGRGILFGGV+DFEETEESL+S+FYNDLF++QI
Sbjct: 293 PSAVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSIFYNDLFSYQI 352

Query: 352 ETNRWYSASLRPQR-KAAKATSKNNRNKDKELEDILNQILEKANLNDDENEKETIGDVXX 410
           E+NRWY+  LR QR K  +  +K+++ K+ EL++ILN+ILEKANL DD+   E   ++  
Sbjct: 353 ESNRWYALQLRSQRKKVVRLNNKSSKEKELELQNILNEILEKANLKDDD---EDANELSN 409

Query: 411 XXXXXXXXXXXXXXXXKKEYPIRIQLPHPRFNASTAVVDDTLFIFGGVWEIGEKDYSIDS 470
                           KKEY +R QLPH RFNAST VVDDTLFI+GGVWE+GEKDYSIDS
Sbjct: 410 GLGSDSDSDDESEKVSKKEYIVRNQLPHHRFNASTTVVDDTLFIYGGVWELGEKDYSIDS 469

Query: 471 FYAIDLNRLDGIKIYWEDLRDIEMAKELGXXXXXXXXXXXXXXXXXXXXXXITDQKLVAX 530
            Y+IDLN+LDG+ +YWE+L DIE AKELG                      + DQKLVA 
Sbjct: 470 MYSIDLNKLDGVTVYWENLHDIEKAKELGAINSDEEDEEDEDDEDDDEEETV-DQKLVAE 528

Query: 531 XXXXXXXXXXXXXXXXXXXRPWLPHPKPFETLRGFYVRTGADFLEWAISSNRDARGKHLK 590
                              RPWLPHPK FE+LR FYVRTGA FLEWAIS+N+  RGKHLK
Sbjct: 529 EEEEEEEIEDADDMEIPDPRPWLPHPKAFESLRNFYVRTGASFLEWAISNNKHTRGKHLK 588

Query: 591 KKSFDLCQDRWWERRDQVRIEEDKXXXXXXXXXXXXKDTSKSKKRR 636
            KSF+LCQDRWWERRDQVRIEEDK            KDT+KS KRR
Sbjct: 589 TKSFELCQDRWWERRDQVRIEEDKLEELGGVGEVIEKDTTKSTKRR 634

>Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON}
           (180710..182662) [1953 nt, 651 aa]
          Length = 650

 Score =  816 bits (2107), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/599 (65%), Positives = 457/599 (76%), Gaps = 14/599 (2%)

Query: 52  LANFKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGEXXXXXXXXXAFYN 111
           LANFK+EQE FE++ + +V+RP+RRIN  M+ NP HGK EL+LFGGE          F+N
Sbjct: 52  LANFKKEQELFEQINIESVERPSRRINPCMIENPNHGKSELILFGGESTNKDTSTTQFFN 111

Query: 112 DLFTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL 171
           DL++Y+ + DQWR+ +S+NSPMPRSSAA+AAHPSGV LIHGGEFSSPKQNTFYHYSDTWL
Sbjct: 112 DLYSYTPENDQWRRYTSKNSPMPRSSAAMAAHPSGVALIHGGEFSSPKQNTFYHYSDTWL 171

Query: 172 LDCNTKEWTKIEQKNGPTARSGHRLTVWKNYFILHGGFRDLGTMTTYLSDCWLFDITTYK 231
           LDC+TKEWTK+EQKNGP+ARSGHR+++WKNYF+LHGGFRDLGT TTYL+DCWLFDIT YK
Sbjct: 172 LDCSTKEWTKVEQKNGPSARSGHRISIWKNYFMLHGGFRDLGTSTTYLNDCWLFDITNYK 231

Query: 232 WKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKSD 291
           WKQ++FPPNHPIPDARSGHS +PT +GAVLWGGYCKVKAGKGLQKGKILTDCWYLKMK+D
Sbjct: 232 WKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKAD 291

Query: 292 IGAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFYNDLFTFQI 351
             AIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGV+DFEETEESL+SMFYNDLF++QI
Sbjct: 292 PTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSMFYNDLFSYQI 351

Query: 352 ETNRWYSASLRPQR-KAAKATSKNNRNKDKELEDILNQILEKANLNDDENEK-------- 402
           E NRW++  LRPQR K  +  +K++++K+KEL+D+LNQILEKANLND +++         
Sbjct: 352 EINRWFALQLRPQRKKVVRLNNKSSKDKEKELQDLLNQILEKANLNDKDDKDQEDEDAKA 411

Query: 403 -ETIGDVXXXXXXXXXXXXXXXXXXKKEYPIRIQLPHPRFNASTAVVDDTLFIFGGVWEI 461
            ET  D                   KKEY +  QLPHPRFNA+  VV+DTLFI+GGVWE+
Sbjct: 412 IETELDRADHDTSDSDADDVEDAKEKKEYKVLTQLPHPRFNATMTVVNDTLFIYGGVWEL 471

Query: 462 GEKDYSIDSFYAIDLNRLDGIKIYWEDLRDIEMAKELG-XXXXXXXXXXXXXXXXXXXXX 520
           GEKDY+IDSFY+IDLNR DG+ + WEDL +IE AKE G                      
Sbjct: 472 GEKDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKEAGIVDSDEEDDEFGDSDDEDDGEE 531

Query: 521 XITDQKLVAXXXXXXXXXXXXXXXXXXXXR---PWLPHPKPFETLRGFYVRTGADFLEWA 577
            I DQKLVA                        PWLPHPKPFE+LR FYVRTGA FLEWA
Sbjct: 532 EIMDQKLVAEEEEEEEEEEEEEQVDEMEIPDPCPWLPHPKPFESLRVFYVRTGATFLEWA 591

Query: 578 ISSNRDARGKHLKKKSFDLCQDRWWERRDQVRIEEDKXXXXXXXXXXXXKDTSKSKKRR 636
           IS+NRDARGKHLKKKSFDLCQDRWW+RRDQVRIEEDK            KDTSKS KRR
Sbjct: 592 ISNNRDARGKHLKKKSFDLCQDRWWQRRDQVRIEEDKMEELGGIGEVIEKDTSKSTKRR 650

>ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL263C (KEL3)
          Length = 640

 Score =  814 bits (2103), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/590 (67%), Positives = 452/590 (76%), Gaps = 6/590 (1%)

Query: 52  LANFKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGEXXXXXXXXXAFYN 111
           LANFKR+Q +FE V V TV+RP +R +SS+VANPLH KREL+LFGGE          FYN
Sbjct: 52  LANFKRQQAEFEAVNVETVERPHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMTHFYN 111

Query: 112 DLFTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL 171
           DLF YSLD DQW+K +SQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL
Sbjct: 112 DLFIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL 171

Query: 172 LDCNTKEWTKIEQKNGPTARSGHRLTVWKNYFILHGGFRDLGTMTTYLSDCWLFDITTYK 231
            DC T EWTKIEQKNGP++RSGHR+TVWKNY ILHGGFRDLGT TTYL+DCWLFDITTYK
Sbjct: 172 FDCATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFDITTYK 231

Query: 232 WKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKSD 291
           W+Q+ FP NHPIPDARSGHSL+PTP+GA+LWGGYCKVKAGKGLQKGKILTDCWYLKMKSD
Sbjct: 232 WQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMKSD 291

Query: 292 IGAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFYNDLFTFQI 351
           + AIRWERRKKQGFQPS R GCSMVHHKGRGILFGGV+D+EETEE L+S+FYNDLFT+ I
Sbjct: 292 VTAIRWERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDLFTYHI 351

Query: 352 ETNRWYSASLRPQRKA-AKATSKNNRNKDKELEDILNQILEKANLNDDENEKETIGDVXX 410
           ETNRWYS SLR QR +  K+  K+NR+KDKELED+LN IL+KANL+DD+ +++    +  
Sbjct: 352 ETNRWYSVSLRAQRHSKVKSAPKSNRDKDKELEDMLNAILKKANLDDDDGDEDG-KTIEE 410

Query: 411 XXXXXXXXXXXXXXXXKKEYPIRIQLPHPRFNASTAVVDDTLFIFGGVWEIGEKDYSIDS 470
                           KK YPI ++LPHPRFNASTA+VDDTLFIFGGVWE GEKDY IDS
Sbjct: 411 ELNKLENDGITETEETKKSYPIVMKLPHPRFNASTAIVDDTLFIFGGVWEQGEKDYMIDS 470

Query: 471 FYAIDLNRLDGIKIYWEDLRDIEMAKELGXXXXXXXXXXXXXXXXXXXXXXITDQKLVAX 530
           FY+ID+N++DG+K+YWED+  +E AKELG                       +D+KLVA 
Sbjct: 471 FYSIDMNKVDGVKVYWEDMAAVERAKELGEEDEDDAEDDEDDDSEDDDEEEHSDRKLVAE 530

Query: 531 XXXXXXXXXXXXXXXXXXXRPWLPHPKPFETLRGFYVRTGADFLEWAISSNR----DARG 586
                              RPWLPHPK FE+LR FYVRTGA FLEWAI++      DA+G
Sbjct: 531 EEEEEEEEDNEILPEIPDPRPWLPHPKAFESLRAFYVRTGASFLEWAITNKHNTRSDAKG 590

Query: 587 KHLKKKSFDLCQDRWWERRDQVRIEEDKXXXXXXXXXXXXKDTSKSKKRR 636
           KHLKK SFDLCQ+RWWERR+QVRIEEDK            KD +K  KRR
Sbjct: 591 KHLKKHSFDLCQERWWERREQVRIEEDKLEELGGVGEVIEKDFTKPTKRR 640

>Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON}
           YPL263C (KEL3) - Kelch-repeat protein, similar to Kel1
           and Kel2 [contig 186] FULL
          Length = 658

 Score =  812 bits (2097), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/594 (66%), Positives = 461/594 (77%), Gaps = 22/594 (3%)

Query: 52  LANFKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGEXXXXXXXXXAFYN 111
           LANFK+EQE F+EV+V+ V+RP++RINS MVANP+HGKRELL+FGGE         AFYN
Sbjct: 78  LANFKKEQELFQEVLVTPVERPSQRINSCMVANPIHGKRELLIFGGEHTNSTNSLTAFYN 137

Query: 112 DLFTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL 171
           +LFTYSLD DQWRKI+S+NSPMPRSSAA AAH SGV LIHGGEFSSPKQNTFYHYSDTWL
Sbjct: 138 ELFTYSLDSDQWRKITSRNSPMPRSSAAAAAHSSGVALIHGGEFSSPKQNTFYHYSDTWL 197

Query: 172 LDCNTKEWTKIEQKNGPTARSGHRLTVWKNYFILHGGFRDLGTMTTYLSDCWLFDITTYK 231
           LDC TKEWTK+EQKNGP+ARSGHR+T+WKN+FILHGGFRDLGT TTYL+D W+FDITTYK
Sbjct: 198 LDCTTKEWTKMEQKNGPSARSGHRMTIWKNFFILHGGFRDLGTSTTYLNDLWIFDITTYK 257

Query: 232 WKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKSD 291
           WKQV+FPPNHPIPDARSGHS++PT DGAVLWGGYCKVKAGKGLQKGK LTDCWYLKMKSD
Sbjct: 258 WKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQKGKTLTDCWYLKMKSD 317

Query: 292 IGAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFYNDLFTFQI 351
           + AIRWERRKKQGFQPSPRVGCSMVHHKGRG+LFGGV+DFEETEE L S F+NDLF++Q+
Sbjct: 318 VSAIRWERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLASEFFNDLFSYQV 377

Query: 352 ETNRWYSASLRPQRKAAKATSKNNRNKDKELEDILNQILEKANL--------NDDENEKE 403
           E NRWYS  +RPQ+K   A S+NNRNKD+ELE+ILN IL++ANL        N+ + E +
Sbjct: 378 EANRWYSVKMRPQKKKTVAISRNNRNKDEELENILNDILQQANLADDTDDDDNEIKRELQ 437

Query: 404 TIGDVXXXXXXXXXXXXXXXXXXKKEYPIRIQLPHPRFNASTAVVDDTLFIFGGVWEIGE 463
            I +                   +K+Y +  QLPHPRFNA+TAVVDD LFIFGGVWE GE
Sbjct: 438 RIDE------------EEALENSRKQYEVVGQLPHPRFNATTAVVDDFLFIFGGVWEFGE 485

Query: 464 KDYSIDSFYAIDLNRLDGIKIYWEDLRDIEMAKELGXXXXXXXXXXXXXXXXXXXXXXIT 523
           +D+SIDSFY+IDLN+LDG+K+YWE+L ++E AK LG                        
Sbjct: 486 RDFSIDSFYSIDLNKLDGVKVYWENLSELEKAKALG-EDDEEEFDDDEDDDDDDEEEETA 544

Query: 524 DQKLVAXXXXXXXXXXXXXXXXXX-XXRPWLPHPKPFETLRGFYVRTGADFLEWAISSNR 582
           DQKLVA                     RPWLPHPKPFETLR FY+RTGA+FL+WAIS+NR
Sbjct: 545 DQKLVAEDEEEEEEEEEEEDEPEIPDLRPWLPHPKPFETLRAFYIRTGAEFLKWAISNNR 604

Query: 583 DARGKHLKKKSFDLCQDRWWERRDQVRIEEDKXXXXXXXXXXXXKDTSKSKKRR 636
           DA+GKHLKK+SFDLCQDRWWERR+Q+RIEEDK            +D +++ KRR
Sbjct: 605 DAKGKHLKKQSFDLCQDRWWERREQIRIEEDKLEELGGVENVVERDPAQTMKRR 658

>TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {ON}
           Anc_6.10 YPL263C
          Length = 638

 Score =  801 bits (2068), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/589 (64%), Positives = 447/589 (75%), Gaps = 7/589 (1%)

Query: 52  LANFKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGEXXXXXXXXXAFYN 111
           L NFK++QE+FE++ + TV +PT+RINS M++NP+HGK EL+LFGGE          FYN
Sbjct: 53  LENFKKQQEQFEKINIETVSKPTKRINSCMISNPIHGKNELILFGGENTSTTT---TFYN 109

Query: 112 DLFTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL 171
           DLFTY+ + DQW+K +SQNSPMPRSS+A+ +HP+G+ L+HGGEFSSPKQNTFYHYSDTWL
Sbjct: 110 DLFTYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWL 169

Query: 172 LDCNTKEWTKIEQKNGPTARSGHRLTVWKNYFILHGGFRDLGTMTTYLSDCWLFDITTYK 231
           LDC TKEW+K+E KNGP+ARSGHR+TVWKN+ ILHGGFRDLGT TTYL D WLFD+T YK
Sbjct: 170 LDCATKEWSKVENKNGPSARSGHRMTVWKNFIILHGGFRDLGTSTTYLKDLWLFDVTKYK 229

Query: 232 WKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKSD 291
           W QV+FPPNH IPDARSGHSL+PT DGA+LWGGYCKVKAGKGLQKGKIL+DCWYLKMKSD
Sbjct: 230 WTQVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKVKAGKGLQKGKILSDCWYLKMKSD 289

Query: 292 IGAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFYNDLFTFQI 351
           +  IRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESL+S+FYNDLFT+QI
Sbjct: 290 VSGIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSLFYNDLFTYQI 349

Query: 352 ETNRWYSASLRPQRKAA-KATSKNNRNKDKELEDILNQILEKANLNDDENEKETI--GDV 408
           E NRW+S S+R QRK   K   K  ++K+KEL+DILN IL+K NL DD++E       ++
Sbjct: 350 EINRWFSLSMRSQRKKTIKIGPKTTKDKEKELQDILNSILKKNNLTDDDSEDPNAIEEEL 409

Query: 409 XXXXXXXXXXXXXXXXXXKKEYPIRIQLPHPRFNASTAVVDDTLFIFGGVWEIGEKDYSI 468
                              K+Y +  QLPH RFNA+TAVV+DTL+IFGG WE+GEKDYSI
Sbjct: 410 KINDDESNSEDESKDGQVTKQYEVMNQLPHVRFNATTAVVNDTLYIFGGSWELGEKDYSI 469

Query: 469 DSFYAIDLNRLDGIKIYWEDLRDIEMAKELGXXXXXXXXXXXXXXXXXXXXXXITDQKLV 528
           DSFY+IDLN+LDG+ +YWED+ +IE AKELG                      I DQKLV
Sbjct: 470 DSFYSIDLNKLDGVTVYWEDMEEIEAAKELGEQFSDEEDEDDEEEDEDDGEEEIVDQKLV 529

Query: 529 AXXXXXXXXXXXXXXXXXX-XXRPWLPHPKPFETLRGFYVRTGADFLEWAISSNRDARGK 587
           A                     RPWLPHPKPFETLR FYVRTGA FLEWAIS+NRD++GK
Sbjct: 530 AEEDEEEEEIEADEDEMEIPDPRPWLPHPKPFETLRAFYVRTGATFLEWAISNNRDSKGK 589

Query: 588 HLKKKSFDLCQDRWWERRDQVRIEEDKXXXXXXXXXXXXKDTSKSKKRR 636
           HLKKKSF+L +DRWWERRDQVRIEEDK            +DT++  KRR
Sbjct: 590 HLKKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVERDTTQVNKRR 638

>KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 640

 Score =  794 bits (2050), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/590 (64%), Positives = 443/590 (75%), Gaps = 5/590 (0%)

Query: 52  LANFKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGEXXXXXXXXXAFYN 111
           LANFKREQE FE++ V  VDRP +RIN  M  NP HGKREL++FGGE          FYN
Sbjct: 51  LANFKREQENFEKINVENVDRPDQRINPCMFVNPAHGKRELMMFGGESTTQETGTTHFYN 110

Query: 112 DLFTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL 171
           DLF YSLD D W++ +SQNSPMPRSSAA+A+HP+GV LIHGGEFSSPKQNTFYHYSD+WL
Sbjct: 111 DLFVYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWL 170

Query: 172 LDCNTKEWTKIEQKNGPTARSGHRLTVWKNYFILHGGFRDLGTMTTYLSDCWLFDITTYK 231
            DC++KEWTK+EQKNGP+ARSGHR+ +WKN+ ILHGGFRDLGT TTYL+D W+FDIT YK
Sbjct: 171 FDCSSKEWTKVEQKNGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDLWVFDITNYK 230

Query: 232 WKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKSD 291
           WKQV+ P NHPIPDARSGHSL+ T +GAVL+GGY KVKAGKGLQKGKIL+DCWYLKMKSD
Sbjct: 231 WKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKMKSD 290

Query: 292 IGAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFYNDLFTFQI 351
           +G+IRWERRKKQG QPSPRVGCSMVHHKGRG+LFGGV+DFEETEESL S+FYN+L+T+QI
Sbjct: 291 LGSIRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFYNELYTYQI 350

Query: 352 ETNRWYSASLRPQRKAAK-ATSKNNRNKDKELEDILNQILEKANLND--DENEKETIGD- 407
           E NRWY+ SLRPQRK      SK+NRNKDKELEDILNQIL+KANL D  D++E + I + 
Sbjct: 351 ENNRWYAMSLRPQRKKKNFVQSKSNRNKDKELEDILNQILDKANLRDAEDDDESKVIEEQ 410

Query: 408 VXXXXXXXXXXXXXXXXXXKKEYPIRIQLPHPRFNASTAVVDDTLFIFGGVWEIGEKDYS 467
           +                   K Y     LPH RFNA+TAVVDDTLFIFGG  EIGEKDY 
Sbjct: 411 LNQLDLIDFDDDDESDKKSAKSYETMSTLPHARFNAATAVVDDTLFIFGGTVEIGEKDYP 470

Query: 468 IDSFYAIDLNRLDGIKIYWEDLRDIEMAKELGXXXXXXXXXXXXXXXXXXXXXXITDQKL 527
           IDSFY+ID+N+LDG+K+YWE+L+++E A++LG                      I D KL
Sbjct: 471 IDSFYSIDMNKLDGVKVYWEELKEVERAEKLGEQDSDDEFGDEDDDDEDDGEEEIVDSKL 530

Query: 528 VAXXXXXXXXXXXXXXXXXX-XXRPWLPHPKPFETLRGFYVRTGADFLEWAISSNRDARG 586
            A                     RPWLPHPK FETLR FYVRTG  FLE AISSNRD++G
Sbjct: 531 EAEDEEEEEEEEEVEEEYEIPDLRPWLPHPKAFETLRAFYVRTGPTFLELAISSNRDSKG 590

Query: 587 KHLKKKSFDLCQDRWWERRDQVRIEEDKXXXXXXXXXXXXKDTSKSKKRR 636
           KHLK KSF+LCQDRWWERR+QVRIEEDK            KDTSK+++RR
Sbjct: 591 KHLKTKSFELCQDRWWERREQVRIEEDKLEELGGVEDVIEKDTSKTQRRR 640

>TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.10
           YPL263C
          Length = 633

 Score =  781 bits (2018), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/586 (63%), Positives = 437/586 (74%), Gaps = 6/586 (1%)

Query: 52  LANFKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGEXXXXXXXXXAFYN 111
           LANFK+EQE+FE+VVV  ++RP+RRIN SM+ANP+HGK EL++FGGE          F+N
Sbjct: 53  LANFKKEQEQFEKVVVENIERPSRRINPSMIANPIHGKSELIMFGGEHTIQSTSTTHFFN 112

Query: 112 DLFTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL 171
           DL  +S D +QW++ISSQNSPMPRSSAA+  HPSGV L+HGGEFSSPKQNTFYHYSDTWL
Sbjct: 113 DLVVFSPDNEQWKRISSQNSPMPRSSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWL 172

Query: 172 LDCNTKEWTKIEQKNGPTARSGHRLTVWKNYFILHGGFRDLGTMTTYLSDCWLFDITTYK 231
           LDC TKEWTKIEQKNGP+ARSGHR+ VWKN+ ILHGGFRDLGT TTYL+DCWLFDITTYK
Sbjct: 173 LDCATKEWTKIEQKNGPSARSGHRMAVWKNFIILHGGFRDLGTSTTYLNDCWLFDITTYK 232

Query: 232 WKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKSD 291
           WKQV+FP NHP+PDARSGHSL+   +GA+LWGGYCKVKAGKGLQKGKILTDCWYLKM S+
Sbjct: 233 WKQVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMSSN 292

Query: 292 IGAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFYNDLFTFQI 351
             AIRW+R+K+QGFQPSPRVGCSMV HKGRG+LFGGV+DFEETEESLES FYND+FT+QI
Sbjct: 293 TSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNFYNDVFTYQI 352

Query: 352 ETNRWYSASLRPQR-KAAKATSKNNRNKDKELEDILNQILEKANLNDDENEKETIGDVXX 410
             NRWYS SLRPQR K  K  +++ ++++KELED+LN+IL  A L+D   + E       
Sbjct: 353 NMNRWYSLSLRPQRKKQVKLNNRSTKDQEKELEDLLNKILRNAQLDD---QGEEEEIDAA 409

Query: 411 XXXXXXXXXXXXXXXXKKEYPIRIQLPHPRFNASTAVVDDTLFIFGGVWEIGEKDYSIDS 470
                            KE+ I  +LPHPRFNA+TAVVDDTLFIFGGVWE GEKDYSIDS
Sbjct: 410 EESTAVEEDSDESESLDKEHVIMNELPHPRFNAATAVVDDTLFIFGGVWEFGEKDYSIDS 469

Query: 471 FYAIDLNRLDGIKIYWEDLRDIEMAKELGXXXXXXXXXXXXXXXXXXXXXXITDQKLVAX 530
           FY IDLN+ DG+ +YWEDL  +E AK+                          DQKLVA 
Sbjct: 470 FYGIDLNKADGVTVYWEDLTALENAKDEDDSDEDEGEEDDDDEEDSEEEQ--VDQKLVAE 527

Query: 531 XXXXXXXXXXXXXXXXXXXRPWLPHPKPFETLRGFYVRTGADFLEWAISSNRDARGKHLK 590
                              RPWLPHPK FE+LR FYVRTGA FLEWAIS+NR  +GKHLK
Sbjct: 528 DEDEEEEEFEEEEMEIPDPRPWLPHPKAFESLRSFYVRTGATFLEWAISNNRHVKGKHLK 587

Query: 591 KKSFDLCQDRWWERRDQVRIEEDKXXXXXXXXXXXXKDTSKSKKRR 636
            KSF++C+ RWWERRDQVR+EEDK            +DT+K+KKRR
Sbjct: 588 TKSFEICESRWWERRDQVRLEEDKLEELGGVGEIIERDTTKTKKRR 633

>KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263C KEL3
           Cytoplasmic protein of unknown function
          Length = 642

 Score =  775 bits (2000), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/590 (63%), Positives = 441/590 (74%), Gaps = 8/590 (1%)

Query: 54  NFKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGEXXXXXXXXXAFYNDL 113
           NF++EQE F+EVVV+ V RP+ R N  MV NP HGKRELL+FGGE          FYN+L
Sbjct: 54  NFRKEQELFQEVVVTPVKRPSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNEL 113

Query: 114 FTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLLD 173
           FTYSLD DQW+KI+S+N+PMPRSSAA A HPSGVVLIHGGEFSSPKQNTFYHYSD+WLLD
Sbjct: 114 FTYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLD 173

Query: 174 CNTKEWTKIEQKNGPTARSGHRLTVWKNYFILHGGFRDLGTMTTYLSDCWLFDITTYKWK 233
           C++KEWTKI+QKNGP+ARSGHR+TVWKN+F++HGGFRDLGT TTYL+DCWLFDITTYKWK
Sbjct: 174 CSSKEWTKIDQKNGPSARSGHRMTVWKNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWK 233

Query: 234 QVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKSDIG 293
           QV+FPPNHP+PDARSGHSL+PT +GA++WGGYCK+KA KGLQKGKILTDCWYL+MKSDI 
Sbjct: 234 QVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYCKIKAKKGLQKGKILTDCWYLRMKSDIT 293

Query: 294 AIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFYNDLFTFQIET 353
            IRWERRKKQGFQPSPRVGCSM HHKGRGILFGGV+D+EETEE L S F+NDL ++Q+E 
Sbjct: 294 GIRWERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSEFFNDLLSYQVEA 353

Query: 354 NRWYSASLRPQRKAAKATSKNNRNKDKELEDILNQILEKANLNDDENEKETIGDVXXXXX 413
           NRWYS  +RPQ+K   A SK+ ++KD EL  ILN IL+KANL D+ENE+    D      
Sbjct: 354 NRWYSIKMRPQKKKIVAASKSAKSKDDELVGILNDILQKANLADEENEENES-DSEIEKE 412

Query: 414 XXXXXXXXXXXXXKKEYPIRIQLPHPRFNASTAVVDDTLFIFGGVWEIGEKDYSIDSFYA 473
                        +K+YP+  QLPH RFNA+T VVDDTLFIFGG WE GE+D+SIDSFY+
Sbjct: 413 LHRLDEEELLGHQQKQYPVVAQLPHSRFNAATTVVDDTLFIFGGSWEYGERDFSIDSFYS 472

Query: 474 IDLNRLDGIKIYWEDLRDIEMAKELGXXXXXXXXXXXXXXXXXXXXXXITDQKLVAXXXX 533
           IDLNR DG++++WEDL +IE AK+ G                      + ++ +      
Sbjct: 473 IDLNRTDGVRVFWEDLEEIEKAKDQGLEEDEEEEEEEDDDDEDDEEETLDEELIAEMEDD 532

Query: 534 XXXXXXXXXXXXXXXX-------RPWLPHPKPFETLRGFYVRTGADFLEWAISSNRDARG 586
                                  RPWLPHPK FETLR FY+RTGA+FL+WAIS+NR A+G
Sbjct: 533 KQEEEEQEEEEEEEEAGPEIPDPRPWLPHPKAFETLRAFYIRTGAEFLQWAISNNRSAKG 592

Query: 587 KHLKKKSFDLCQDRWWERRDQVRIEEDKXXXXXXXXXXXXKDTSKSKKRR 636
           KHLKK+SFDL QDRWWERR+QVRIEEDK            +D+S S KRR
Sbjct: 593 KHLKKQSFDLSQDRWWERREQVRIEEDKLEEMGGVENIIERDSSHSTKRR 642

>ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 643

 Score =  765 bits (1976), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/590 (63%), Positives = 445/590 (75%), Gaps = 5/590 (0%)

Query: 52  LANFKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGEXXXXXXXXXAFYN 111
           LA+FK+EQE+FE+VVV +VD+P+ RIN  +V+NP HGK+EL+LFGGE          FYN
Sbjct: 54  LASFKKEQEQFEKVVVESVDKPSARINPCLVSNPAHGKKELILFGGEYTNQSNSTTHFYN 113

Query: 112 DLFTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL 171
           +LFT++ D DQWRKISSQN+PMPRSSAA+AAHPSG+ L+HGGEFSSPKQNTFYHYSDTWL
Sbjct: 114 ELFTFTPDNDQWRKISSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTWL 173

Query: 172 LDCNTKEWTKIEQKNGPTARSGHRLTVWKNYFILHGGFRDLGTMTTYLSDCWLFDITTYK 231
           LDC TKEWTK++QKNGP +RSGHR+TVWKN+FI++GGFRDLGT TTYL+DCWLFDITT+K
Sbjct: 174 LDCTTKEWTKLDQKNGPASRSGHRMTVWKNFFIMYGGFRDLGTSTTYLNDCWLFDITTHK 233

Query: 232 WKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKSD 291
           W QV+FP NH IPDARSGHS +P  +GA+LWGGYCKVKAGKGLQKGKILTDCWYLKM S 
Sbjct: 234 WTQVEFPRNHLIPDARSGHSFIPDQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMNST 293

Query: 292 IGAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFYNDLFTFQI 351
             AIRWERRKKQGFQPSPRVGCSMV HKGRG+LFGGV+DFEETEESL+S FYNDLFTFQI
Sbjct: 294 PSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQI 353

Query: 352 ETNRWYSASLRPQRKAAKATSKNN-RNKDKELEDILNQILEKANLNDDENEKETIGDVXX 410
           +TNRWYS SLRPQRK     SK++ ++++KEL+D LN+IL++A L D + +KE    +  
Sbjct: 354 KTNRWYSLSLRPQRKKQVKISKSSTKDQEKELQDHLNRILQQAQLYDQDEDKEDDKAIRE 413

Query: 411 X-XXXXXXXXXXXXXXXKKEYPIRIQLPHPRFNASTAVVDDTLFIFGGVWEIGEKDYSID 469
                            KK++ I  QLPHPRFN S AVV+DTLFI+GG+WE+G+KDY+ID
Sbjct: 414 QFEDENQSGDEDEEESTKKQHTISTQLPHPRFNTSLAVVNDTLFIYGGLWELGDKDYNID 473

Query: 470 SFYAIDLNRLDGIKIYWEDLRDIEMAKELGXXXX--XXXXXXXXXXXXXXXXXXITDQKL 527
           SFY IDLN++DG+ +YWE+L +IE AK+L                         + DQ L
Sbjct: 474 SFYGIDLNKVDGVTVYWENLAEIEKAKKLAEQGSDEDEDDEDEEDEDEDDDEEEVRDQVL 533

Query: 528 VAXXXXXXXXXXXXXXXXXX-XXRPWLPHPKPFETLRGFYVRTGADFLEWAISSNRDARG 586
           VA                     RPWLPHPK FE+LR FYVR G  FLEWAIS+NRDARG
Sbjct: 534 VAEEEDAEEDEEVEEEEMEIPDPRPWLPHPKAFESLRAFYVRAGPQFLEWAISNNRDARG 593

Query: 587 KHLKKKSFDLCQDRWWERRDQVRIEEDKXXXXXXXXXXXXKDTSKSKKRR 636
           KHLK+KSFDLCQDRWWERRDQVRIEEDK            ++ ++  KRR
Sbjct: 594 KHLKQKSFDLCQDRWWERRDQVRIEEDKMEELGGVGDIVERNPAQKTKRR 643

>NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {ON}
           Anc_6.10
          Length = 645

 Score =  748 bits (1931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/593 (60%), Positives = 431/593 (72%), Gaps = 9/593 (1%)

Query: 52  LANFKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGEXXXXXXXXXAFYN 111
           LANFK +QE+FE V V ++ +P +R+NS M+  P H K+ELL+FGGE          FYN
Sbjct: 53  LANFKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHFYN 112

Query: 112 DLFTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL 171
           +L TYS D  QWRKI+SQNSPMPRSSAA+ AHPSG+ L+HGGEFSSPKQNTFYHYSDTWL
Sbjct: 113 ELITYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWL 172

Query: 172 LDCNTKEWTKIEQKNGPTARSGHRLTVWKNYFILHGGFRDLGTMTTYLSDCWLFDITTYK 231
           LD +TKEWTK++   GP  RSGHR+T+WKNYFIL GGF+DLG  T+Y +DCW FDITTYK
Sbjct: 173 LDTHTKEWTKMDSAKGPPGRSGHRITIWKNYFILSGGFKDLGHSTSYFNDCWCFDITTYK 232

Query: 232 WKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKSD 291
           WKQ++FPPNHPIPDARSGHS +PT +G +LWGGYCKVKAGKGLQKGKIL DCWYLKMKSD
Sbjct: 233 WKQIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLKMKSD 292

Query: 292 IGAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFYNDLFTFQI 351
           +  +RWERRKKQGFQPSPRVGCSM +HKGRGILFGGV+DFEETEESLES+FYNDLF++ +
Sbjct: 293 LSQVRWERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDLFSYNV 352

Query: 352 ETNRWYSASLRPQRK----AAKATSKNNRNKDKELEDILNQILEKANLNDDENEKETIGD 407
           E+NRW+S SLR  +K    A  + +K+++ K+KEL+D+LNQILEK NL DD+++ E    
Sbjct: 353 ESNRWFSLSLRKAQKFKKVAKSSNNKSSKEKEKELQDLLNQILEKNNLKDDDDDDEISTG 412

Query: 408 VXXXXXXXXXXXXXXXXXXKKEYPIRI--QLPHPRFNASTAVVDDTLFIFGGVWEIGEKD 465
                               K   + +  QLPHPRFNA+T VVDD+LFI+GG+WE+GEKD
Sbjct: 413 TETETETAANSDDEDNKEHSKSAQVTVMSQLPHPRFNAATTVVDDSLFIYGGIWEMGEKD 472

Query: 466 YSIDSFYAIDLNRLDGIKIYWEDLRDIEMAKELGXXXXXXXXXXXXXXXXXXXXXXITDQ 525
           Y+IDS Y+IDLN+LDG+  YWEDL++IE AKE+G                        D+
Sbjct: 473 YAIDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIGEQDSDEDEEEEDDEEDDDEEEI-EDK 531

Query: 526 KLVAXXXXXXXXXXXXXXXXXXX--XRPWLPHPKPFETLRGFYVRTGADFLEWAISSNRD 583
           KLVA                      RPWLPHPKPFE+LR FY+R GA FLEWAIS+N+ 
Sbjct: 532 KLVAEEDDEEEEEEEEEFEEMEIPDLRPWLPHPKPFESLRAFYIREGAAFLEWAISNNKH 591

Query: 584 ARGKHLKKKSFDLCQDRWWERRDQVRIEEDKXXXXXXXXXXXXKDTSKSKKRR 636
            RGKHLKKKSFDLC+DRWWERRDQVRIEEDK            KDTS    +R
Sbjct: 592 VRGKHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEKDTSVPTSKR 644

>CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263c KEL3
          Length = 641

 Score =  739 bits (1909), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/593 (59%), Positives = 434/593 (73%), Gaps = 9/593 (1%)

Query: 52  LANFKREQEKFEEVVVSTVDRPTRRINSSMVANPL--HGKRELLLFGGEXXXXXXXXXAF 109
           LANFK+EQE+FE+V V +VD+  +R+N  MV NP     K+EL++FGGE          F
Sbjct: 50  LANFKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTTF 109

Query: 110 YNDLFTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDT 169
           YNDL T++ + +QW++ +SQN+PMPRSSAA+AAHPSG+ L+HGGEFSSPKQNTFYHYSDT
Sbjct: 110 YNDLHTFTPENNQWKRYTSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDT 169

Query: 170 WLLDCNTKEWTKIEQKNGPTARSGHRLTVWKNYFILHGGFRDLGTMTTYLSDCWLFDITT 229
           W+LDCNTKEW K++ K GP+ARSGHR+TVWKN+FILHGGFRDLGT TTYLSDCWLFDITT
Sbjct: 170 WILDCNTKEWAKVDAKVGPSARSGHRITVWKNFFILHGGFRDLGTSTTYLSDCWLFDITT 229

Query: 230 YKWKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAG-KGLQKGKILTDCWYLKM 288
           YKWKQV+FP NH +PDARSGHS +PT +GA+LWGGYCKVKA  KG QKGKIL+DCWYLKM
Sbjct: 230 YKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGKILSDCWYLKM 289

Query: 289 KSDIGAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFYNDLFT 348
           KSDI  IRWERR+KQGFQPSPRVGCSM +HKGRGILFGGV+DFEETEESLES F+NDLF+
Sbjct: 290 KSDISGIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESNFFNDLFS 349

Query: 349 FQIETNRWYSASLRPQRK----AAKATSKNNRNKDKELEDILNQILEKANLNDDENEKET 404
           + IE+NRWYS S+R ++      AK + KN++ ++KEL+ +L+ ILEKANL D  ++ E 
Sbjct: 350 YHIESNRWYSLSIRSRKSNNNAVAKKSGKNSKEQEKELKMLLDSILEKANLQDKSDDDED 409

Query: 405 IGDVXXXXXXXXXXXXXXXXXXKKEYPIRIQLPHPRFNASTAVVDDTLFIFGGVWEIGEK 464
             ++                    ++ I  QLPHPRFNA+T V+DDTLFIFGG+WE+G+K
Sbjct: 410 DEEINTALAKVDLEDEEEEQLA-VQHTILTQLPHPRFNATTTVIDDTLFIFGGIWELGDK 468

Query: 465 DYSIDSFYAIDLNRLDGIKIYWEDLRDIEMAKELGXXXXXXXXXXXXXXXXXXXXXXITD 524
           ++ IDS Y+IDLN+LDG+ +YWEDL++IE AKELG                        +
Sbjct: 469 EFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELGVEDSDFEDDDEDDDDEDDDEEDDNE 528

Query: 525 QKLVAXXXXXXXXXXXXXXXXXX-XXRPWLPHPKPFETLRGFYVRTGADFLEWAISSNRD 583
           +                         RPWLPHPKPFETLR FY+R GA FLEWAIS+N++
Sbjct: 529 KDEGDDEESEEEEEEEIEEELEYPDPRPWLPHPKPFETLRAFYIREGAAFLEWAISNNKN 588

Query: 584 ARGKHLKKKSFDLCQDRWWERRDQVRIEEDKXXXXXXXXXXXXKDTSKSKKRR 636
           A+GKHLKK SFDLCQ+RWWERRDQ+RIEEDK            +D S S KRR
Sbjct: 589 AKGKHLKKHSFDLCQERWWERRDQLRIEEDKLEEIGGVGDIIERDKSASSKRR 641

>KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6.10
           YPL263C
          Length = 636

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/606 (56%), Positives = 425/606 (70%), Gaps = 43/606 (7%)

Query: 52  LANFKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGEXXXXXXXXXAFYN 111
           L NFK+EQE +E++ + +V++P+ R N S++++    K+ELLLFGGE          FYN
Sbjct: 52  LENFKKEQENYEKINIESVEKPSIRNNGSIISSTT--KKELLLFGGEHTSKELQTTKFYN 109

Query: 112 DLFTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL 171
           DL+T+S D +QW++I+SQNSPMPRSSAA+AAHPSG+ L++GGEFSSPKQ+TFYHYSDTW+
Sbjct: 110 DLYTFSPDNNQWKRITSQNSPMPRSSAAMAAHPSGIALLNGGEFSSPKQSTFYHYSDTWI 169

Query: 172 LDCNTKEWTKIEQKNGPTARSGHRLTVWKNYFILHGGFRDLGTMTTYLSDCWLFDITTYK 231
           LD  TKEWTKIE K  P  RSGHR+T WKNYFIL GGF+DLG  TTY +D WLFDITTYK
Sbjct: 170 LDLTTKEWTKIEGKVKPVGRSGHRITTWKNYFILFGGFKDLGHSTTYYNDVWLFDITTYK 229

Query: 232 WKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKSD 291
           WKQV+FP NH +PDARSGHSL+PT +G +++GGYCK+KA KGLQKGK+L+ CW LKMK+D
Sbjct: 230 WKQVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCKIKAKKGLQKGKLLSGCWNLKMKAD 289

Query: 292 IGAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFYNDLFTFQI 351
           + AIRWERR+KQGFQPSPRVGCSM +HKGRGILFGGV+DF+ETEESLES+FYNDLFT+ I
Sbjct: 290 VEAIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESIFYNDLFTYNI 349

Query: 352 ETNRWYSASLRPQRKAAKATS----KNNRNKDKELEDILNQILEKANL------------ 395
           E+NRW++ +L+ +  A K  S    K+++ K++EL+D+LNQILEK NL            
Sbjct: 350 ESNRWFNVTLKKRSNATKTISSTKNKSSKEKERELQDLLNQILEKNNLKPDDEEEEESSD 409

Query: 396 ---NDDENEKETIGDVXXXXXXXXXXXXXXXXXXKKEYPIRIQLPHPRFNASTAVVDDTL 452
              +DDE+++E                       K +     QLPHPRFNA+T V+DD L
Sbjct: 410 IFGSDDEDDEE--------------------QKNKIDIKTVTQLPHPRFNATTTVIDDML 449

Query: 453 FIFGGVWEIGEKDYSIDSFYAIDLNRLDGIKIYWEDLRDIEMAKELGXXXXXXXXXXXXX 512
           +I+GG WE GE DYSIDSFY+IDLN+LDG+ +YWEDL +IE AKELG             
Sbjct: 450 YIYGGAWEFGEIDYSIDSFYSIDLNKLDGVNVYWEDLNEIETAKELGEQGSEDEDEDDFE 509

Query: 513 XXXXXXXXXITDQKLVAXXXXXXXXXXXXXXXXXXX--XRPWLPHPKPFETLRGFYVRTG 570
                    + D KL+A                      RPWLPHPK FE+LR FY+R G
Sbjct: 510 EDEEDGEEEVEDTKLIAEDVEDEKEEEEEEYPEMEIPDPRPWLPHPKAFESLRAFYLREG 569

Query: 571 ADFLEWAISSNRDARGKHLKKKSFDLCQDRWWERRDQVRIEEDKXXXXXXXXXXXXKDTS 630
             FLEWAIS+NR  RGK LK+KSF+LCQDRWWERRDQ+ IEEDK            +DTS
Sbjct: 570 PAFLEWAISNNRHTRGKLLKQKSFELCQDRWWERRDQISIEEDKLEEIGVVGDVVERDTS 629

Query: 631 KSKKRR 636
           K+  +R
Sbjct: 630 KAVSKR 635

>NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {ON}
           Anc_6.10 YPL263C
          Length = 663

 Score =  675 bits (1741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/609 (55%), Positives = 412/609 (67%), Gaps = 24/609 (3%)

Query: 52  LANFKREQEKFEEVVVSTV-----DRPTRRINSSMV-ANPLHGKR--ELLLFGGEXXXXX 103
           LANFK EQEKFE++ V  +     +  + R NSSM+ A   H K+  ELL+FGGE     
Sbjct: 54  LANFKMEQEKFEKINVELLPQGQHNHISPRSNSSMITAASAHNKKGKELLMFGGEYTSPE 113

Query: 104 XXXXAFYNDLFTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTF 163
                FYNDL +Y+ D  QWRKI+SQNSPMPRSSAA+  HPSG+ ++HGGEFSSPKQNTF
Sbjct: 114 TGMTHFYNDLLSYTPDTQQWRKITSQNSPMPRSSAAMCYHPSGIAILHGGEFSSPKQNTF 173

Query: 164 YHYSDTWLLDCNTKEWTKIEQKNGPTARSGHRLTVWKNYFILHGGFRDLG-TMTTYLSDC 222
           YHYSDTW+LD +TKEWTK++ K  P ARSGHR+  WKNYF+L GGF+D+G   T Y +D 
Sbjct: 174 YHYSDTWILDTSTKEWTKVDIKKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDV 233

Query: 223 WLFDITTYKWKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKVKA--GKGLQKGKIL 280
           W FDI  YKW QV+FP NHP+PD RSGHS +P  +G +LWGGY KVK+    G QKGKIL
Sbjct: 234 WCFDILNYKWTQVEFPKNHPLPDPRSGHSWIPVEEGCILWGGYTKVKSKLKSGQQKGKIL 293

Query: 281 TDCWYLKMKSDIGAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLES 340
            DCWYLKMKSD+ +IRWERRKK GFQPSPRVGCSM +HKGRGILFGGV+DF+ETEESLES
Sbjct: 294 NDCWYLKMKSDLSSIRWERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLES 353

Query: 341 MFYNDLFTFQIETNRWYSASLRPQRKAAK----ATSKNNRNKDKELEDILNQILEKANLN 396
           +FYNDLF++ +ETNRW++ +LR  +K  K    + +KN++ K+KEL+D+LNQILEK NL 
Sbjct: 354 LFYNDLFSYNVETNRWFALNLRKNQKGNKSLKRSNNKNSKEKEKELQDLLNQILEKNNLK 413

Query: 397 ------DDENEKETIGDVXXXXXXXXXXXXXXXXXXKKE-YPIRIQLPHPRFNASTAVVD 449
                 D+E  +   G                    + E   I  QLPHPR+N +  VVD
Sbjct: 414 DEDDEDDEEVNENEDGSTTASTAATSDDEDTERTTQEAEGVTIMNQLPHPRYNVAMTVVD 473

Query: 450 DTLFIFGGVWEIGEKDYSIDSFYAIDLNRLDGIKIYWEDLRDIEMAKELGXXXX--XXXX 507
           D LFI+GG WE+GEKDY I+SFY+IDLNR+DG+  YWEDL++IE AKELG          
Sbjct: 474 DLLFIYGGSWELGEKDYFINSFYSIDLNRIDGVTCYWEDLKEIEKAKELGEQDSDEEDDE 533

Query: 508 XXXXXXXXXXXXXXITDQKLVAXXXXXXXXXXXXXXXXXXXXRPWLPHPKPFETLRGFYV 567
                         I DQKLVA                    RPWLPHPKPFE+LR FY+
Sbjct: 534 DDEEDDDEDDDEEEIKDQKLVADDEDEEEEEEDVQEMEIPDLRPWLPHPKPFESLRAFYI 593

Query: 568 RTGADFLEWAISSNRDARGKHLKKKSFDLCQDRWWERRDQVRIEEDKXXXXXXXXXXXXK 627
           R G  FLEWAIS+N+  RGKHLKKKSF+LC+DRWWERRDQ+RIEEDK            K
Sbjct: 594 REGPAFLEWAISNNKHVRGKHLKKKSFELCEDRWWERRDQIRIEEDKLEELGVVGDVIEK 653

Query: 628 DTSKSKKRR 636
           DTSK   +R
Sbjct: 654 DTSKGASKR 662

>KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {ON}
           Anc_6.10 YPL263C
          Length = 650

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/576 (51%), Positives = 379/576 (65%), Gaps = 16/576 (2%)

Query: 52  LANFKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGEXXXXXXXXXAFYN 111
           L NFK EQE+FE+VVV  V  PT R N+ +V N    K ELLLFGGE          FYN
Sbjct: 54  LQNFKLEQEQFEKVVVELVPHPTPRNNACLVTNA--SKPELLLFGGERTNNETNMTKFYN 111

Query: 112 DLFTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL 171
           DL  Y+   +QW+K +SQNSPMPRSSAA+ +H SGV ++ GGEFSSPKQNTFYHY+DTWL
Sbjct: 112 DLHVYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWL 171

Query: 172 LDCNTKEWTKIEQKNGPTARSGHRLTVWKNYFILHGGFRDLGTMTTYLSDCWLFDITTYK 231
           LD  T+EW+K++ KNGP+ARSGHR+T WKNYFIL GGF+DL   T+Y +D WLF++  +K
Sbjct: 172 LDNTTREWSKLDFKNGPSARSGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFK 231

Query: 232 WKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKVKA--GKGLQKGKILTDCWYLKMK 289
           W + +   N   PD RSGHS + + +G +++GGYCKVKA   K L KGK LTDCW LKM 
Sbjct: 232 WTKWE-TTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMS 290

Query: 290 SDIGAIRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVFDFEETEESLESMFYNDLFT 348
            ++  I+WERR K+G QPSPRVGCSM +H   RGILFGGV+D EETEE L S++YNDL++
Sbjct: 291 QNVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYS 350

Query: 349 FQIETNRWYSASLRPQRKAAKAT---SKNN---RNKDKELEDILNQILEKANLNDDENEK 402
           + IE+NRWY   LR   + + A    S NN   + ++KEL+D+LN+ILE+ +L D+E   
Sbjct: 351 YNIESNRWYPLKLRKVTQNSNANRNKSSNNTVSKEQEKELQDLLNKILEQNDLKDEETNS 410

Query: 403 ETIGDVXXXXXXXXXXXXXXXXXXK--KEYPIRIQLPHPRFNASTAVVDDTLFIFGGVWE 460
            +  +                   K     P   QLPH RFNA T V++DT +I+GG+WE
Sbjct: 411 YSGSNTPHEETTTDREQDDNEEEEKMRTNLPKLNQLPHERFNACTTVLNDTFYIYGGMWE 470

Query: 461 IGEKDYSIDSFYAIDLNRLDGIKIYWEDLRDIEMAKELGXXXXXXXXXXXXXXXXXXXXX 520
             + DY+IDSFY+IDLN+LDGI  Y+E+L++IE  K LG                     
Sbjct: 471 FKDNDYTIDSFYSIDLNKLDGITQYYENLQEIEEVKRLGDVQSEDDFEYEDDDDEDDGEA 530

Query: 521 XITDQKLVAXXXXXXXXXXXXXXXXXX--XXRPWLPHPKPFETLRGFYVRTGADFLEWAI 578
             T+++L A                      RPWLPHPK FE+LR FY+R G  FLEWAI
Sbjct: 531 EPTNERLEAEDDDEEENEEDEGIDEMEIPDPRPWLPHPKAFESLREFYIREGPKFLEWAI 590

Query: 579 SSNRDARGKHLKKKSFDLCQDRWWERRDQVRIEEDK 614
           S+N+ A+GKHLK+KSF+LCQDRWWERRDQ++IEEDK
Sbjct: 591 SNNKHAKGKHLKQKSFELCQDRWWERRDQIQIEEDK 626

>Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}
           YPL263C (REAL)
          Length = 652

 Score =  551 bits (1419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/581 (48%), Positives = 373/581 (64%), Gaps = 21/581 (3%)

Query: 52  LANFKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGEXXXXXXXXXAFYN 111
           L++F ++Q + E V ++ V+R + R +  M ANP H KREL +FGGE          FYN
Sbjct: 55  LSSFTKKQTELEHVDITAVERLSCRTHPLMFANPQHNKRELFIFGGEFTDPETKLTHFYN 114

Query: 112 DLFTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL 171
           DL++YS+  + W+K  S+N+P+PRSSAA+A HPSG+ L+HGGEFSSPKQ+ FYHYSDTWL
Sbjct: 115 DLYSYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWL 174

Query: 172 LDCNTKEWTKIE---QKNGPTARSGHRLTVWKNYFILHGGFRDLGT-MTTYLSDCWLFDI 227
            DC  +++TK+E   + + P+ARSGHR+  WKNYFIL GGFRDLG   T+YL+D W FDI
Sbjct: 175 FDCAERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDI 234

Query: 228 TTYKWKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKV--KAGKGLQKGKILTDCWY 285
           + YKW +++    +  P+ARSGH  +PT + A+L GGYCK+  K  K L KGKIL D W 
Sbjct: 235 SNYKWTKLE---TNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWK 291

Query: 286 LKMKSDIGAIRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVFDFEETEESLESMFYN 344
           L +  D    +WE+ K    QPSPRVG S  +  + + + FGGV+D +ETEESLES+FYN
Sbjct: 292 LNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYN 351

Query: 345 DLFTFQIETNRWYSASLRPQR----KAAKATSKNNRNKD--KELEDILNQILEKANLNDD 398
           DL+ F +E N+W    ++PQR    K A  TSK   NKD  KEL+D+LN IL K+NLNDD
Sbjct: 352 DLYMFHLELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQDLLNSILAKSNLNDD 411

Query: 399 ENEKETIGDVXXXXXXXXXXXXXXXXXXKKEYPIRIQLPHPRFNASTAVVDDTLFIFGGV 458
           +++  T                       +   I  QLPHPRFNA+T VVDD+LFI+ GV
Sbjct: 412 DDDDNTTTGSNSIDGDDEGEDDDSDLDNPENITISNQLPHPRFNAATCVVDDSLFIYSGV 471

Query: 459 WEIGEKDYSIDSFYAIDLNRLDGIKIYWEDLRDIEMAKELGXXXXXXXXXXXXXXXXXXX 518
           WE+GEKDY I+SFY+IDLN+LDG+ +YWEDL  IE AK LG                   
Sbjct: 472 WELGEKDYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLGDRDSDEDDFEYEDDDDDDG 531

Query: 519 XXXITDQKLVAXXXXXXXXXXXXXXXXXXXX-----RPWLPHPKPFETLRGFYVRTGADF 573
                +++ VA                         R WLPHPKPFETLR FY+R GA+F
Sbjct: 532 EDNDEEEQDVALLEGDEDEEGENEDNGQAQMEIPDERSWLPHPKPFETLRAFYLREGANF 591

Query: 574 LEWAISSNRDARGKHLKKKSFDLCQDRWWERRDQVRIEEDK 614
           L W+IS+N+D +GKHLK KSF++C+DRWWERRDQV +EE++
Sbjct: 592 LTWSISNNKDLKGKHLKTKSFEICEDRWWERRDQVTLEEER 632

>YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}
           KEL3Cytoplasmic protein of unknown function
          Length = 651

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/580 (48%), Positives = 371/580 (63%), Gaps = 20/580 (3%)

Query: 52  LANFKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGEXXXXXXXXXAFYN 111
           L++F ++Q + E V +++V++P+ R +  M ANP H K EL +FGGE          FYN
Sbjct: 55  LSSFSKKQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYN 114

Query: 112 DLFTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL 171
           DL++YS+  + W+K  SQN+P+PRSSAA+A HPSG+ L+HGGEFSSPKQ+ FYHYSDTWL
Sbjct: 115 DLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWL 174

Query: 172 LDCNTKEWTKIE---QKNGPTARSGHRLTVWKNYFILHGGFRDLGT-MTTYLSDCWLFDI 227
            DC  +++TK+E   + + P+ARSGHR+  WKNYFIL GGFRDLG   T+YL+D W FDI
Sbjct: 175 FDCVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDI 234

Query: 228 TTYKWKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKV--KAGKGLQKGKILTDCWY 285
           +TYKW +++    +  PDARSGH  +PT + A+L GGYCK+  K  K L KGKIL D W 
Sbjct: 235 STYKWTKLE---TNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWK 291

Query: 286 LKMKSDIGAIRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVFDFEETEESLESMFYN 344
           L +  D    +WE+ K    QPSPRVG S  +  + + + FGGV+D +ETEESLES+FYN
Sbjct: 292 LNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYN 351

Query: 345 DLFTFQIETNRWYSASLRPQR----KAAKATSKNNRNKD--KELEDILNQILEKANLNDD 398
           DL+ F +E N+W    ++PQR    K + ATSK   NKD  KEL+D+LN IL K+NLNDD
Sbjct: 352 DLYMFHLELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQDLLNSILAKSNLNDD 411

Query: 399 ENEKETIGDVXXXXXXXXXXXXXXXXXXKKE-YPIRIQLPHPRFNASTAVVDDTLFIFGG 457
           +++ +                        +E   I  QLPHPRFNA+T VV D+LFI+ G
Sbjct: 412 DDDNDDNSTTGPNSIDDDEDNEDDSDLDNQEDITISNQLPHPRFNAATCVVGDSLFIYSG 471

Query: 458 VWEIGEKDYSIDSFYAIDLNRLDGIKIYWEDLRDIEMAKELGXXXXXXXXXXXXXXXXXX 517
           VWE+GEKDY I+SFY+IDLN+LDG+K+YWEDL  IE AK LG                  
Sbjct: 472 VWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLGDRDSDEDEFEYEDDEEDE 531

Query: 518 XXXXITDQK---LVAXXXXXXXXXXXXXXXXXXXXRPWLPHPKPFETLRGFYVRTGADFL 574
                                              R WLPHPKPFETLR FY+R GA+FL
Sbjct: 532 DDGEEEQDAGPLEGDEDEESESDDDKQAQMEIPDERSWLPHPKPFETLRAFYLREGANFL 591

Query: 575 EWAISSNRDARGKHLKKKSFDLCQDRWWERRDQVRIEEDK 614
            W+IS+NR+ +GK LK KSF+LC+DRWWERRDQV +EE++
Sbjct: 592 TWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEER 631

>Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}
           YPL263C (REAL)
          Length = 654

 Score =  547 bits (1409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/585 (48%), Positives = 371/585 (63%), Gaps = 27/585 (4%)

Query: 52  LANFKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGEXXXXXXXXXAFYN 111
           L++F ++Q + E V ++ V+RP+ R++  M ANP H K EL +FGGE          FYN
Sbjct: 55  LSSFTKKQTELEHVDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYN 114

Query: 112 DLFTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL 171
           DL++YS+  + W+K  SQN+P+PRSS A+A H SG+ L+HGGEFSSPKQ+ FYHYSDTWL
Sbjct: 115 DLYSYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWL 174

Query: 172 LDCNTKEWTKIE---QKNGPTARSGHRLTVWKNYFILHGGFRDLGT-MTTYLSDCWLFDI 227
            DC+ K++TK+E   + + P+ARSGHR+  WKNYFIL GGFRDLG+  T+YL+D W FDI
Sbjct: 175 FDCHEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDI 234

Query: 228 TTYKWKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCK--VKAGKGLQKGKILTDCWY 285
           + YKW +++    +  PDARSGH  VPT + A+L GGYCK   K  K L KGKIL D W 
Sbjct: 235 SNYKWTKLE---TNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWK 291

Query: 286 LKMKSDIGAIRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVFDFEETEESLESMFYN 344
           L +  D    +WE+ K    QPSPRVG S  +  + + + FGGV+D +ETEESL+S+FYN
Sbjct: 292 LTLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYN 351

Query: 345 DLFTFQIETNRWYSASLRPQR----KAAKATSKNNRNKD--KELEDILNQILEKANL--- 395
           DL+ F +E N+W    ++PQR    + A ATSK   NKD  KEL+D+LN IL K+NL   
Sbjct: 352 DLYMFHLELNKWSKLRIKPQRHTNNRNAPATSKRKSNKDQEKELQDLLNSILAKSNLNDE 411

Query: 396 --NDDENEKETIGDVXXXXXXXXXXXXXXXXXXKKEYPIRIQLPHPRFNASTAVVDDTLF 453
             ++D++   T G                    ++   I  QLPHPRFNA+T VVDD+LF
Sbjct: 412 EDDNDDSTATTTG--ANSSNDEGDDEDDSDFENQENITISNQLPHPRFNAATCVVDDSLF 469

Query: 454 IFGGVWEIGEKDYSIDSFYAIDLNRLDGIKIYWEDLRDIEMAKELG----XXXXXXXXXX 509
           I+ GVWE+GEKDY I+SFY+IDLN+LDG+K+YWEDL  +E AK LG              
Sbjct: 470 IYSGVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSTVEEAKRLGDRDSDEEEFEYEDE 529

Query: 510 XXXXXXXXXXXXITDQKLVAXXXXXXXXXXXXXXXXXXXXRPWLPHPKPFETLRGFYVRT 569
                        T                          R WLPHPKPFETLR FY+R 
Sbjct: 530 DDDEDDDEEEPQDTRLLEDDDDEESEEEDDGQAQMEIPDERSWLPHPKPFETLRAFYLRE 589

Query: 570 GADFLEWAISSNRDARGKHLKKKSFDLCQDRWWERRDQVRIEEDK 614
           GA+FL W+IS+NR+ +GK LK KSF+LC+DRWWERRDQV +EE++
Sbjct: 590 GANFLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEER 634

>Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C
           (REAL)
          Length = 651

 Score =  537 bits (1384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/580 (48%), Positives = 367/580 (63%), Gaps = 20/580 (3%)

Query: 52  LANFKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGEXXXXXXXXXAFYN 111
           L++F ++Q + E V ++ V+RP+ R +  M ANP H K EL +FGGE          FYN
Sbjct: 55  LSSFTKKQTELEHVDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFYN 114

Query: 112 DLFTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL 171
           DL++YS+  + W+K  SQN+P+PRSSAA+A HPSG+ L+HGGEFSSPKQ+ FYHYSDTWL
Sbjct: 115 DLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWL 174

Query: 172 LDCNTKEWTKIE---QKNGPTARSGHRLTVWKNYFILHGGFRDLGT-MTTYLSDCWLFDI 227
            DC  +++ K+E   + + P+ARSGHR+  WKNYFIL GGFRDLG   T+YL+D W FDI
Sbjct: 175 FDCVERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDI 234

Query: 228 TTYKWKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCK--VKAGKGLQKGKILTDCWY 285
           + YKW +++    +  PDARSGH  +PT + A+L GGYCK   K  K L KGKIL D W 
Sbjct: 235 SNYKWSKIE---TNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWK 291

Query: 286 LKMKSDIGAIRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVFDFEETEESLESMFYN 344
           L +  D    +WE+ K    QPSPRVG S  +  + + + FGGV+D +ETEESLES+FYN
Sbjct: 292 LNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYN 351

Query: 345 DLFTFQIETNRWYSASLRPQRKAAK----ATSKNNRNKD--KELEDILNQILEKANLNDD 398
           DL+ F +E N+W    ++ QR+ +     ATSK   NKD  KEL+D+LN IL K+NLNDD
Sbjct: 352 DLYMFHLELNKWSKLRIKSQRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAKSNLNDD 411

Query: 399 ENEKETIGDVXXXXXXXXXXXXXXXXXXKKE-YPIRIQLPHPRFNASTAVVDDTLFIFGG 457
           ++E +                        +E   I  QLPHPRFNA+T VV D+LFI+ G
Sbjct: 412 DDENDDYTATGSNSIDGDEDEEDDSDLDNQEDITISNQLPHPRFNAATCVVGDSLFIYSG 471

Query: 458 VWEIGEKDYSIDSFYAIDLNRLDGIKIYWEDLRDIEMAKELGXXXXXXXXXXXXXXXXXX 517
           VWE+GEKDY I+SFY+IDLN+LDG+K+YWE+L  IE AK LG                  
Sbjct: 472 VWELGEKDYPINSFYSIDLNKLDGVKVYWEELSAIEEAKRLGDRDSDEEEFEYEDEEDDE 531

Query: 518 XXXXITDQKLVAXXXXXXXXXXXXXXXXXXX---XRPWLPHPKPFETLRGFYVRTGADFL 574
                     +                        R WLPHPKPFETLR FY+R GA+FL
Sbjct: 532 DQSEEEQDAGLLESDEDEESDDEDDGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFL 591

Query: 575 EWAISSNRDARGKHLKKKSFDLCQDRWWERRDQVRIEEDK 614
            W+IS+NR+ +GK LK KSF+LC+DRWWERRDQV +EE++
Sbjct: 592 TWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEER 631

>Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]
           {ON} complement(150301..153555) [3255 nt, 1085 aa]
          Length = 1084

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 74/253 (29%), Positives = 106/253 (41%), Gaps = 50/253 (19%)

Query: 123 WRKISSQNSPMPR---SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLLDCNTKEW 179
           W +I  QNSP PR    S+A A   + + ++ G    S        Y DTW++ CN  + 
Sbjct: 139 WNRIKLQNSPFPRYRHVSSAYATASNNIYILGGLHDQSV-------YGDTWIISCN-PDA 190

Query: 180 TKIEQK------NGPTARSGHRLTVWKNYFILHGG----FRDLGTMTTYLSDCWLFDITT 229
           T+   K      N P  R GH  T+  N FI+ GG        G M     D +LF+I +
Sbjct: 191 TQFSSKSVDIGENTPPPRVGHAATLCGNAFIVFGGDTHKVNKEGLMD---DDIYLFNINS 247

Query: 230 YKWKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMK 289
           YKW   +  P  P P  R GH +       +L     K K       G    D ++  + 
Sbjct: 248 YKWTIPN--PIGPRPLGRYGHKI------CILATSTVKTKL---YLFGGQFDDTYFNDLA 296

Query: 290 S-DIGAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFY 343
             D+ + R     WE  K +GF P P    +MV +     ++GG     +T++ L     
Sbjct: 297 VFDLSSFRRQDSHWEFIKSKGFMPPPLTNHTMVTYGSDLWIYGG-----DTQQGL----I 347

Query: 344 NDLFTFQIETNRW 356
           ND+F F   TN W
Sbjct: 348 NDIFKFSPNTNTW 360

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 74/160 (46%), Gaps = 19/160 (11%)

Query: 52  LANFKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGEXXXXXXXXXAFYN 111
           L++F+R Q+   E + S    P    N +MV    +G  +L ++GG+            N
Sbjct: 300 LSSFRR-QDSHWEFIKSKGFMPPPLTNHTMVT---YG-SDLWIYGGDTQQ------GLIN 348

Query: 112 DLFTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL 171
           D+F +S + + W K+ +  +  P      A     ++ + GG+     +N  Y  S  +L
Sbjct: 349 DIFKFSPNTNTWTKVETTGTKPPPMQEHAAVVYKNIMCVVGGK----DENDMYLNS-VYL 403

Query: 172 LDCNTKEW-TKIEQKNGPT-ARSGHRLTVWKN-YFILHGG 208
            + ++ +W T  + K+G    RSGH +T+  N   ++ GG
Sbjct: 404 FNFDSSKWYTFPDFKSGIIQGRSGHSVTLLNNDKLLIMGG 443

>NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5.88
           YGR238C
          Length = 1086

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 107/259 (41%), Gaps = 60/259 (23%)

Query: 123 WRKISSQNSPMPR---SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLLDCNTKEW 179
           W +I  QNSP PR    ++++ +  + V +I G    S        Y DTW+L C   + 
Sbjct: 131 WNRIKLQNSPFPRYRHVASSVISDTNQVYVIGGLHDQS-------VYGDTWVLTCEDPQT 183

Query: 180 TKI-------EQKNGPTARSGHRLTVWKNYFILHGG----FRDLGTMTTYLSDCWLFDIT 228
           + +         +  P  R GH  T+  N F++ GG      ++G M     D +LF+I 
Sbjct: 184 STMFSSRTVDITETTPPPRVGHASTLCGNAFVIFGGDTHKKNEMGEMD---DDIYLFNIN 240

Query: 229 TYKWKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQK-----GKILTDC 283
           +YKW          IP     H + P P G   +G    + A K +Q      G    D 
Sbjct: 241 SYKWT---------IP-----HPIGPRPKGR--YGHKISIIARKQMQTKLYLFGGQFDDN 284

Query: 284 WYLKMKS-DIGAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEES 337
           ++  +   D+ + R     WE  K + F P P    +MV +  +  +FGG        ++
Sbjct: 285 YFNDLVVFDLSSFRRDDSHWEFIKPRSFIPPPITNHTMVSYDFKLWVFGG--------DT 336

Query: 338 LESMFYNDLFTFQIETNRW 356
           LE +  N +F +    N W
Sbjct: 337 LEGLL-NQVFMYDPAVNDW 354

>KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {ON}
           Anc_5.88 YGR238C
          Length = 986

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 64/226 (28%), Positives = 89/226 (39%), Gaps = 37/226 (16%)

Query: 119 DGDQWRKISSQNSPMPR---SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLLDCN 175
           D   W +I   NSP PR    ++A A     + +I G    S        Y DTW+L   
Sbjct: 130 DQTVWNRIKLANSPFPRYRHVASAYATEDDKIYVIGGLHDQSV-------YGDTWILTSE 182

Query: 176 TKEWTKIEQK-----NGPTARSGHRLTVWKNYFILHGG----FRDLGTMTTYLSDCWLFD 226
                 I Q      N P  R GH  T+  N FI+ GG        G M     D +LF+
Sbjct: 183 NNASRFISQTVDISDNTPPPRVGHAATLCGNAFIIFGGDTHKVNKDGLMD---DDLYLFN 239

Query: 227 ITTYKWKQVDFPPNHPIPDARSGH--SLVPTPDGAV---LWGGYCKVKAGKGLQKGKILT 281
           I ++KW   +  P  P P  R GH  S++ T +      L+GG         L    ++ 
Sbjct: 240 INSHKWTIPN--PVGPRPLGRYGHKISIIATANSKTRLYLFGGQFDDAYFNDL----VVF 293

Query: 282 DCWYLKMKSDIGAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGG 327
           D    +        RWE  K + F P P    +MV +  +  +FGG
Sbjct: 294 DLSSFRRPDS----RWEFVKPKSFVPPPLTNHTMVSYDNKLWVFGG 335

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 45/117 (38%), Gaps = 12/117 (10%)

Query: 240 NHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKSDIGAIRWER 299
           N P P  R   S   T D  +   G        GL    +  D W L  +++      + 
Sbjct: 141 NSPFPRYRHVASAYATEDDKIYVIG--------GLHDQSVYGDTWILTSENNASRFISQT 192

Query: 300 RKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFYNDLFTFQIETNRW 356
                  P PRVG +        I+FGG    +  + + + +  +DL+ F I +++W
Sbjct: 193 VDISDNTPPPRVGHAATLCGNAFIIFGG----DTHKVNKDGLMDDDLYLFNINSHKW 245

>SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1085

 Score = 61.6 bits (148), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 71/255 (27%), Positives = 102/255 (40%), Gaps = 54/255 (21%)

Query: 123 WRKISSQNSPMPR---SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLLDC---NT 176
           W +I   +SP PR    ++A A+  + V +I G    S        Y DTW+L     NT
Sbjct: 73  WNRIKLGSSPFPRYRHVASAYASEQNQVFVIGGLHDQSV-------YGDTWILTAHANNT 125

Query: 177 KEWTKIE--QKNGPTARSGHRLTVWKNYFILHGG----FRDLGTMTTYLSDCWLFDITTY 230
           +  +K        P  R GH  T+  N F++ GG      + G M     D +LF+I +Y
Sbjct: 126 RFTSKTVDISDTTPPPRVGHASTLCGNAFVIFGGDTHKVNNEGLMD---DDVYLFNINSY 182

Query: 231 KWKQVDFP-PNHPIPDARSGHSLVPTPDGAVLWGGYCKVKA---GKGLQKGKILTDCWYL 286
           KW     P P  P P  R GH +      +V+     K K    G           C Y 
Sbjct: 183 KWT---IPHPVGPRPLGRYGHKI------SVIATSQMKTKLYVFGGQFDDTYFNDLCVY- 232

Query: 287 KMKSDIGAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESM 341
               D+ + R     WE  K Q F P P    +MV +  +  +FGG     +T + L   
Sbjct: 233 ----DLSSFRRPDSHWEFLKPQSFVPPPLTNHTMVSYDYKLWIFGG-----DTAQGL--- 280

Query: 342 FYNDLFTFQIETNRW 356
             N++F +    N W
Sbjct: 281 -INEVFMYDPTVNDW 294

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 73/169 (43%), Gaps = 24/169 (14%)

Query: 89  KRELLLFGGEXXXXXXXXXAFYNDLFTYSLDG-----DQWRKISSQN-SPMPRSSAAIAA 142
           K +L +FGG+          ++NDL  Y L         W  +  Q+  P P ++  + +
Sbjct: 211 KTKLYVFGGQFDD------TYFNDLCVYDLSSFRRPDSHWEFLKPQSFVPPPLTNHTMVS 264

Query: 143 HPSGVVLIHGGEFSSPKQNTFYHYSDTWLLDCNTKEWTKIEQKNG-PTARSGHRLTVWKN 201
           +    + I GG+ +    N  + Y      D    +WT +E     P A   H   V+K+
Sbjct: 265 Y-DYKLWIFGGDTAQGLINEVFMY------DPTVNDWTVVETTGSKPPAIQEHAAVVYKD 317

Query: 202 YFILHGGFRDLGTMTTYLSDCWLFDITTYKWKQVDFPPNHPIPDARSGH 250
              + GG  +     +Y +D +  ++ ++KW ++ F  N  +P  RSGH
Sbjct: 318 LMCVTGGKDE---QDSYSNDVYFLNLKSFKWFKLPFFKNG-VPQGRSGH 362

>ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} similar
           to uniprot|Q75AR9 Ashbya gossypii ADL149W ADL149Wp and
           some similarites with YHR158C uniprot|P38853
           Saccharomyces cerevisiae YHR158C KEL1 Protein required
           for proper cell fusion and cell morphology functions in
           a complex with Kel2p to negatively regulate mitotic exit
           interacts with Tem1p and Lte1p localizes to regions of
           polarized growth potential Cdc28p substrate
          Length = 1293

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 63/256 (24%), Positives = 104/256 (40%), Gaps = 50/256 (19%)

Query: 123 WRKISSQNSPMPR---SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLLDCNTKEW 179
           W ++  QNSP PR    +++  +  + + +I G    S        Y DTW++  N    
Sbjct: 141 WNRVKLQNSPFPRYRHVASSNCSEDNSLYVIGGLHDQS-------VYGDTWIISTNDN-G 192

Query: 180 TKIEQKN------GPTARSGHRLTVWKNYFILHGG-FRDLGTMTTYLSDCWLFDITTYKW 232
           T+ + K        P  R GH  T+  N F+L GG    + +      D +LF++ +YKW
Sbjct: 193 TQFQSKTVEISETTPPPRVGHAATLCGNAFVLFGGDTHKVNSEGLMDDDLYLFNVNSYKW 252

Query: 233 KQVDFPPNHPI---PDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMK 289
                P  HPI   P  R GH +      +++     K K       G    D ++  + 
Sbjct: 253 T---IP--HPIGPRPLGRYGHKI------SIMAANQMKTKL---YLFGGQFDDTYFNDLA 298

Query: 290 S-DIGAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFY 343
             D+ + R     WE  K   F P P    +M+ +     +FGG        ++L+ +  
Sbjct: 299 VFDLSSFRRPDSHWEFLKPTTFSPPPLTNHTMISYDNHLWVFGG--------DTLQGLI- 349

Query: 344 NDLFTFQIETNRWYSA 359
           N +F + +  N W  A
Sbjct: 350 NQVFKYDVANNDWSIA 365

>Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {ON}
           YHR158C (REAL)
          Length = 1169

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 67/254 (26%), Positives = 104/254 (40%), Gaps = 50/254 (19%)

Query: 123 WRKISSQNSPMPR---SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL---LDCNT 176
           W +I  QNSP PR    ++A     + + +I G    S        Y DTW+   LD  T
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYVTDKNQIYVIGGLHDQSV-------YGDTWILTALDNAT 165

Query: 177 K-EWTKIE-QKNGPTARSGHRLTVWKNYFILHGG----FRDLGTMTTYLSDCWLFDITTY 230
           K   T I+  +  P  R GH   +  N F++ GG        G M     D +L +I +Y
Sbjct: 166 KFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMD---DDIYLLNINSY 222

Query: 231 KWKQVDFP-PNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMK 289
           KW     P P  P P  R GH +      +++     K K       G    D ++  + 
Sbjct: 223 KWT---VPAPVGPRPLGRYGHKI------SIIATTQMKTKL---YVFGGQFDDTYFNDLA 270

Query: 290 S-DIGAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFY 343
             D+ + R     WE  K + F P P    +M+ +  +  +FGG        ++L+ +  
Sbjct: 271 VYDLSSFRRPDSHWEFLKPKAFTPPPITNFTMISYDSKLWVFGG--------DTLQGLI- 321

Query: 344 NDLFTFQIETNRWY 357
           ND+F +    N W+
Sbjct: 322 NDVFMYDPAINDWF 335

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 46/210 (21%), Positives = 83/210 (39%), Gaps = 35/210 (16%)

Query: 89  KRELLLFGGEXXXXXXXXXAFYNDLFTYSLDG-----DQWRKISSQN-SPMPRSSAAIAA 142
           K +L +FGG+          ++NDL  Y L         W  +  +  +P P ++  + +
Sbjct: 251 KTKLYVFGGQFDD------TYFNDLAVYDLSSFRRPDSHWEFLKPKAFTPPPITNFTMIS 304

Query: 143 HPSGVVLIHGGEFSSPKQNTFYHYSDTWLLDCNTKEWTKIEQK-NGPTARSGHRLTVWKN 201
           + S + +  G              +D ++ D    +W  IE     P     H   V+ +
Sbjct: 305 YDSKLWVFGGDTLQG-------LINDVFMYDPAINDWFIIETTGEKPPPVQEHASVVYND 357

Query: 202 YFILHGGFRDLGTMTTYLSDCWLFDITTYKWKQVDFPPNHPIPDARSGHSLVPTPDGAVL 261
              + GG  +      YL+  +  ++ ++KW ++       IP  RSGHSL    D  +L
Sbjct: 358 LMCVVGGKDE---HDAYLNSVYFLNLKSHKWFKLPVF-TAGIPQGRSGHSLTLLKDDKIL 413

Query: 262 WGG-----YCKVK------AGKGLQKGKIL 280
             G     Y +V+      +   LQ+G I+
Sbjct: 414 IMGGDKFDYARVEEFDLHTSDIDLQRGTIV 443

>KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} similar
           to uniprot|P50090 Saccharomyces cerevisiae YGR238C KEL2
           Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate AND similar to YHR158C
           uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 905

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 69/252 (27%), Positives = 99/252 (39%), Gaps = 48/252 (19%)

Query: 123 WRKISSQNSPMPR--SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL---LDCNT- 176
           W +I  + SP PR    A+  A  SG + + GG            Y DTW+   LD  T 
Sbjct: 93  WNRIRLKQSPFPRYRHVASSYATDSGELFVIGGLHDQSV------YGDTWIIKSLDNATS 146

Query: 177 -KEWTKIEQKNGPTARSGHRLTVWKNYFILHGG----FRDLGTMTTYLSDCWLFDITTYK 231
            K  T       P  R GH  T+  N F++ GG      D G M     D +LF+I ++K
Sbjct: 147 FKSITVPIADATPPPRVGHASTLCGNAFVIFGGDTHKVNDAGLMD---DDIYLFNINSHK 203

Query: 232 WKQVDFP-PNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKS 290
           W     P P  P P  R GH +      +++     K K       G    D ++  +  
Sbjct: 204 WT---IPTPQGPRPLGRYGHKI------SIIAANQMKTKL---YVFGGQFDDTYFNDLAE 251

Query: 291 -DIGAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFYN 344
            D+ + R     WE  K   F P P    +M+    +  +FGG     +T + L     N
Sbjct: 252 FDLSSFRRSDSHWEFIKPATFMPPPLANHTMISFDHKLWVFGG-----DTPQGLT----N 302

Query: 345 DLFTFQIETNRW 356
           ++F F    N W
Sbjct: 303 EVFMFDPAANDW 314

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 45/100 (45%), Gaps = 7/100 (7%)

Query: 167 SDTWLLDCNTKEWTKIEQK-NGPTARSGHRLTVWKNYFILHGGFRDLGTMTTYLSDCWLF 225
           ++ ++ D    +W  ++   N P     H   ++++   + GG +D      Y +  +  
Sbjct: 302 NEVFMFDPAANDWCVVQTTGNIPPPLQEHAAIIYRDLMCVFGG-KD--AQDNYSNAVYFL 358

Query: 226 DITTYKW-KQVDFPPNHPIPDARSGHSLVPTPDGAVLWGG 264
           +  + KW K   F  N+ IP ARSGHSL    +  +L  G
Sbjct: 359 NFRSLKWFKLPTF--NNMIPRARSGHSLTLLSNNKLLIMG 396

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 67/161 (41%), Gaps = 21/161 (13%)

Query: 52  LANFKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGEXXXXXXXXXAFYN 111
           L++F+R    +E +  +T   P    N +M++       +L +FGG+            N
Sbjct: 254 LSSFRRSDSHWEFIKPATF-MPPPLANHTMIS----FDHKLWVFGGDTPQ------GLTN 302

Query: 112 DLFTYSLDGDQWRKI-SSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTW 170
           ++F +    + W  + ++ N P P    A   +   + +  G +      N  Y      
Sbjct: 303 EVFMFDPAANDWCVVQTTGNIPPPLQEHAAIIYRDLMCVFGGKDAQDNYSNAVY------ 356

Query: 171 LLDCNTKEWTKIEQKNG--PTARSGHRLTVWKNY-FILHGG 208
            L+  + +W K+   N   P ARSGH LT+  N   ++ GG
Sbjct: 357 FLNFRSLKWFKLPTFNNMIPRARSGHSLTLLSNNKLLIMGG 397

>Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C
           (KEL1) - involved in cell fusion and morphology;
           contains six Kelch repeats [contig 244] FULL
          Length = 978

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 63/255 (24%), Positives = 103/255 (40%), Gaps = 54/255 (21%)

Query: 123 WRKISSQNSPMPR---SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLLDCN---- 175
           WR+I   NSP PR    ++A A+  + V +I G    S        Y DTW++  +    
Sbjct: 76  WRRIKLANSPFPRYRHVASAYASEQNQVYVIGGLHDQS-------VYGDTWIVTSHENGA 128

Query: 176 --TKEWTKIEQKNGPTARSGHRLTVWKNYFILHGG-FRDLGTMTTYLSDCWLFDITTYKW 232
             T +  +I     P  R GH  T+  N F++ GG    + +      D +LF+I +YKW
Sbjct: 129 RFTSKTVEISDAT-PPPRVGHASTLCGNAFVIFGGDTHKVNSDGLMDDDVYLFNINSYKW 187

Query: 233 KQVDFPPNHPIPDARSGH-----SLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLK 287
              +  P  P P  R GH     ++ P      ++GG                 D ++  
Sbjct: 188 TIPN--PVGPRPLGRYGHKISIIAMSPMKTKLYVFGGQ--------------FDDTYFND 231

Query: 288 MKS-DIGAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESM 341
           +   D+ + R     W+      F P P    +M+ +  +  +FGG     +T + L   
Sbjct: 232 LAVFDLSSFRRPDSSWQFITPNSFTPPPLTNHAMISYDYKLWVFGG-----DTPQGL--- 283

Query: 342 FYNDLFTFQIETNRW 356
             +D+F F  + N W
Sbjct: 284 -IDDVFVFDPQVNDW 297

 Score = 36.2 bits (82), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 48/220 (21%), Positives = 89/220 (40%), Gaps = 30/220 (13%)

Query: 89  KRELLLFGGEXXXXXXXXXAFYNDLFTYSLDG-----DQWRKISSQN-SPMPRSSAAIAA 142
           K +L +FGG+          ++NDL  + L         W+ I+  + +P P ++ A+ +
Sbjct: 214 KTKLYVFGGQFDD------TYFNDLAVFDLSSFRRPDSSWQFITPNSFTPPPLTNHAMIS 267

Query: 143 HPSGVVLIHGGEFSSPKQNTFYHYSDTWLLDCNTKEWTKIEQKNG--PTARSGHRLTVWK 200
           +    + + GG+  +P+        D ++ D    +W K  Q  G  P     H   ++ 
Sbjct: 268 Y-DYKLWVFGGD--TPQG----LIDDVFVFDPQVNDW-KFIQTTGQKPPPLQEHASVLYG 319

Query: 201 NYFILHGGFRDLGTMTTYLSDCWLFDITTYKWKQVDFPPNHPIPDARSGHSLVPTPDGAV 260
           +   + GG  +      Y +  +  ++ + KW +  F     IP  RSGHSL   P+  +
Sbjct: 320 DLMCIVGGKDE---QDVYSNGVYFLNLISLKWFKFPFF-RAGIPQGRSGHSLTLLPNHKL 375

Query: 261 LWGGYCKVKAGKG----LQKGKILTDCWYLKMKSDIGAIR 296
           L  G  K    +G        ++   C  L    D+  +R
Sbjct: 376 LIMGGDKFDYARGGDDDFHTSEVDMACGTLLYTLDLSKLR 415

>Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {ON}
           YHR158C (REAL)
          Length = 1168

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 67/254 (26%), Positives = 104/254 (40%), Gaps = 50/254 (19%)

Query: 123 WRKISSQNSPMPR---SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLL---DCNT 176
           W +I  Q+SP PR    S+A     + + +I G    S        Y DTW+L   D  T
Sbjct: 113 WNRIKLQDSPFPRYRHVSSAYVTDKNQIYVIGGLHDQSV-------YGDTWILTAFDNAT 165

Query: 177 K-EWTKIE-QKNGPTARSGHRLTVWKNYFILHGG----FRDLGTMTTYLSDCWLFDITTY 230
           K   T I+  +  P  R GH   +  N F++ GG        G M     D +L +I +Y
Sbjct: 166 KFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMD---DDIYLLNINSY 222

Query: 231 KWKQVDFP-PNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMK 289
           KW     P P  P P  R GH +      +++     K K       G    D ++  + 
Sbjct: 223 KWT---VPAPVGPRPLGRYGHKI------SIIATNQMKTKL---YVFGGQFDDTYFNDLA 270

Query: 290 S-DIGAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFY 343
             D+ + R     WE  K + F P P    +M+ +  +  +FGG        ++L+ +  
Sbjct: 271 VYDLSSFRRPDSHWEFLKPKTFSPPPITNFTMISYDSKLWVFGG--------DTLQGLV- 321

Query: 344 NDLFTFQIETNRWY 357
           ND+F +    N W+
Sbjct: 322 NDVFMYDPALNDWF 335

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 46/210 (21%), Positives = 81/210 (38%), Gaps = 35/210 (16%)

Query: 89  KRELLLFGGEXXXXXXXXXAFYNDLFTYSLDG-----DQWRKISSQN-SPMPRSSAAIAA 142
           K +L +FGG+          ++NDL  Y L         W  +  +  SP P ++  + +
Sbjct: 251 KTKLYVFGGQFDD------TYFNDLAVYDLSSFRRPDSHWEFLKPKTFSPPPITNFTMIS 304

Query: 143 HPSGVVLIHGGEFSSPKQNTFYHYSDTWLLDCNTKEWTKIEQK-NGPTARSGHRLTVWKN 201
           + S + +  G              +D ++ D    +W  IE     P     H   V+ +
Sbjct: 305 YDSKLWVFGGDTLQG-------LVNDVFMYDPALNDWFIIETTGEKPPPVQEHATVVYND 357

Query: 202 YFILHGGFRDLGTMTTYLSDCWLFDITTYKWKQVDFPPNHPIPDARSGHSLVPTPDGAVL 261
              + GG  +      YL+  +  ++ + KW ++       IP  RSGHSL    +  +L
Sbjct: 358 LMCVVGGKDE---HDAYLNSVYFLNLKSNKWFKLPVF-TAGIPQGRSGHSLTLLKNDKIL 413

Query: 262 WGG-----YCKVKAGK------GLQKGKIL 280
             G     Y +V+          +QKG I+
Sbjct: 414 IMGGDKFDYARVEESDLHTSDIDMQKGTIV 443

>Suva_15.357 Chr15 complement(617637..618952,619001..621203) [3519
           bp, 1172 aa] {ON} YHR158C (REAL)
          Length = 1172

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 64/255 (25%), Positives = 103/255 (40%), Gaps = 50/255 (19%)

Query: 123 WRKISSQNSPMPR---SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLL----DCN 175
           W +I  QNSP PR    ++A A   + + +I G    S        Y DTW+L    D  
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYATDKNQIYVIGGLHDQSV-------YGDTWILSAFDDAT 165

Query: 176 TKEWTKIE-QKNGPTARSGHRLTVWKNYFILHGG----FRDLGTMTTYLSDCWLFDITTY 230
               T I+  +  P  R GH   +  N F++ GG        G M     D +L ++ +Y
Sbjct: 166 KFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNREGLMD---DDIYLLNVNSY 222

Query: 231 KWKQVDFP-PNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMK 289
           KW     P P  P P  R GH +      +++     K K       G    D ++  + 
Sbjct: 223 KWT---VPAPVGPRPLGRYGHKI------SIIATTQMKTKL---YVFGGQFDDTYFNDLA 270

Query: 290 S-DIGAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFY 343
             D+ + R     W+  K   F P P    +M+ +  +  +FGG        ++L+ +  
Sbjct: 271 VYDLSSFRRPDSHWDFLKPMTFTPPPMTNFTMISYDSKLWVFGG--------DTLQGLI- 321

Query: 344 NDLFTFQIETNRWYS 358
           ND+F +    N W++
Sbjct: 322 NDVFMYDPAKNDWFT 336

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 71/184 (38%), Gaps = 26/184 (14%)

Query: 89  KRELLLFGGEXXXXXXXXXAFYNDLFTYSLDG-----DQWRKISSQN-SPMPRSSAAIAA 142
           K +L +FGG+          ++NDL  Y L         W  +     +P P ++  + +
Sbjct: 251 KTKLYVFGGQFDD------TYFNDLAVYDLSSFRRPDSHWDFLKPMTFTPPPMTNFTMIS 304

Query: 143 HPSGVVLIHGGEFSSPKQNTFYHYSDTWLLDCNTKEWTKIEQK-NGPTARSGHRLTVWKN 201
           + S + +  G              +D ++ D    +W  IE     P     H   V+ +
Sbjct: 305 YDSKLWVFGGDTLQG-------LINDVFMYDPAKNDWFTIETSGEKPPPVQEHATVVYND 357

Query: 202 YFILHGGFRDLGTMTTYLSDCWLFDITTYKW-KQVDFPPNHPIPDARSGHSLVPTPDGAV 260
              + GG  +      YL+  +  ++ T+KW K   F     IP  RSGHSL    +  V
Sbjct: 358 LMCVVGGKDE---HDAYLNTVYFLNLKTHKWFKLPIFAAG--IPQGRSGHSLTLLKNDKV 412

Query: 261 LWGG 264
           L  G
Sbjct: 413 LIMG 416

>KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1104

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 64/256 (25%), Positives = 103/256 (40%), Gaps = 56/256 (21%)

Query: 123 WRKISSQNSPMPRSSAAIAAHPS--GVVLIHGGEFSSPKQNTFYHYSDTWLLDC--NTKE 178
           W +I  ++SP PR     +++ +    V + GG      Q+ F    D W++    N  +
Sbjct: 197 WNRIKLKDSPFPRYRHVTSSYATEDDRVFVIGGLHD---QSVF---GDVWIIKSLENGTK 250

Query: 179 WTKIE---QKNGPTARSGHRLTVWKNYFILHGG----FRDLGTMTTYLSDCWLFDITTYK 231
           +T       +N P  R GH  T+  N F++ GG        G M     D +LF+I +YK
Sbjct: 251 FTSTTIDITENTPPPRVGHAATLCGNAFVVFGGDTHKVNKDGLMD---DDLYLFNINSYK 307

Query: 232 WKQVDFPPNHPIPDARSGHSL-----VPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYL 286
           W   +  P  P P  R GH +      P      L+GG                 D ++ 
Sbjct: 308 WTIPN--PIGPRPLGRYGHKVSIIATTPMKTKLYLFGGQ--------------FDDTYFN 351

Query: 287 KMKS-DIGAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLES 340
            +   D+   R     WE  K + F P P    +MV ++ +  +FGG        ++L+ 
Sbjct: 352 NLAVFDLSQFRRPDSHWEFLKPKSFMPPPLTNHTMVSYQNKLWIFGG--------DTLQG 403

Query: 341 MFYNDLFTFQIETNRW 356
           +  N +F +  E N W
Sbjct: 404 LI-NKIFMYDPEVNDW 418

 Score = 39.7 bits (91), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 46/203 (22%), Positives = 80/203 (39%), Gaps = 20/203 (9%)

Query: 89  KRELLLFGGEXXXXXXXXXAFYNDLFTYSLDGDQWRKISSQN-SPMPRSSAAIAAHPSGV 147
           K +L LFGG+         A + DL  +      W  +  ++  P P ++  + ++    
Sbjct: 335 KTKLYLFGGQFDDTYFNNLAVF-DLSQFRRPDSHWEFLKPKSFMPPPLTNHTMVSY-QNK 392

Query: 148 VLIHGGEFSSPKQNTFYHYSDTWLLDCNTKEWTKIE-------QKNGPTARSGHRLTVWK 200
           + I GG+      N  + Y      D    +WT +E       Q+N P     H   ++ 
Sbjct: 393 LWIFGGDTLQGLINKIFMY------DPEVNDWTVVETFPANNDQENFPPPMQEHASVMYG 446

Query: 201 NYFILHGGFRDLGTMTTYLSDCWLFDITTYKWKQVDFPPNHPIPDARSGHSLVPTPDGAV 260
           +  ++ GG  +      YL+  +   I T +W ++ F  +  IP  RSGHS+       +
Sbjct: 447 DLMVVMGGKDE---QDNYLNTVYFLKINTLEWYKLPFL-SVGIPQGRSGHSITLLKGNKL 502

Query: 261 LWGGYCKVKAGKGLQKGKILTDC 283
           L  G  K    +  + G   TD 
Sbjct: 503 LIMGGDKFDYARPEEHGLHTTDT 525

>YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON}
           KEL1Protein required for proper cell fusion and cell
           morphology; functions in a complex with Kel2p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 1164

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 66/254 (25%), Positives = 104/254 (40%), Gaps = 50/254 (19%)

Query: 123 WRKISSQNSPMPR---SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLL---DCNT 176
           W +I  QNSP PR    ++A     + + +I G    S        Y DTW+L   D  T
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYVTDKNQIYVIGGLHDQSV-------YGDTWILTAFDNAT 165

Query: 177 K-EWTKIE-QKNGPTARSGHRLTVWKNYFILHGG----FRDLGTMTTYLSDCWLFDITTY 230
           +   T I+  +  P  R GH   +  N F++ GG        G M     D +L +I +Y
Sbjct: 166 RFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMD---DDIYLLNINSY 222

Query: 231 KWKQVDFP-PNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMK 289
           KW     P P  P P  R GH +      +++     K K       G    D ++  + 
Sbjct: 223 KWT---VPAPVGPRPLGRYGHKI------SIIATTQMKTKL---YVFGGQFDDTYFNDLA 270

Query: 290 S-DIGAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFY 343
             D+ + R     WE  K + F P P    +M+ +  +  +FGG        ++L+ +  
Sbjct: 271 VYDLSSFRRPDSHWEFLKPRTFTPPPITNFTMISYDSKLWVFGG--------DTLQGLV- 321

Query: 344 NDLFTFQIETNRWY 357
           ND+F +    N W+
Sbjct: 322 NDVFMYDPAINDWF 335

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 49/120 (40%), Gaps = 15/120 (12%)

Query: 92  LLLFGGEXXXXXXXXXAFYNDLFTYSLDGDQWRKI-SSQNSPMPRSSAAIAAHPSGVVLI 150
           L +FGG+            ND+F Y    + W  I ++   P P    A   +   + ++
Sbjct: 309 LWVFGGDTLQ------GLVNDVFMYDPAINDWFIIDTTGEKPPPVQEHATVVYNDLMCVV 362

Query: 151 HGGEFSSPKQNTFYHYSDTWLLDCNTKEWTKIEQKNG--PTARSGHRLTVWKNYFILHGG 208
            G +      N+ Y       L+  +++W K+       P  RSGH LT+ KN  IL  G
Sbjct: 363 GGKDEHDAYLNSVY------FLNLKSRKWFKLPVFTAGIPQGRSGHSLTLLKNDKILIMG 416

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 43/210 (20%), Positives = 82/210 (39%), Gaps = 35/210 (16%)

Query: 89  KRELLLFGGEXXXXXXXXXAFYNDLFTYSLDG-----DQWRKISSQN-SPMPRSSAAIAA 142
           K +L +FGG+          ++NDL  Y L         W  +  +  +P P ++  + +
Sbjct: 251 KTKLYVFGGQFDD------TYFNDLAVYDLSSFRRPDSHWEFLKPRTFTPPPITNFTMIS 304

Query: 143 HPSGVVLIHGGEFSSPKQNTFYHYSDTWLLDCNTKEWTKIEQK-NGPTARSGHRLTVWKN 201
           + S + +  G              +D ++ D    +W  I+     P     H   V+ +
Sbjct: 305 YDSKLWVFGGDTLQG-------LVNDVFMYDPAINDWFIIDTTGEKPPPVQEHATVVYND 357

Query: 202 YFILHGGFRDLGTMTTYLSDCWLFDITTYKWKQVDFPPNHPIPDARSGHSLVPTPDGAVL 261
              + GG  +      YL+  +  ++ + KW ++       IP  RSGHSL    +  +L
Sbjct: 358 LMCVVGGKDE---HDAYLNSVYFLNLKSRKWFKLPVF-TAGIPQGRSGHSLTLLKNDKIL 413

Query: 262 WGG-----YCKVK------AGKGLQKGKIL 280
             G     Y +V+      +   +Q+G I+
Sbjct: 414 IMGGDKFDYARVEEYDLHTSDIDMQRGTIV 443

>KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1056

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 63/251 (25%), Positives = 102/251 (40%), Gaps = 46/251 (18%)

Query: 123 WRKISSQNSPMPR---SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLLDCNTKEW 179
           W ++   NSP PR    ++A A+  + V +I G    S        Y DTW++  +    
Sbjct: 78  WSRVKLANSPFPRYRHVASAYASEQNQVYVIGGLHDQS-------VYGDTWIISAHDN-G 129

Query: 180 TKIEQKN------GPTARSGHRLTVWKNYFILHGG-FRDLGTMTTYLSDCWLFDITTYKW 232
           +K   K        P  R GH  T+  N F++ GG    + +      D +LF+I +YKW
Sbjct: 130 SKFSSKTVDITDTTPPPRVGHASTLCGNAFVIFGGDTHKVNSDGLMDDDVYLFNINSYKW 189

Query: 233 KQVDFP-PNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKS- 290
                P P  P P  R GH +      +++     + K       G    D ++  +   
Sbjct: 190 T---IPRPVGPRPLGRYGHKI------SIIATSQMRTKL---YVFGGQFDDTYFNDLTVF 237

Query: 291 DIGAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFYND 345
           D+ + R     W+  K   F P P    +M+ +  +  +FGG     +T + L     ND
Sbjct: 238 DLSSFRRPDSHWQFIKPNTFTPPPLTNHTMISYDYKLWVFGG-----DTPQGL----IND 288

Query: 346 LFTFQIETNRW 356
           +F F  + N W
Sbjct: 289 VFMFDPQINDW 299

 Score = 34.7 bits (78), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 49/111 (44%), Gaps = 11/111 (9%)

Query: 167 SDTWLLDCNTKEWTKIEQKNG--PTARSGHRLTVWKNYFILHGGFRDLGTMTTYLSDCWL 224
           +D ++ D    +W K+ Q  G  P     H   ++ +   + GG  +      Y +  + 
Sbjct: 287 NDVFMFDPQINDW-KVMQTTGDKPPPLQEHAAVLYGDLMCVVGGKDE---QDVYSNSVFF 342

Query: 225 FDITTYKWKQVDFPPNH--PIPDARSGHSLVPTPDGAVLWGGYCKVKAGKG 273
            ++ + KW ++   P++   IP  RSGHSL   P+  +L  G  K    +G
Sbjct: 343 LNLISLKWFKL---PSYRSGIPQGRSGHSLTLLPNHKLLIMGGDKFDYARG 390

>CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa]
           {ON} some similarities with uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1 involved in cell fusion and
           morphology
          Length = 1136

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 64/257 (24%), Positives = 100/257 (38%), Gaps = 54/257 (21%)

Query: 123 WRKISSQNSPMPRSSAAIAAHPS--GVVLIHGGEFSSPKQNTFYHYSDTWLLDC------ 174
           W +I   NSP PR     ++H +  G + + GG            Y DTW+L        
Sbjct: 147 WGRIRLSNSPFPRYRHVSSSHITDQGKIYVIGGLHDQSV------YGDTWILTASDIDKT 200

Query: 175 ---NTKEWTKIE-QKNGPTARSGHRLTVWKNYFILHGG-FRDLGTMTTYLSDCWLFDITT 229
              N+ + T IE  ++ P  R GH  T+  N F++ GG    + +      D +L +I +
Sbjct: 201 GAINSFKSTTIEITESTPPPRVGHASTLCGNAFVVFGGDTHKVNSDGLMDDDLYLLNINS 260

Query: 230 YKWKQVDFP-PNHPIPDARSGHSLVPTPDGAV---LWGGYCKVKAGKGLQKGKILTDCWY 285
           YKW     P P    P  R GH +V          L+GG                 D ++
Sbjct: 261 YKWT---IPKPVGQRPLGRYGHKIVTISAEQTKLYLFGGQ--------------FDDTYF 303

Query: 286 LKMKS-DIGAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLE 339
             +   D+ + R     W   K  GF P P    +MV ++ +  +FGG        ++LE
Sbjct: 304 GDLAVFDLSSFRRPDSHWVFLKPSGFNPPPLTNHTMVTYQDKIWVFGG--------DTLE 355

Query: 340 SMFYNDLFTFQIETNRW 356
               N ++ +    N W
Sbjct: 356 EGLINRVYLYSPTNNSW 372

>TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5.88
           YGR238C
          Length = 1009

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 59/250 (23%), Positives = 103/250 (41%), Gaps = 44/250 (17%)

Query: 123 WRKISSQNSPMPRSSAAIAAHPS--GVVLIHGGEFSSPKQNTFYHYSDTWLLDCNTKEWT 180
           W ++  Q+SP PR     +++ S    + + GG            Y DTW+++ +    T
Sbjct: 94  WNRVKLQDSPFPRYRHVASSYVSDDNRIYVIGGLHDESV------YGDTWIINVD-DSGT 146

Query: 181 KIEQKN------GPTARSGHRLTVWKNYFILHGG-FRDLGTMTTYLSDCWLFDITTYKWK 233
           +   K        P  R GH  T+  N F++ GG    + +      D +LF+I ++KW 
Sbjct: 147 QFSSKTVDISEFTPPPRVGHAATLCGNAFVIFGGDTHKVNSEGLMDDDLYLFNINSFKWT 206

Query: 234 QVDFP-PNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKS-D 291
               P P  P P  R GH +      +++     K K       G    D ++  +   D
Sbjct: 207 ---IPHPVGPRPLGRYGHKI------SIIATNQMKTKL---YLFGGQFDDTFFNDLAVYD 254

Query: 292 IGAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFYNDL 346
           + + R     WE  K + F P P    +MV +  +  +FGG        ++++ +  N +
Sbjct: 255 LSSFRRSDSHWEFLKPKTFVPPPLANHTMVSYDHKLWIFGG--------DTMQGLI-NKV 305

Query: 347 FTFQIETNRW 356
           F + I +N W
Sbjct: 306 FVYDIMSNDW 315

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 73/184 (39%), Gaps = 26/184 (14%)

Query: 89  KRELLLFGGEXXXXXXXXXAFYNDLFTYSLDG-----DQWRKISSQN-SPMPRSSAAIAA 142
           K +L LFGG+          F+NDL  Y L         W  +  +   P P ++  + +
Sbjct: 232 KTKLYLFGGQFDD------TFFNDLAVYDLSSFRRSDSHWEFLKPKTFVPPPLANHTMVS 285

Query: 143 HPSGVVLIHGGEFSSPKQNTFYHYSDTWLLDCNTKEWTKIEQKNG-PTARSGHRLTVWKN 201
           +    + I GG+      N  + Y      D  + +W+ +E     P     H   ++K+
Sbjct: 286 Y-DHKLWIFGGDTMQGLINKVFVY------DIMSNDWSLVETTGARPPPLQEHAALIYKD 338

Query: 202 YFILHGGFRDLGTMTTYLSDCWLFDITTYKWKQVDFPP-NHPIPDARSGHSLVPTPDGAV 260
              + GG  +      YL+  +  ++ + +W    FP     IP  RSGHS+    +  +
Sbjct: 339 LMCVVGGKDE---QDIYLNSIYFLNLKSCRW--FKFPVFKAGIPQGRSGHSITLLKNNKI 393

Query: 261 LWGG 264
           L  G
Sbjct: 394 LIMG 397

>TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {ON}
           Anc_5.88 YGR238C
          Length = 828

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 64/253 (25%), Positives = 95/253 (37%), Gaps = 39/253 (15%)

Query: 119 DGDQWRKISSQNSPMPRSSAAIAAH--PSGVVLIHGGEFSSP------KQNTFYHYSDT- 169
           D   W KI+ + +P PR     +++  PS  + I+GG F S       K N   +Y++  
Sbjct: 18  DYSPWSKINVKGTPFPRYRHITSSYIYPSNDLYINGGLFESDVYGDTWKLNIKENYNEND 77

Query: 170 ---WLLDCNTKEWTKIEQKNGPTARSGHRLTVWKNYFILHGGFRDLGTMTTYL--SDCWL 224
              W   CN  +         P  R GH  T+  N  I+ GG      ++  L   D + 
Sbjct: 78  LERWHYSCNIIDI----MGTTPPPRVGHAATLCGNALIVFGGDTHKVNVSNGLMDDDLYF 133

Query: 225 FDITTYKWKQVDFP-PNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDC 283
            ++ T KW     P P    P  R GH +        L+GG         L K  +L   
Sbjct: 134 LNLDTTKWT---IPSPKGIRPLGRYGHKISVINSNLYLFGGQFDETYFNDLVKFDLLN-- 188

Query: 284 WYLKMKSDIGAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFY 343
            +    S     +WE  K +GF P P    SM   + +  +FGG             +  
Sbjct: 189 -FKDANS-----QWEFIKPKGFIPPPLSNFSMCTFENKLYVFGG---------DTYQVLT 233

Query: 344 NDLFTFQIETNRW 356
           N+ F +  E N W
Sbjct: 234 NETFVYDPELNEW 246

>CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {ON}
           weakly similar to uniprot|P50090 Saccharomyces
           cerevisiae YGR238c KEL2 or uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1
          Length = 936

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 59/256 (23%), Positives = 91/256 (35%), Gaps = 56/256 (21%)

Query: 123 WRKISSQNSPMPR--SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLLDCNTKEWT 180
           W +    +SP+PR    A+  A P   + + GG            Y DTW+L  N+    
Sbjct: 162 WGRTRLMSSPLPRYRHIASTYATPDNRIFVMGGLHGE------LVYGDTWMLTANSDSTN 215

Query: 181 KIEQK-----NGPTARSGHRLTVWKNYFILHGG-FRDLGTMTTYLSDCWLFDITTYKWKQ 234
              Q      N P  R GH  T+  N  ++ GG    L +      D +LF++ +++W  
Sbjct: 216 FTTQVIDLTVNTPPPRVGHAATLCGNALVIFGGDTHKLNSEGLLDDDLYLFNVDSHRWT- 274

Query: 235 VDFPPNHPIPDARSGHSLVPTPDGAVLWGGY--------CKVKAGKGLQKGKILTDCWYL 286
                             +PTP G    G Y           K  K    G  L D ++ 
Sbjct: 275 ------------------IPTPIGTRPLGRYGHQVSVIATTPKKAKLYLFGGQLDDNYFN 316

Query: 287 KMKS-DIGAI-----RWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLES 340
            +   D+        RW+  K + F P P    +MV +  +  +FGG         S   
Sbjct: 317 DLAMYDLSDFRNPHSRWQFLKSKAFTPPPLTNHTMVAYDYKLWVFGG---------SSRG 367

Query: 341 MFYNDLFTFQIETNRW 356
              N L+ +  + N W
Sbjct: 368 ELQNQLYVYIPDLNEW 383

>NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1167

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 61/225 (27%), Positives = 90/225 (40%), Gaps = 41/225 (18%)

Query: 123 WRKISSQNSPMPRSSAAIAAHPS--GVVLIHGGEFSSPKQNTFYHYSDTWLLDC-NTKEW 179
           W +I  QNSP PR     +++ S  G + + GG            Y DTW+L   N    
Sbjct: 160 WNRIKLQNSPFPRYRHVASSYVSDDGKIYVIGGLHDQSV------YGDTWILSYENNGLS 213

Query: 180 TKIEQK------NGPTARSGHRLTVWKNYFILHGG----FRDLGTMTTYLSDCWLFDITT 229
           T I  K      N P  R GH  T+  N F++ GG        G+M     D +LF+I +
Sbjct: 214 TTITSKTVDISENTPPPRVGHAATLCGNAFVIFGGDTHKVNKDGSMD---DDIYLFNINS 270

Query: 230 YKWKQVDFP-PNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKM 288
           YKW     P P    P  R GH +      +++     K K       G    D ++  +
Sbjct: 271 YKWT---IPKPVGQRPLGRYGHKI------SIIATSQMKTKL---YLFGGQFDDTYFNDL 318

Query: 289 KS-DIGAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGG 327
              D+ + R     WE  + + F P P    +M  +  +  +FGG
Sbjct: 319 VVFDLSSFRRPDSHWEFIRPKSFIPPPLTNHTMCSYDHKLWVFGG 363

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 42/189 (22%), Positives = 75/189 (39%), Gaps = 30/189 (15%)

Query: 89  KRELLLFGGEXXXXXXXXXAFYNDLFTYSLDG-----DQWRKISSQN-SPMPRSSAAIAA 142
           K +L LFGG+          ++NDL  + L         W  I  ++  P P ++  + +
Sbjct: 300 KTKLYLFGGQFDD------TYFNDLVVFDLSSFRRPDSHWEFIRPKSFIPPPLTNHTMCS 353

Query: 143 HPSGVVLIHGGEFSSPKQNTFYHYSDTWLLDCNTKEWTKIEQ-------KNGPTARSGHR 195
           +    + + GG+      N  + Y      D    +W  +E         N P     H 
Sbjct: 354 Y-DHKLWVFGGDTLQGLTNQVFMY------DPVDNDWCVVETFANNNDVSNIPPPIQEHA 406

Query: 196 LTVWKNYFILHGGFRDLGTMTTYLSDCWLFDITTYKWKQVDFPPNHPIPDARSGHSLVPT 255
             ++K+   + GG  +      YL+D +  ++ T KW ++ F     +P  RSGHS+   
Sbjct: 407 AVLYKDLMCVIGGKDE---SDNYLNDVYFLNLKTLKWFKLPF-YKEGVPQGRSGHSVTLL 462

Query: 256 PDGAVLWGG 264
            +  +L  G
Sbjct: 463 KNDKILIMG 471

>TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1016

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 65/251 (25%), Positives = 99/251 (39%), Gaps = 60/251 (23%)

Query: 123 WRKISSQNSPMPRSSAAIAAHPS--GVVLIHGGEFSSPKQNTFYHYSDTWLLDCNTKEWT 180
           W +I   NSP PR     +++ S    + + GG            Y DTW +  +T   T
Sbjct: 142 WNRIKLTNSPFPRYRHVASSYESVDNEIFVIGGLHDQSV------YGDTWSI-TSTNNGT 194

Query: 181 KIEQKN------GPTARSGHRLTVWKNYFILHGG----FRDLGTMTTYLSDCWLFDITTY 230
           +   K        P  R GH  T+  N F++ GG        G M     D +LF+I ++
Sbjct: 195 QFISKALEILDLSPPPRVGHASTLCGNAFVVFGGDTHKVNKDGLMD---DDIYLFNINSH 251

Query: 231 KWKQVDFP-PNHPIPDARSGH--SLVPTPDGAV---LWGGYCKVKAGKGLQKGKILTDCW 284
           KW     P P  P P  R GH  S++ T        L+GG                 D +
Sbjct: 252 KWT---IPSPVGPRPLGRYGHKISIIATSSSKTKLYLFGGQ--------------FDDTY 294

Query: 285 YLKMKS-DIGAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESL 338
           +  +   D+ + R     WE  K +G  P P    +MV +  +  +FGG     +T++ L
Sbjct: 295 FNDIAVFDLSSFRRADSHWEFIKPKGLIPPPMTNHTMVTYDNKLWVFGG-----DTKDGL 349

Query: 339 ESMFYNDLFTF 349
                ND++ F
Sbjct: 350 ----INDIYAF 356

>Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON}
           YGR238C (REAL)
          Length = 894

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 62/257 (24%), Positives = 109/257 (42%), Gaps = 41/257 (15%)

Query: 114 FTYSLDGDQWRKIS---SQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTW 170
            T +LDG  +   +    QN+P PR   A     +  V + GG+      N      D +
Sbjct: 118 ITGNLDGTSFVSKTIQIGQNTPPPRVGHASTICGNAYV-VFGGDTHKLNMNRLLD-DDLY 175

Query: 171 LLDCNTKEWTKIEQKNG--PTARSGHRLTVWKNY-----FILHGGFRDLGTMTTYLSDCW 223
           L + N+ +WT I Q  G  P  R GH++++  N        L GG  D     TY +D  
Sbjct: 176 LFNINSYKWT-IPQPVGTRPLGRYGHKISIIANNPMQTKLFLFGGQID----ETYFNDLA 230

Query: 224 LFDITTYKWKQ---VDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKIL 280
           +FD+++++      V   P   +P   + H++V   +   ++GG    K    L      
Sbjct: 231 MFDLSSFRRPNSHWVFLKPVSIVPPPLTNHTMVTFDNKLWVFGG----KTPNTLSNE--- 283

Query: 281 TDCWYLKMKSDIGAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLES 340
           T C Y  +++D     W + +  G +P      + V +K    +FGG        + +++
Sbjct: 284 TFC-YDPVQND-----WSKIQTTGERPPAVQEHASVVYKHLMCIFGG--------KDIQN 329

Query: 341 MFYNDLFTFQIETNRWY 357
            + ND++   + T +WY
Sbjct: 330 AYSNDVYFLNLITFKWY 346

 Score = 50.8 bits (120), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 65/156 (41%), Gaps = 23/156 (14%)

Query: 123 WRKISSQNSPMPR--SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLLDCN---TK 177
           W +I  +NSP PR   SA+        + + GG       +    Y DTW +  N   T 
Sbjct: 73  WNRIKLKNSPFPRYRHSASPIVTNDNRIFVTGG------LHDHLVYGDTWQITGNLDGTS 126

Query: 178 EWTKIEQ--KNGPTARSGHRLTVWKNYFILHGGFRDLGTMTTYL-SDCWLFDITTYKWKQ 234
             +K  Q  +N P  R GH  T+  N +++ GG      M   L  D +LF+I +YKW  
Sbjct: 127 FVSKTIQIGQNTPPPRVGHASTICGNAYVVFGGDTHKLNMNRLLDDDLYLFNINSYKWT- 185

Query: 235 VDFP-PNHPIPDARSGHSLV-----PTPDGAVLWGG 264
              P P    P  R GH +      P      L+GG
Sbjct: 186 --IPQPVGTRPLGRYGHKISIIANNPMQTKLFLFGG 219

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 74/189 (39%), Gaps = 35/189 (18%)

Query: 179 WTKIEQKNGPTARSGHR---LTVWKNYFILHGGFRDLGTMTTYLSDCWL----FDITTYK 231
           W +I+ KN P  R  H    +    N   + GG  D         D W      D T++ 
Sbjct: 73  WNRIKLKNSPFPRYRHSASPIVTNDNRIFVTGGLHD----HLVYGDTWQITGNLDGTSFV 128

Query: 232 WKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKSD 291
            K +    N P P  R GH+     +  V++GG         L   ++L D  YL    +
Sbjct: 129 SKTIQIGQNTPPP--RVGHASTICGNAYVVFGG-----DTHKLNMNRLLDDDLYL---FN 178

Query: 292 IGAIRWERRKKQGFQPSPRVG--CSMVHH---KGRGILFGGVFDFEETEESLESMFYNDL 346
           I + +W   +  G +P  R G   S++ +   + +  LFGG  D           ++NDL
Sbjct: 179 INSYKWTIPQPVGTRPLGRYGHKISIIANNPMQTKLFLFGGQID---------ETYFNDL 229

Query: 347 FTFQIETNR 355
             F + + R
Sbjct: 230 AMFDLSSFR 238

 Score = 36.2 bits (82), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 57/125 (45%), Gaps = 22/125 (17%)

Query: 91  ELLLFGGEXXXXXXXXXAFYNDLFTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGV--- 147
           +L +FGG+            N+ F Y    + W KI +     P    A+  H S V   
Sbjct: 268 KLWVFGGKTPN------TLSNETFCYDPVQNDWSKIQTTGERPP----AVQEHASVVYKH 317

Query: 148 -VLIHGGEFSSPKQNTFYHYSDTWLLDCNTKEWTKIEQ-KNG-PTARSGHRLTVWKN-YF 203
            + I GG+     QN + +  D + L+  T +W K+ + K G P  RSGH LT+ KN   
Sbjct: 318 LMCIFGGK---DIQNAYSN--DVYFLNLITFKWYKLPRIKEGLPKERSGHSLTLIKNDKL 372

Query: 204 ILHGG 208
           ++ GG
Sbjct: 373 VIMGG 377

>YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}
           KEL2Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 882

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 87/223 (39%), Gaps = 39/223 (17%)

Query: 123 WRKISSQNSPMPR---SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLLDCN---- 175
           W ++  +NSP PR   SS+ I  + + + +  G    S        Y D W +  N    
Sbjct: 73  WNRVKLKNSPFPRYRHSSSFIVTNDNRIFVTGGLHDQSV-------YGDVWQIAANADGT 125

Query: 176 --TKEWTKIEQKNGPTARSGHRLTVWKNYFILHGG-FRDLGTMTTYLSDCWLFDITTYKW 232
             T +   I+Q N P  R GH  T+  N +++ GG    L        D +LF+I +YKW
Sbjct: 126 SFTSKRIDIDQ-NTPPPRVGHASTICGNAYVVFGGDTHKLNKNGLLDDDLYLFNINSYKW 184

Query: 233 KQVDFPPNHPI---PDARSGHSLV-----PTPDGAVLWGGYCKVKAGKGLQKGKILTDCW 284
                P   PI   P  R GH +      P      L+GG         L    ++ D  
Sbjct: 185 T---IP--QPIGRRPLGRYGHKISIIASNPMQTKLYLFGGQVDETYFNDL----VVFDLS 235

Query: 285 YLKMKSDIGAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGG 327
             +  +      WE  +  G  P P    +MV +  +  +FGG
Sbjct: 236 SFRRPNS----HWEFLEPVGDLPPPLTNHTMVAYDNKLWVFGG 274

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 51/195 (26%), Positives = 88/195 (45%), Gaps = 30/195 (15%)

Query: 79  SSMVANPLHGKRELLLFGGEXXXXXXXXXAFYNDLFTYSLDGDQWRKISSQ--------N 130
           S + +NP+  K  L LFGG+          ++NDL  + L    +R+ +S         +
Sbjct: 203 SIIASNPMQTK--LYLFGGQVDE------TYFNDLVVFDLSS--FRRPNSHWEFLEPVGD 252

Query: 131 SPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLLDCNTKEWTKIEQK-NGPT 189
            P P ++  + A+    + + GGE  +PK  +    +DT+  D    EW+K++     P 
Sbjct: 253 LPPPLTNHTMVAY-DNKLWVFGGE--TPKTIS----NDTYRYDPAQSEWSKVKTTGEKPP 305

Query: 190 ARSGHRLTVWKNYFILHGGFRDLGTMTTYLSDCWLFDITTYKWKQVDFPPNHPIPDARSG 249
               H   V+K+   + GG +D  T   Y +D +  ++ + KW ++       IP  RSG
Sbjct: 306 PIQEHASVVYKHLMCVLGG-KD--THNAYSNDVYFLNLLSLKWYKLPRM-KEGIPQERSG 361

Query: 250 HSLVPTPDGAVLWGG 264
           HSL    +  +L  G
Sbjct: 362 HSLTLMKNEKLLIMG 376

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 77/175 (44%), Gaps = 30/175 (17%)

Query: 52  LANFKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGEXXXXXXXXXAFYN 111
           L++F+R    +E  +    D P    N +MVA       +L +FGGE            N
Sbjct: 234 LSSFRRPNSHWE-FLEPVGDLPPPLTNHTMVA----YDNKLWVFGGETPK------TISN 282

Query: 112 DLFTYSLDGDQWRKISSQNS---PMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYS- 167
           D + Y     +W K+ +      P+   ++ +  H   ++ + GG      ++T   YS 
Sbjct: 283 DTYRYDPAQSEWSKVKTTGEKPPPIQEHASVVYKH---LMCVLGG------KDTHNAYSN 333

Query: 168 DTWLLDCNTKEWTKIEQ-KNG-PTARSGHRLTVWKNYFILHGGFRDLGTMTTYLS 220
           D + L+  + +W K+ + K G P  RSGH LT+ KN  +L  G    G  T Y S
Sbjct: 334 DVYFLNLLSLKWYKLPRMKEGIPQERSGHSLTLMKNEKLLIMG----GDKTDYAS 384

>Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa]
           {ON} complement(151895..154816) [2922 nt, 974 aa]
          Length = 973

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 65/258 (25%), Positives = 99/258 (38%), Gaps = 61/258 (23%)

Query: 123 WRKISSQNSPMPRSSAAIAAHPS--GVVLIHGGEFSSPKQNTFYHYSDTWLL---DCNTK 177
           W +     SP PR     ++H S    + I GG     ++ + Y   D W +   D  + 
Sbjct: 37  WNRFKLNPSPFPRYRHVASSHASKDDTLFIIGGL----REQSVY--GDVWSINHKDDKSF 90

Query: 178 EWTKIE-QKNGPTARSGHRLTVWKNYFILHGG----FRDLGTMTTYLSDCWLFDITTYKW 232
             + IE     P  R GH  T+  N  IL GG      + G M     D +LF++ +YKW
Sbjct: 91  SASSIEITPTTPPPRVGHASTICGNALILFGGDTHKVNEDGLMD---DDLYLFNLNSYKW 147

Query: 233 KQVDFPPNHPI---PDARSGHSLV-----PTPDGAVLWGGYCKVKAGKGLQKGKILTDCW 284
                P   PI   P  R GH +      PT     L+GG                 D +
Sbjct: 148 T---IP--EPIGLRPLGRYGHKISIIATQPTKTKLFLFGGQ--------------FDDTY 188

Query: 285 YLKMKS-DIGAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESL 338
           +  +   D+   R     WE  K + F P P    +M+ +  +  +FGG        E+L
Sbjct: 189 FNDLSMFDLSTFRKPDAQWEFIKPKSFFPPPVSNHTMISYDNKLWVFGG--------ETL 240

Query: 339 ESMFYNDLFTFQIETNRW 356
           + +  N++F +    N W
Sbjct: 241 QGLI-NEVFVYDPIVNDW 257

>Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar to
           Ashbya gossypii ADL149W
          Length = 1362

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 98/250 (39%), Gaps = 44/250 (17%)

Query: 123 WRKISSQNSPMPR--SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLLDCN----- 175
           W ++    SP PR    A+  A  S  V + GG            Y DTW++  +     
Sbjct: 158 WNRVKLLQSPFPRYRHVASSYASDSNEVFVIGGLHDQSV------YGDTWIIKSHENGNK 211

Query: 176 -TKEWTKIEQKNGPTARSGHRLTVWKNYFILHGGFRDLGTMTTYL-SDCWLFDITTYKWK 233
            T +  +I +   P  R GH  T+  N F++ GG          +  D +L +I ++KW 
Sbjct: 212 FTSKTVEITETT-PPPRVGHASTLCGNAFVIFGGDTHKTNAEGLMDDDVYLLNINSHKWT 270

Query: 234 QVDFP-PNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKS-D 291
               P P  P P  R GH +      +++     K K       G    D ++  +   D
Sbjct: 271 ---IPRPVGPRPLGRYGHKI------SIIATSQMKTKL---YVFGGQFDDTYFNDLAVYD 318

Query: 292 IGAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFYNDL 346
           + + R     W+  K   F P P    +MV +  +  +FGG     +T + L     N+L
Sbjct: 319 LSSFRRPDSHWQFLKPVSFVPPPLTNHTMVSYDYKLWVFGG-----DTPQGL----INEL 369

Query: 347 FTFQIETNRW 356
           F +   TN W
Sbjct: 370 FMYDPTTNDW 379

>TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1172

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 66/272 (24%), Positives = 100/272 (36%), Gaps = 69/272 (25%)

Query: 123 WRKISSQNSPMPR---SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLLDCNT--- 176
           W +    NSP PR    ++++ +  + V +I G    S        Y DTW++  NT   
Sbjct: 55  WCRYKLHNSPFPRYRHVASSVVSSDNKVFVIGGLHDQSV-------YGDTWIISENTINI 107

Query: 177 ----------------------KEWTKIEQKNGPTARSGHRLTVWKNYFILHGGFRDLGT 214
                                  +  +I +   P  R GH  T+  N F++ GG      
Sbjct: 108 NSPATMHTPTSTTSTTSNISFSSKTVEITEY-TPPPRVGHASTLCGNAFVIFGGDTHKTN 166

Query: 215 MTTYLSD-CWLFDITTYKWKQVDFP-PNHPIPDARSGHSLVPTPDGAVLWGGYCKVKA-- 270
               + D  +LF+I +YKW     P P  P P  R GH +      +++     K K   
Sbjct: 167 KDGLMDDDIYLFNINSYKWT---IPQPVGPRPLGRYGHKI------SIIATSQMKTKLYV 217

Query: 271 -GKGLQKGKILTDCWYLKMKSDIGAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGIL 324
            G           C Y     D+ + R     WE  K + F P P    +MV +  +  +
Sbjct: 218 FGGQFDDSYFNDLCVY-----DLSSFRKPESHWEFLKPKSFIPPPLTNHTMVSYDYKLWV 272

Query: 325 FGGVFDFEETEESLESMFYNDLFTFQIETNRW 356
           FGG     +T++ L     N LF F    N W
Sbjct: 273 FGG-----DTQQGL----INQLFMFDPVINDW 295

>ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR158C (KEL1) and
           YGR238C (KEL2)
          Length = 1211

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 64/253 (25%), Positives = 104/253 (41%), Gaps = 50/253 (19%)

Query: 123 WRKISSQNSPMPR---SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLLDC--NTK 177
           W ++    +P PR    ++A A+  + V++I G    S        Y DTW+L    N K
Sbjct: 52  WDRVKLVQTPFPRYRHVASAYASDTNEVIVIGGLHDQS-------VYGDTWILRAQDNGK 104

Query: 178 EWTK--IE-QKNGPTARSGHRLTVWKNYFILHGG----FRDLGTMTTYLSDCWLFDITTY 230
           +++   IE  +  P  R GH  T+  N F++ GG      + G M     D +L ++ ++
Sbjct: 105 QFSARTIEITETTPPPRVGHAATLCGNAFVIFGGDTHKTNNEGLMD---DDVYLLNVNSH 161

Query: 231 KWKQVDFP-PNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMK 289
           KW     P P  P P  R GH +      +++     K K       G    D ++  + 
Sbjct: 162 KWT---IPHPVGPRPLGRYGHKI------SIIATSQMKTKL---YVFGGQFDDTYFNDLA 209

Query: 290 S-DIGAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFY 343
             D+ + R     W   K   F P P    +MV +  +  +FGG     +T + L     
Sbjct: 210 VYDLSSFRRPDSHWVFVKPASFVPPPLTNHTMVSYDYKLWVFGG-----DTPQGL----I 260

Query: 344 NDLFTFQIETNRW 356
           N+LF +    N W
Sbjct: 261 NELFVYDPVVNDW 273

>Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C
           (REAL)
          Length = 894

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 60/142 (42%), Gaps = 24/142 (16%)

Query: 123 WRKISSQNSPMPR--SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLLDCN----- 175
           W +I  ++SP PR   S++        + + GG +          Y D W +  N     
Sbjct: 73  WNRIKLKDSPFPRYRHSSSFITTNDNRIFVTGGLYDQSV------YGDVWEITANANGTS 126

Query: 176 -TKEWTKIEQKNGPTARSGHRLTVWKNYFILHGG-FRDLGTMTTYLSDCWLFDITTYKWK 233
            T +  +I+  N P  R GH  T+  N +++ GG    L        D +LF+I +YKW 
Sbjct: 127 FTSKRIQIDH-NTPPPRVGHASTMCGNAYVVFGGDTHKLNKNRLLDDDLYLFNINSYKWT 185

Query: 234 QVDFPPNHPI---PDARSGHSL 252
               P  HPI   P  R GH +
Sbjct: 186 ---IP--HPIGSRPLGRYGHKI 202

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 76/176 (43%), Gaps = 13/176 (7%)

Query: 91  ELLLFGGEXXXXXXXXXAFYNDLFTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLI 150
           EL LFGG+         A + DL ++      W  +   ++  P  +          + +
Sbjct: 213 ELYLFGGQIDETYFNDLAVF-DLSSFRRPNSHWEFLEPISALPPPLTNHTMVTFDNKLWV 271

Query: 151 HGGEFSSPKQNTFYHYSDTWLLDCNTKEWTKIEQK-NGPTARSGHRLTVWKNYFILHGGF 209
            GGE  +PK  +    +DT+  D     W+K+E     P     H   V+K+   + GG 
Sbjct: 272 FGGE--TPKTIS----NDTYCYDPIQNAWSKVETTGEKPPPVQEHASVVYKHLMCVFGG- 324

Query: 210 RDLGTMTTYLSDCWLFDITTYKWKQVDFPPNHPIPDARSGHSL-VPTPDGAVLWGG 264
           +D+    TY +D +  ++ + KW ++       IP  RSGHSL +   +  V+ GG
Sbjct: 325 KDIHN--TYSNDVYFLNLLSLKWFKLPCV-KEGIPQERSGHSLTLMNNEKLVIMGG 377

 Score = 35.8 bits (81), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 28/127 (22%), Positives = 51/127 (40%), Gaps = 13/127 (10%)

Query: 230 YKWKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMK 289
           Y W ++    + P P  R   S + T D  +   G        GL    +  D W +   
Sbjct: 71  YIWNRIKLK-DSPFPRYRHSSSFITTNDNRIFVTG--------GLYDQSVYGDVWEITAN 121

Query: 290 SDIGAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFYNDLFTF 349
           ++  +   +R +     P PRVG +        ++FGG  D  +  ++   +  +DL+ F
Sbjct: 122 ANGTSFTSKRIQIDHNTPPPRVGHASTMCGNAYVVFGG--DTHKLNKN--RLLDDDLYLF 177

Query: 350 QIETNRW 356
            I + +W
Sbjct: 178 NINSYKW 184

>Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON}
           YGR238C (REAL)
          Length = 883

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 55/223 (24%), Positives = 89/223 (39%), Gaps = 39/223 (17%)

Query: 123 WRKISSQNSPMPR---SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLLDCN---- 175
           W +I  ++SP PR   SS+ I +     + + GG ++         Y D W +  N    
Sbjct: 71  WNRIKLKDSPFPRYRHSSSPIVSS-ENRIFVTGGLYNQSV------YGDVWQITANADGT 123

Query: 176 --TKEWTKIEQKNGPTARSGHRLTVWKNYFILHGG-FRDLGTMTTYLSDCWLFDITTYKW 232
             T +  +I+ +N P  R GH  T+  N +++ GG    L        D +LF++ +YKW
Sbjct: 124 SFTPKAIQID-RNTPPPRVGHASTLCGNAYVVFGGDTHKLNEDKLLDDDIYLFNVNSYKW 182

Query: 233 KQVDFPPNHPI---PDARSGHSLV-----PTPDGAVLWGGYCKVKAGKGLQKGKILTDCW 284
                P   PI   P  R GH +      P      L+GG    +  K       + D  
Sbjct: 183 T---IP--QPIGSRPLGRYGHKISIIAYNPMQTKLYLFGG----QLDKTYFNDLAMFDLS 233

Query: 285 YLKMKSDIGAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGG 327
             + ++      WE  +     P P    +MV +  +  +FGG
Sbjct: 234 SFRRRNS----HWEFLEPATTVPPPLANHTMVTYGNKLWVFGG 272

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 74/163 (45%), Gaps = 26/163 (15%)

Query: 52  LANFKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGEXXXXXXXXXAFYN 111
           L++F+R    +E +  +T   P    N +MV    +G + L +FGGE            N
Sbjct: 232 LSSFRRRNSHWEFLEPATT-VPPPLANHTMVT---YGNK-LWVFGGETPK------TVSN 280

Query: 112 DLFTYSLDGDQWRKISSQNS---PMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYS- 167
           + + Y    + W KI +      P+   ++ +  H   ++ + GG++      T   YS 
Sbjct: 281 ETYCYDPIQNDWSKIETTGEIPPPVQEHASVVYKH---IMCVFGGKY------THNAYSN 331

Query: 168 DTWLLDCNTKEWTKIEQ-KNG-PTARSGHRLTVWKNYFILHGG 208
           D + LD  + +W K+   K G P  RSGH LT+ KN  IL  G
Sbjct: 332 DVYFLDLLSFKWYKLPHIKEGIPRERSGHSLTLMKNEKILIMG 374

>YOL141W Chr15 (56452..58539) [2088 bp, 695 aa] {ON}
           PPM2AdoMet-dependent tRNA methyltransferase also
           involved in methoxycarbonylation; required for the
           synthesis of wybutosine (yW), a modified guanosine found
           at the 3'-position adjacent to the anticodon of
           phe-tRNA; similarity to Ppm1p
          Length = 695

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 39/95 (41%), Gaps = 17/95 (17%)

Query: 179 WTKIEQKN-------GPTARSGHRLTVW--KNYFILHGGFRDLGTMTTYLSDCWLFDITT 229
           + KI+ KN        P AR  H  T     N  +L GG +        LSD W+FD+ T
Sbjct: 421 YDKIDMKNIEVSSSEVPVARMCHTFTTISRNNQLLLIGGRK---APHQGLSDNWIFDMKT 477

Query: 230 YKWKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGG 264
            +W  +       +   R  HS    PDG VL  G
Sbjct: 478 REWSMI-----KSLSHTRFRHSACSLPDGNVLILG 507

>TBLA0A04320 Chr1 (1068199..1070715) [2517 bp, 838 aa] {ON} Anc_7.9
           YAL056W
          Length = 838

 Score = 35.0 bits (79), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 39/100 (39%), Gaps = 10/100 (10%)

Query: 171 LLDCNTKEWTKIEQKNGPTARSGHRLTVWKNYFILHGGFRDLGTMTTYLSDCWLFDITTY 230
           L    + + TK    +GP  +     T   +  ++HGG       T   SD W FD  T 
Sbjct: 627 LFPIGSPKSTKSNGPSGPVLQLHINETSEGHTLVMHGG----SNATHIYSDMWWFDFETE 682

Query: 231 KWKQVDFPPNH------PIPDARSGHSLVPTPDGAVLWGG 264
            W Q++           PI  A +GHS+      ++  GG
Sbjct: 683 SWVQIETQAQTEDKGLVPIEMALAGHSMATVGSASIFVGG 722

>ZYRO0C00550g Chr3 (39312..41858) [2547 bp, 848 aa] {ON} similar to
           uniprot|Q08886 Saccharomyces cerevisiae YOR371C GPB1
           Proposed beta subunit of the heterotrimeric G protein
           that interacts with the receptor Grp1p has signaling
           role in response to nutrients involved in regulation of
           pseudohyphal growth through cAMP levels homolog of Gpb2p
          Length = 848

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 28/71 (39%), Gaps = 10/71 (14%)

Query: 203 FILHGGFRDLGTMTTYLSDCWLFDITTYKWKQVDFPPNH------PIPDARSGHSLVPTP 256
            I+HGG       T    D W +DI T  W Q+     H      PI     GHSLV   
Sbjct: 671 LIMHGG----SNKTDVCRDMWWYDIETETWSQITTHGKHEASKMIPIGVGLVGHSLVCVG 726

Query: 257 DGAVLWGGYCK 267
             AV  GG  +
Sbjct: 727 GMAVFVGGLLQ 737

>NCAS0A07640 Chr1 complement(1521774..1524515) [2742 bp, 913 aa]
           {ON} Anc_7.9 YAL056W
          Length = 913

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 35/86 (40%), Gaps = 17/86 (19%)

Query: 147 VVLIHGGEFSSPKQNTFYHYSDTWLLDCNTKEWTKIEQ-----------KNGPTARSGHR 195
           +++IHGG       N    Y D W  D   ++WTKI+             N   A  GH 
Sbjct: 728 MIIIHGG------SNDHKVYGDMWWFDVEMEKWTKIDMYAETNDAKEGLVNCDLALVGHT 781

Query: 196 LTVWKNYFILHGGFRDLGTMTTYLSD 221
           + +  +Y I  GG       T ++S+
Sbjct: 782 MAIIGHYAISVGGLIQQDVDTLFISE 807

>ZYRO0C03344g Chr3 complement(259809..261785) [1977 bp, 658 aa] {ON}
           similar to similar to uniprot|Q08282 YOL141w
           Saccharomyces cerevisiae PPM2 Putative carboxyl methyl
           transferase
          Length = 658

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 42/94 (44%), Gaps = 13/94 (13%)

Query: 89  KRELLLFGGEXXXXXXXXXAFYNDLFTYSLDGD-QWRKISSQNSPMPRSSAAIAAHPSGV 147
           K++LL FGG             N++ +   DGD +        +P+ R+        +  
Sbjct: 372 KKQLLYFGGSCPQRT-------NEIISIGPDGDCEAVPFDKTTAPVARACHTFTLVNNDT 424

Query: 148 VLIHGGEFSSPKQNTFYHYSDTWLLDCNTKEWTK 181
            ++ GG     ++N +   SDTW+ + ++ EWT+
Sbjct: 425 AMVVGG-----RRNPWQPLSDTWMFNLSSHEWTR 453

>Kwal_55.20756 s55 (545793..550520) [4728 bp, 1575 aa] {ON} YGL197W
           (MDS3) - 1:1 [contig 139] FULL
          Length = 1575

 Score = 32.0 bits (71), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 310 RVGCSMVHHKGRGILFGGVFDFEETEESLESMFYNDLFTFQIETNRWYSASLRP 363
           RV  SM  H GR  LFGG+    +++  L  +  N+L++  +ET  W   S  P
Sbjct: 138 RVFHSMCFHDGRLYLFGGLVVSPQSDYEL--IASNELWSLDLETKTWLQLSSDP 189

>CAGL0K02101g Chr11 (182946..187847) [4902 bp, 1633 aa] {ON} similar
           to uniprot|P32634 Saccharomyces cerevisiae YER132c PMD1
           or uniprot|P53094 Saccharomyces cerevisiae YGL197w MDS3
          Length = 1633

 Score = 32.0 bits (71), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 42/96 (43%), Gaps = 11/96 (11%)

Query: 146 GVVLIHGGEFSSP-KQNTFYHYSDTWLLDCNTKEWTKIEQKNGPTARSGHRLTVWKN--- 201
           G + I GG   SP  +  F   +D W LD    +W+ + +  G   R  H + V  +   
Sbjct: 170 GFLYIFGGLMISPHNEYEFVATNDLWQLDLRGNKWSLLSKDPGVGRRYNHEMHVLNSEDP 229

Query: 202 ----YFILHGGFRDLGTMTTYLSDCWLFDITTYKWK 233
                 ++ GG   +  M   ++   +F++TT +W+
Sbjct: 230 TKDTKLVIVGG---IDNMDEPVAKIDIFNLTTLQWE 262

>Kpol_1014.25 s1014 complement(42216..44105) [1890 bp, 629 aa] {ON}
           complement(42216..44105) [1890 nt, 630 aa]
          Length = 629

 Score = 31.6 bits (70), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 38/87 (43%), Gaps = 5/87 (5%)

Query: 125 KISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLLDCNTKEWTKIEQ 184
           KI + ++P+ R    ++      ++  GG   +P Q     + + W LD +TK+W+K  Q
Sbjct: 371 KIDTTDTPIGRMCHTLSRISESEIISIGGR-KAPGQG----FDECWKLDLSTKQWSKGAQ 425

Query: 185 KNGPTARSGHRLTVWKNYFILHGGFRD 211
            N    R    +   +N  I  G   D
Sbjct: 426 LNAKRYRHSAFMVDDENVLICGGDTTD 452

>YDL074C Chr4 complement(324047..326149) [2103 bp, 700 aa] {ON}
           BRE1E3 ubiquitin ligase, forms heterodimer with Rad6p to
           monoubiquinate histone H2B-K123, which is required for
           the subsequent methylation of histone H3-K4 and H3-K79;
           required for DSBR, transcription, silencing, and
           checkpoint control
          Length = 700

 Score = 31.6 bits (70), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 25/45 (55%)

Query: 172 LDCNTKEWTKIEQKNGPTARSGHRLTVWKNYFILHGGFRDLGTMT 216
           +D   ++WTKI+Q++  T  S  +  + K    L  GFR+L  +T
Sbjct: 415 IDILKEQWTKIDQRSNDTKSSSTQDALIKEIQDLEKGFRELSDLT 459

>Smik_7.75 Chr7 (119160..123611) [4452 bp, 1483 aa] {ON} YGL197W
           (REAL)
          Length = 1483

 Score = 31.6 bits (70), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 53/142 (37%), Gaps = 18/142 (12%)

Query: 116 YSLDGDQ------WRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQN-TFYHYSD 168
           + LD D        RK  S  SP+         +  G + I GG   SP+        ++
Sbjct: 134 FKLDADTSDVQVDIRKAKSLESPLKERLFHSLCYLDGCLYIFGGLTVSPQSGYELIAANE 193

Query: 169 TWLLDCNTKEWTKIEQKNGPTARSGHRLTVWK-------NYFILHGGFRDLGTMTTYLSD 221
            W LD NTK+W+ +        R  H + V            I+ GG   L  M   +  
Sbjct: 194 LWKLDLNTKKWSLLSDDPQIARRFNHTMHVKNENNDNRDTKLIIVGG---LNNMDQPVKK 250

Query: 222 CWLFDITTYKWKQVDFPPNHPI 243
             +++IT   W Q +  P  P+
Sbjct: 251 IDIYNITQNCW-QAETIPKQPM 271

>NCAS0B05440 Chr2 (1017388..1022040) [4653 bp, 1550 aa] {ON} 
          Length = 1550

 Score = 31.6 bits (70), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 50/117 (42%), Gaps = 16/117 (13%)

Query: 148 VLIHGGEFSSPKQN-TFYHYSDTWLLDCNTKEWTKIEQKNGPTARSGHRLTVWK------ 200
           + I GG   SP+        ++ W L+  TK WT I +    T R  H + +        
Sbjct: 192 LYIFGGLIVSPQSGYELIATNELWRLNLKTKVWTLISKDPRITRRFNHNMHIKNENNDTR 251

Query: 201 -NYFILHGGFRDLGTMTTYLSDCWLFDITTYKWKQVDFPPNHPIPDARS---GHSLV 253
               I+ GG  +L    +++    ++++T   WK  D  P  P+ DAR+   GH + 
Sbjct: 252 DTKLIIIGGLNNLDQPVSHID---VYNLTQNCWK-ADSIPKDPL-DARTNVDGHEIT 303

>KAFR0I02910 Chr9 complement(582726..584801) [2076 bp, 691 aa] {ON}
           Anc_3.15 YOL141W
          Length = 691

 Score = 31.2 bits (69), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 30/136 (22%), Positives = 58/136 (42%), Gaps = 20/136 (14%)

Query: 133 MPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLLDCNTKEWTKIEQKNG-PTAR 191
           + R+  +   H  G ++  GG   +P +      SDT  +D     + +++  +  P AR
Sbjct: 390 LKRNFGSSIKHDEGNIMYTGG--CNPNR-----ISDTLKIDTQKNTFIQLQNHSVLPPAR 442

Query: 192 SGH---RLTVWKNYFILHGGFRDLGTMTTYLSDCWLFDITTYKWKQVDFPPNHPIPDARS 248
           + H   RL   +   ++ G           ++DCW +++ T +W++        +P+ R 
Sbjct: 443 ACHTFTRLGDGETAMVIGGR----NAPHRAVNDCWFYNLNTNEWQK-----GPELPEPRF 493

Query: 249 GHSLVPTPDGAVLWGG 264
            HS V T    +L  G
Sbjct: 494 RHSCVATDKNTLLVCG 509

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.428 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,336,690
Number of extensions: 2473876
Number of successful extensions: 7944
Number of sequences better than 10.0: 70
Number of HSP's gapped: 7774
Number of HSP's successfully gapped: 110
Length of query: 636
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 520
Effective length of database: 40,180,143
Effective search space: 20893674360
Effective search space used: 20893674360
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)