Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E00858gsingletonON84784745110.0
KLLA0E14631gsingletonON84584731800.0
Smik_26.6singletonON84584530120.0
KLLA0D00330gsingletonON76575428120.0
KLLA0E25081gsingletonON63063023800.0
YMR239C (RNT1)8.779ON47194781.2
KAFR0H030301.431ON24753751.6
Skud_13.4108.779ON47494743.4
KAFR0D006101.66ON817146743.7
Suva_13.4248.779ON46994733.9
Smik_13.4518.779ON47294734.6
TDEL0F005401.506ON1032111718.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E00858g
         (847 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E00858g Chr5 (63985..66528) [2544 bp, 847 aa] {ON} conserve...  1742   0.0  
KLLA0E14631g Chr5 complement(1304707..1307244) [2538 bp, 845 aa]...  1229   0.0  
Smik_26.6 Chr26 complement(3482..6019) [2538 bp, 845 aa] {ON} YA...  1164   0.0  
KLLA0D00330g Chr4 complement(26976..29273) [2298 bp, 765 aa] {ON...  1087   0.0  
KLLA0E25081g Chr5 (2222708..2224600) [1893 bp, 630 aa] {ON} simi...   921   0.0  
YMR239C Chr13 complement(748262..749677) [1416 bp, 471 aa] {ON} ...    35   1.2  
KAFR0H03030 Chr8 (579798..580541) [744 bp, 247 aa] {ON} Anc_1.43...    33   1.6  
Skud_13.410 Chr13 complement(723047..724471) [1425 bp, 474 aa] {...    33   3.4  
KAFR0D00610 Chr4 (99088..101541) [2454 bp, 817 aa] {ON} Anc_1.66...    33   3.7  
Suva_13.424 Chr13 complement(729834..731243) [1410 bp, 469 aa] {...    33   3.9  
Smik_13.451 Chr13 complement(732656..734074) [1419 bp, 472 aa] {...    33   4.6  
TDEL0F00540 Chr6 complement(90867..93965) [3099 bp, 1032 aa] {ON...    32   8.3  

>SAKL0E00858g Chr5 (63985..66528) [2544 bp, 847 aa] {ON} conserved
           hypothetical protein
          Length = 847

 Score = 1742 bits (4511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 847/847 (100%), Positives = 847/847 (100%)

Query: 1   MSTFNVDQVLQELTLAEKISLIAAVDFWHTAPIERLGIPSIRVSDGPNGVRGTKFFDSVP 60
           MSTFNVDQVLQELTLAEKISLIAAVDFWHTAPIERLGIPSIRVSDGPNGVRGTKFFDSVP
Sbjct: 1   MSTFNVDQVLQELTLAEKISLIAAVDFWHTAPIERLGIPSIRVSDGPNGVRGTKFFDSVP 60

Query: 61  SAAFPNGTGLAATFNKELLEKAGELMGREAIHKNAAVILGPTTNMQRGPLGGRGFESFSE 120
           SAAFPNGTGLAATFNKELLEKAGELMGREAIHKNAAVILGPTTNMQRGPLGGRGFESFSE
Sbjct: 61  SAAFPNGTGLAATFNKELLEKAGELMGREAIHKNAAVILGPTTNMQRGPLGGRGFESFSE 120

Query: 121 DPYLAGVATSSVVNGIQSQGIAATVKHFVCNDLEDQRFSSNSIVTERALREIYLEPFRLA 180
           DPYLAGVATSSVVNGIQSQGIAATVKHFVCNDLEDQRFSSNSIVTERALREIYLEPFRLA
Sbjct: 121 DPYLAGVATSSVVNGIQSQGIAATVKHFVCNDLEDQRFSSNSIVTERALREIYLEPFRLA 180

Query: 181 VRDSNPQCFMTAYSKVNDVHCSQNKKLLQDVLRGEWSWDGMVMSDWFGTYSSAEAIKNGL 240
           VRDSNPQCFMTAYSKVNDVHCSQNKKLLQDVLRGEWSWDGMVMSDWFGTYSSAEAIKNGL
Sbjct: 181 VRDSNPQCFMTAYSKVNDVHCSQNKKLLQDVLRGEWSWDGMVMSDWFGTYSSAEAIKNGL 240

Query: 241 DIEFPGPTRWRKGDLISHLVNSKEAITEHDVDHRARNVLKLVKFFLENKDKTGIQENGPE 300
           DIEFPGPTRWRKGDLISHLVNSKEAITEHDVDHRARNVLKLVKFFLENKDKTGIQENGPE
Sbjct: 241 DIEFPGPTRWRKGDLISHLVNSKEAITEHDVDHRARNVLKLVKFFLENKDKTGIQENGPE 300

Query: 301 DTKNNTPETSKALRWFASESIVLLKNNGNILPLKKEESVVVIGPNAKAQAYSGGGSASLN 360
           DTKNNTPETSKALRWFASESIVLLKNNGNILPLKKEESVVVIGPNAKAQAYSGGGSASLN
Sbjct: 301 DTKNNTPETSKALRWFASESIVLLKNNGNILPLKKEESVVVIGPNAKAQAYSGGGSASLN 360

Query: 361 PYYVVSPYEGIKQKTGKDVEYTVGCQSHKSLSNLVEQLILDTSKPVEDGNVGVLAKFYAQ 420
           PYYVVSPYEGIKQKTGKDVEYTVGCQSHKSLSNLVEQLILDTSKPVEDGNVGVLAKFYAQ
Sbjct: 361 PYYVVSPYEGIKQKTGKDVEYTVGCQSHKSLSNLVEQLILDTSKPVEDGNVGVLAKFYAQ 420

Query: 421 PAELRNSDTEPFDEKVVTKSFITLFDYRNDSVDPKNPIFYVDFEGFYIPDETTDYIVGVQ 480
           PAELRNSDTEPFDEKVVTKSFITLFDYRNDSVDPKNPIFYVDFEGFYIPDETTDYIVGVQ
Sbjct: 421 PAELRNSDTEPFDEKVVTKSFITLFDYRNDSVDPKNPIFYVDFEGFYIPDETTDYIVGVQ 480

Query: 481 VFGTAVLYVDGKLVVDNKTNQRKGTFCFSSGTVEETAVLSLKRGQVYRFKVEYGSGPTSK 540
           VFGTAVLYVDGKLVVDNKTNQRKGTFCFSSGTVEETAVLSLKRGQVYRFKVEYGSGPTSK
Sbjct: 481 VFGTAVLYVDGKLVVDNKTNQRKGTFCFSSGTVEETAVLSLKRGQVYRFKVEYGSGPTSK 540

Query: 541 FGEDFGAGGLQIGISKVIDEDAEIQNAAELAKKHEKVVLCIGLNGEWESEGYDRRDMTLP 600
           FGEDFGAGGLQIGISKVIDEDAEIQNAAELAKKHEKVVLCIGLNGEWESEGYDRRDMTLP
Sbjct: 541 FGEDFGAGGLQIGISKVIDEDAEIQNAAELAKKHEKVVLCIGLNGEWESEGYDRRDMTLP 600

Query: 601 RRTDDLVRAVLEANPNTIVVNQSGTPVEMPWVSKCNALIHCWYGGNELGNAIADVLYGDF 660
           RRTDDLVRAVLEANPNTIVVNQSGTPVEMPWVSKCNALIHCWYGGNELGNAIADVLYGDF
Sbjct: 601 RRTDDLVRAVLEANPNTIVVNQSGTPVEMPWVSKCNALIHCWYGGNELGNAIADVLYGDF 660

Query: 661 VPSGKLSLSWPFKLQDNPAYLTFSTEGGRVLYGEDIYVGYRYFEKLQRQVAFPFGYGLSY 720
           VPSGKLSLSWPFKLQDNPAYLTFSTEGGRVLYGEDIYVGYRYFEKLQRQVAFPFGYGLSY
Sbjct: 661 VPSGKLSLSWPFKLQDNPAYLTFSTEGGRVLYGEDIYVGYRYFEKLQRQVAFPFGYGLSY 720

Query: 721 TEFKLENLQTSVDFSKGNLEVSVDAANIGDNYAGSEVVQVYIASTESKIGRPVKELKGFD 780
           TEFKLENLQTSVDFSKGNLEVSVDAANIGDNYAGSEVVQVYIASTESKIGRPVKELKGFD
Sbjct: 721 TEFKLENLQTSVDFSKGNLEVSVDAANIGDNYAGSEVVQVYIASTESKIGRPVKELKGFD 780

Query: 781 KVYLQPGEKKTVKLNLVLKDSISFFDEYENKWCAEAGKYKVLVGTSSDDIELIGDFTVEK 840
           KVYLQPGEKKTVKLNLVLKDSISFFDEYENKWCAEAGKYKVLVGTSSDDIELIGDFTVEK
Sbjct: 781 KVYLQPGEKKTVKLNLVLKDSISFFDEYENKWCAEAGKYKVLVGTSSDDIELIGDFTVEK 840

Query: 841 TTFWNGL 847
           TTFWNGL
Sbjct: 841 TTFWNGL 847

>KLLA0E14631g Chr5 complement(1304707..1307244) [2538 bp, 845 aa]
           {ON} highly similar to uniprot|P07337 Kluyveromyces
           marxianus Beta-glucosidase precursor
          Length = 845

 Score = 1229 bits (3180), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 575/847 (67%), Positives = 704/847 (83%), Gaps = 2/847 (0%)

Query: 1   MSTFNVDQVLQELTLAEKISLIAAVDFWHTAPIERLGIPSIRVSDGPNGVRGTKFFDSVP 60
           MS F+++Q L ELT  EKISL++AVDFWHT  IERLGIPS+RVSDGPNG+RGT+FFDSVP
Sbjct: 1   MSNFDIEQTLSELTRDEKISLLSAVDFWHTKEIERLGIPSVRVSDGPNGIRGTRFFDSVP 60

Query: 61  SAAFPNGTGLAATFNKELLEKAGELMGREAIHKNAAVILGPTTNMQRGPLGGRGFESFSE 120
           S  FPNGTGLA+TF+ ELL++AG+LM +EA+ KNAAVILGPTTNMQRGPLGGRGFESFSE
Sbjct: 61  SGCFPNGTGLASTFDDELLKEAGKLMAKEAVAKNAAVILGPTTNMQRGPLGGRGFESFSE 120

Query: 121 DPYLAGVATSSVVNGIQSQGIAATVKHFVCNDLEDQRFSSNSIVTERALREIYLEPFRLA 180
           DPYLAGVATSSVV G+QS+GIAATVKHFVCNDLEDQRF+SNSI++ERALREIYLEPFRLA
Sbjct: 121 DPYLAGVATSSVVQGMQSEGIAATVKHFVCNDLEDQRFASNSILSERALREIYLEPFRLA 180

Query: 181 VRDSNPQCFMTAYSKVNDVHCSQNKKLLQDVLRGEWSWDGMVMSDWFGTYSSAEAIKNGL 240
           +++++P C MTAY+KVN  HCSQNKKLL D+LR EW+WDGM+MSDW+GTY++A +IKNGL
Sbjct: 181 IKNADPVCLMTAYNKVNGEHCSQNKKLLLDILRKEWNWDGMIMSDWYGTYTTAASIKNGL 240

Query: 241 DIEFPGPTRWRKGDLISHLVNSKEAITEHDVDHRARNVLKLVKFFLENKDKTGIQENGPE 300
           DIEFPGPTRWR  +L+SH +NSKE I+ +DVD R R VLK++KF ++N++KTGI +NGPE
Sbjct: 241 DIEFPGPTRWRTNELVSHSLNSKEQISIYDVDDRVRQVLKMIKFVVDNQEKTGIVQNGPE 300

Query: 301 DTKNNTPETSKALRWFASESIVLLKNNGNILPLKKEESVVVIGPNAKAQAYSGGGSASLN 360
            T NNT ETS+ LR  A++SIVLLKN  +ILPLKKEES+VVIGPNAKA+A SGGGSAS+N
Sbjct: 301 TTSNNTKETSELLRKIAADSIVLLKNENSILPLKKEESIVVIGPNAKAKASSGGGSASVN 360

Query: 361 PYYVVSPYEGIKQKTGKDVEYTVGCQSHKSLSNLVEQLILDTSKPVEDGNVGVLAKFYAQ 420
            YYV+SPYEGI +K GK+V YT+G +SHK+LSNL+EQL++D SKP E  N G    FY++
Sbjct: 361 SYYVISPYEGIVKKVGKEVPYTIGAESHKTLSNLIEQLVVDPSKPAEGDNAGATGSFYSE 420

Query: 421 PAELRNSDTEPFDEKVVTKSFITLFDYRNDSVDPKNPIFYVDFEGFYIPDETTDYIVGVQ 480
           P E R  D  PF       SF  LFD++++ +D  NPIFY+  EG++ P+E  DYI G+Q
Sbjct: 421 PVEKRAKDESPFHVATFKHSFNLLFDFKHEKIDTTNPIFYITLEGYFTPEEDADYIFGLQ 480

Query: 481 VFGTAVLYVDGKLVVDNKTNQRKGTFCFSSGTVEETAVLSLKRGQVYRFKVEYGSGPTSK 540
           VFGT VLY+D +L++D +  Q  G FCF +GT+E+T  ++L++G+ Y+ ++EYGSGPTS+
Sbjct: 481 VFGTGVLYLDDELLIDQRKGQVSGDFCFGAGTIEKTKTVTLQKGKAYKVRIEYGSGPTSE 540

Query: 541 FGEDFGAGGLQIGISKVIDEDAEIQNAAELAKKHEKVVLCIGLNGEWESEGYDRRDMTLP 600
              +FG+G LQ+G++K ID D EI+ AA+LA  H+K +LCIGLN EWESEG+DR DMTLP
Sbjct: 541 LVSEFGSGALQVGVTKAIDADEEIKKAAKLAAAHDKAILCIGLNAEWESEGHDREDMTLP 600

Query: 601 RRTDDLVRAVLEANPNTIVVNQSGTPVEMPWVSKCNALIHCWYGGNELGNAIADVLYGDF 660
            RT+DLVRAVLEANPNT++VNQSGTPVE PW+ K NAL+  WYGGNELGNAIADVLYGD 
Sbjct: 601 ARTNDLVRAVLEANPNTVIVNQSGTPVEFPWLQKANALVQAWYGGNELGNAIADVLYGDV 660

Query: 661 VPSGKLSLSWPFKLQDNPAYLTFSTEGGRVLYGEDIYVGYRYFEKLQRQVAFPFGYGLSY 720
           VP+GKLSLSWP KL+DNPAYL F TE GRV+YGEDI++GYR++EKLQ++VAFPFGYGLSY
Sbjct: 661 VPNGKLSLSWPLKLEDNPAYLNFKTEFGRVVYGEDIFIGYRFYEKLQKRVAFPFGYGLSY 720

Query: 721 TEFKLENLQTSVDFSKGNLEVSVDAANIGDNYAGSEVVQVYIASTESKIGRPVKELKGFD 780
           TEF L NLQ  V  +   + VSVD  N G+ YAGSEVVQVYIA+TES + R VKELKGF 
Sbjct: 721 TEFALSNLQ--VQINDEVISVSVDVKNTGEKYAGSEVVQVYIAATESSVSRAVKELKGFK 778

Query: 781 KVYLQPGEKKTVKLNLVLKDSISFFDEYENKWCAEAGKYKVLVGTSSDDIELIGDFTVEK 840
           KV LQPG+ +T K++LVLKDS+SFFDE   KWC+EAG+YKVLVGTSSDDI L   F VEK
Sbjct: 779 KVLLQPGQTETAKIDLVLKDSVSFFDEEVGKWCSEAGQYKVLVGTSSDDIVLSESFDVEK 838

Query: 841 TTFWNGL 847
           T++W+GL
Sbjct: 839 TSYWSGL 845

>Smik_26.6 Chr26 complement(3482..6019) [2538 bp, 845 aa] {ON}
           YALI0F01672g (REAL)
          Length = 845

 Score = 1164 bits (3012), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/845 (64%), Positives = 671/845 (79%), Gaps = 1/845 (0%)

Query: 3   TFNVDQVLQELTLAEKISLIAAVDFWHTAPIERLGIPSIRVSDGPNGVRGTKFFDSVPSA 62
           TF++++VL ELT  EKISLIAA DFWHT PI+RL IPS+RVSDGPNG+RGTKFF+SVPSA
Sbjct: 2   TFDIEKVLSELTTNEKISLIAAEDFWHTTPIKRLDIPSVRVSDGPNGIRGTKFFNSVPSA 61

Query: 63  AFPNGTGLAATFNKELLEKAGELMGREAIHKNAAVILGPTTNMQRGPLGGRGFESFSEDP 122
           AFPNGT LA+TF+KELL++ G  M  EAI KNA VILGPT N+QRGPLGGRGFESFSE P
Sbjct: 62  AFPNGTALASTFDKELLKEVGARMADEAIQKNAGVILGPTINIQRGPLGGRGFESFSEVP 121

Query: 123 YLAGVATSSVVNGIQSQGIAATVKHFVCNDLEDQRFSSNSIVTERALREIYLEPFRLAVR 182
           YL+G+A S +VNGIQS+G+AAT+KHFVCNDLEDQR SSNSIVT RALREIYLEPF+LAV+
Sbjct: 122 YLSGIAASCIVNGIQSRGVAATLKHFVCNDLEDQRMSSNSIVTCRALREIYLEPFKLAVK 181

Query: 183 DSNPQCFMTAYSKVNDVHCSQNKKLLQDVLRGEWSWDGMVMSDWFGTYSSAEAIKNGLDI 242
            S+PQC MT+Y+KVN VHCS +K LL D+LR EW W GMVMSDWFGTYS  ++IKNGLDI
Sbjct: 182 YSDPQCIMTSYNKVNGVHCSNSKNLLIDILRDEWKWGGMVMSDWFGTYS-VDSIKNGLDI 240

Query: 243 EFPGPTRWRKGDLISHLVNSKEAITEHDVDHRARNVLKLVKFFLENKDKTGIQENGPEDT 302
           EFPGP++WR  DL+   ++SK  IT  ++D   R+VLKLV +  EN  KT I+++GPE T
Sbjct: 241 EFPGPSKWRSLDLLKSNLDSKAGITISNIDDCVRHVLKLVHYVSENSKKTQIKDHGPETT 300

Query: 303 KNNTPETSKALRWFASESIVLLKNNGNILPLKKEESVVVIGPNAKAQAYSGGGSASLNPY 362
            NNT   SK LR  ASESIVLLKN  +ILPLKKE SVVVIGPNAKA++YSGGGSASL PY
Sbjct: 301 LNNTEHMSKHLRKVASESIVLLKNVDDILPLKKESSVVVIGPNAKAKSYSGGGSASLQPY 360

Query: 363 YVVSPYEGIKQKTGKDVEYTVGCQSHKSLSNLVEQLILDTSKPVEDGNVGVLAKFYAQPA 422
           YV++PYEGI +K G++VEYT GC S K+LS L+E +++D  +P E  N+G++A+++  PA
Sbjct: 361 YVITPYEGICEKIGRNVEYTAGCDSRKTLSGLIEAMVVDPCQPAEGDNIGIIAQYFMDPA 420

Query: 423 ELRNSDTEPFDEKVVTKSFITLFDYRNDSVDPKNPIFYVDFEGFYIPDETTDYIVGVQVF 482
             R++D EPFD   VT+S++TLFDY + ++DP  P FY+ FEGF+ P+E  +YI GVQVF
Sbjct: 421 NQRSADVEPFDTHRVTQSYVTLFDYTHPNIDPIMPFFYIHFEGFFTPEEDGEYIFGVQVF 480

Query: 483 GTAVLYVDGKLVVDNKTNQRKGTFCFSSGTVEETAVLSLKRGQVYRFKVEYGSGPTSKFG 542
           GTA+ Y+D KL +DNKT+Q KG+FCF +GT EET    L +G  YR ++EYGSGPTS   
Sbjct: 481 GTALFYIDDKLEIDNKTHQTKGSFCFGAGTREETCEKYLVKGHQYRIRIEYGSGPTSSVA 540

Query: 543 EDFGAGGLQIGISKVIDEDAEIQNAAELAKKHEKVVLCIGLNGEWESEGYDRRDMTLPRR 602
            DFG GG+Q+G +K ++ D EI  A +LAK ++ V+LCIGLNGEWESEGYDR +M+LP+ 
Sbjct: 541 ADFGYGGIQVGFAKKLNADEEIARAVQLAKTNDNVILCIGLNGEWESEGYDRENMSLPKN 600

Query: 603 TDDLVRAVLEANPNTIVVNQSGTPVEMPWVSKCNALIHCWYGGNELGNAIADVLYGDFVP 662
            D L+ AVL ANPNTIVVNQSG PVE+PWV +C AL+ CWYGGNELGNAIADVLYGD VP
Sbjct: 601 NDRLISAVLTANPNTIVVNQSGMPVELPWVDQCKALLQCWYGGNELGNAIADVLYGDVVP 660

Query: 663 SGKLSLSWPFKLQDNPAYLTFSTEGGRVLYGEDIYVGYRYFEKLQRQVAFPFGYGLSYTE 722
           SGKLS+SWP+   DNPA+L F TE GRVLYGEDIYVGYR++EK++RQVAFPFG+GLSYT 
Sbjct: 661 SGKLSISWPYMCHDNPAFLNFKTESGRVLYGEDIYVGYRFYEKVRRQVAFPFGHGLSYTT 720

Query: 723 FKLENLQTSVDFSKGNLEVSVDAANIGDNYAGSEVVQVYIASTESKIGRPVKELKGFDKV 782
           F+ ++L  S+D +   LE S++  N GD  AG EV+QVY++  ES IGRP+KELKGF KV
Sbjct: 721 FRFDDLIVSIDETLDLLETSLNVTNTGDTIAGKEVIQVYVSHNESTIGRPIKELKGFQKV 780

Query: 783 YLQPGEKKTVKLNLVLKDSISFFDEYENKWCAEAGKYKVLVGTSSDDIELIGDFTVEKTT 842
           +L+P E K V + L LKDSIS+FDE +  WCA  G Y++LVG+SS DI+L   F V KT+
Sbjct: 781 FLKPNETKKVTMKLSLKDSISYFDEEKQLWCATEGIYQILVGSSSKDIKLTERFDVNKTS 840

Query: 843 FWNGL 847
           +W GL
Sbjct: 841 YWKGL 845

>KLLA0D00330g Chr4 complement(26976..29273) [2298 bp, 765 aa] {ON}
           similar to uniprot|P07337 Kluyveromyces marxianus Beta-
           glucosidase precursor
          Length = 765

 Score = 1087 bits (2812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/754 (66%), Positives = 618/754 (81%), Gaps = 2/754 (0%)

Query: 1   MSTFNVDQVLQELTLAEKISLIAAVDFWHTAPIERLGIPSIRVSDGPNGVRGTKFFDSVP 60
           MS F+V+Q L ELT  EKISL++A DFWHT  IERLGIPS+RVSDGPNG+RGT+FFDSVP
Sbjct: 3   MSKFDVEQKLSELTRDEKISLLSATDFWHTKEIERLGIPSVRVSDGPNGIRGTRFFDSVP 62

Query: 61  SAAFPNGTGLAATFNKELLEKAGELMGREAIHKNAAVILGPTTNMQRGPLGGRGFESFSE 120
           S  FPNGTGLA+TF++ELL++AG+LM +EA+ KNAAVILGPTTNMQRGPLGGRGFESFSE
Sbjct: 63  SGCFPNGTGLASTFDEELLKEAGKLMAKEAVAKNAAVILGPTTNMQRGPLGGRGFESFSE 122

Query: 121 DPYLAGVATSSVVNGIQSQGIAATVKHFVCNDLEDQRFSSNSIVTERALREIYLEPFRLA 180
           DPYLAGVAT+SVV GIQS+GIAATVKHFVCNDLEDQRFSSNSI++ERALREIYLEPFRLA
Sbjct: 123 DPYLAGVATASVVQGIQSEGIAATVKHFVCNDLEDQRFSSNSILSERALREIYLEPFRLA 182

Query: 181 VRDSNPQCFMTAYSKVNDVHCSQNKKLLQDVLRGEWSWDGMVMSDWFGTYSSAEAIKNGL 240
           +++S+P C MTA +KVN  HC QNKKLL ++LR EWSWDGM+MSDWF TY++A +IKNGL
Sbjct: 183 IKNSDPVCLMTALNKVNGEHCPQNKKLLIELLRKEWSWDGMIMSDWFATYTTAASIKNGL 242

Query: 241 DIEFPGPTRWRKGDLISHLVNSKEAITEHDVDHRARNVLKLVKFFLENKDKTGIQENGPE 300
           DIEFPGPTRWR  +L+SH +NS+E I+ HDVD R R VLK++KF ++N++KTGI +NGPE
Sbjct: 243 DIEFPGPTRWRTNELVSHSLNSREQISIHDVDDRVRQVLKMIKFVVDNQEKTGIVQNGPE 302

Query: 301 DTKNNTPETSKALRWFASESIVLLKNNGNILPLKKEESVVVIGPNAKAQAYSGGGSASLN 360
            T NN+ ET++ LR  A++SIVLLKN  ++LPLKKEES+V+IGPNAKA+  SGGGSASL+
Sbjct: 303 TTSNNSKETAELLRKIAADSIVLLKNENSVLPLKKEESIVIIGPNAKAKVSSGGGSASLH 362

Query: 361 PYYVVSPYEGIKQKTGKDVEYTVGCQSHKSLSNLVEQLILDTSKPVEDGNVGVLAKFYAQ 420
            YYV+SPYEGI  K GK+V YT+G +SHK+LSNL+EQL++D SKP E  NVG  A FY +
Sbjct: 363 SYYVISPYEGIVNKVGKEVPYTLGAESHKTLSNLIEQLVVDPSKPAEGDNVGAAAYFYNE 422

Query: 421 PAELRNSDTEPFDEKVVTKSFITLFDYRNDSVDPKNPIFYVDFEGFYIPDETTDYIVGVQ 480
           PA  R     PF       S   LFD++++ +D  NP+FY+  EG++ P E  +Y+ G+Q
Sbjct: 423 PAGARPQGKSPFHVTTFKHSHNMLFDFKHEKIDSSNPLFYITLEGYFTPKEDANYLFGLQ 482

Query: 481 VFGTAVLYVDGKLVVDNKTNQRKGTFCFSSGTVEETAVLSLKRGQVYRFKVEYGSGPTSK 540
           V+GT +LY+D +LVVD K +Q +G+FCF +GT E+T  +SL++G+ Y+ ++EYGSGPTS+
Sbjct: 483 VYGTGILYLDDELVVDQKKDQTRGSFCFGAGTDEKTKTVSLQKGKAYKVRIEYGSGPTSE 542

Query: 541 FGEDFGAGGLQIGISKVIDEDAEIQNAAELAKKHEKVVLCIGLNGEWESEGYDRRDMTLP 600
              +FG+GG Q+G++K ID D EI+ AA+LA  H+K +LCIGLN EWESEG+DR DM LP
Sbjct: 543 LVSEFGSGGFQVGVAKAIDADEEIRKAAKLAAGHDKAILCIGLNAEWESEGHDREDMILP 602

Query: 601 RRTDDLVRAVLEANPNTIVVNQSGTPVEMPWVSKCNALIHCWYGGNELGNAIADVLYGDF 660
            RT+DLVRAVLEANPNT+++NQSGTPVE PWV + NAL+  WYGGNELGNAIADVLYGD 
Sbjct: 603 GRTNDLVRAVLEANPNTVIINQSGTPVEFPWVEQANALLQAWYGGNELGNAIADVLYGDV 662

Query: 661 VPSGKLSLSWPFKLQDNPAYLTFSTEGGRVLYGEDIYVGYRYFEKLQRQVAFPFGYGLSY 720
           VP GKLSLSWP KL+DNP YL F TE GRVLYGEDI++GYR++EKLQR+VAFPFGYGLSY
Sbjct: 663 VPGGKLSLSWPLKLEDNPTYLNFKTEFGRVLYGEDIFIGYRFYEKLQRRVAFPFGYGLSY 722

Query: 721 TEFKLENLQTSVDFSKGNLEVSVDAANIGDNYAG 754
           TEF L +LQ   D  +  + VSV+  N G+ YAG
Sbjct: 723 TEFALSHLQVQTD--EEVISVSVNVKNTGEEYAG 754

>KLLA0E25081g Chr5 (2222708..2224600) [1893 bp, 630 aa] {ON} similar
           to uniprot|P07337 Kluyveromyces marxianus Beta-
           glucosidase precursor
          Length = 630

 Score =  921 bits (2380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/630 (66%), Positives = 525/630 (83%)

Query: 1   MSTFNVDQVLQELTLAEKISLIAAVDFWHTAPIERLGIPSIRVSDGPNGVRGTKFFDSVP 60
           MS F+++Q L +LT  EKISL++AVDFWHT  IERLGIPS+RVSDGPNG+RGT+FFDSVP
Sbjct: 1   MSKFDIEQTLGKLTRDEKISLLSAVDFWHTKEIERLGIPSVRVSDGPNGIRGTRFFDSVP 60

Query: 61  SAAFPNGTGLAATFNKELLEKAGELMGREAIHKNAAVILGPTTNMQRGPLGGRGFESFSE 120
           S  FPNGTGLA+TF++ELL++AG+LMG+EA+ KNAAVILGPT NMQRGPLGGRGFESFSE
Sbjct: 61  SGCFPNGTGLASTFDEELLKEAGKLMGKEAVAKNAAVILGPTANMQRGPLGGRGFESFSE 120

Query: 121 DPYLAGVATSSVVNGIQSQGIAATVKHFVCNDLEDQRFSSNSIVTERALREIYLEPFRLA 180
           DPYLAGVAT+SVV GIQS+GIAATVKHFVCNDLEDQRFSSN+ ++ERALREIYLEPFRLA
Sbjct: 121 DPYLAGVATASVVQGIQSEGIAATVKHFVCNDLEDQRFSSNATLSERALREIYLEPFRLA 180

Query: 181 VRDSNPQCFMTAYSKVNDVHCSQNKKLLQDVLRGEWSWDGMVMSDWFGTYSSAEAIKNGL 240
           V++++P C M+AY+KVN  HCSQNKKLL D+LR EW+WDGM+MSDWFGTY++A +IKNGL
Sbjct: 181 VKNADPVCLMSAYNKVNGEHCSQNKKLLLDILRKEWNWDGMIMSDWFGTYTTAASIKNGL 240

Query: 241 DIEFPGPTRWRKGDLISHLVNSKEAITEHDVDHRARNVLKLVKFFLENKDKTGIQENGPE 300
           DIEFPGPTRWR  +L+SH +NS+E I+ +DVD R R VLK++KF L+N++KTGI +NGPE
Sbjct: 241 DIEFPGPTRWRTNELVSHSLNSREQISIYDVDDRVRQVLKMIKFVLDNQEKTGIVQNGPE 300

Query: 301 DTKNNTPETSKALRWFASESIVLLKNNGNILPLKKEESVVVIGPNAKAQAYSGGGSASLN 360
            T NN+ ETS+ LR  A++SIVLLKN  +ILPLKKEESVVVIGPNAKA+A SGGGSAS+N
Sbjct: 301 TTSNNSKETSELLRKIAADSIVLLKNENSILPLKKEESVVVIGPNAKAKASSGGGSASMN 360

Query: 361 PYYVVSPYEGIKQKTGKDVEYTVGCQSHKSLSNLVEQLILDTSKPVEDGNVGVLAKFYAQ 420
            YYV+SPYEGI +K GK+V YT+G +SHK+LSNL+EQL++D SKP E  N G    FY++
Sbjct: 361 SYYVISPYEGIVKKVGKEVPYTIGAESHKTLSNLIEQLVVDPSKPAEGDNAGATGFFYSE 420

Query: 421 PAELRNSDTEPFDEKVVTKSFITLFDYRNDSVDPKNPIFYVDFEGFYIPDETTDYIVGVQ 480
           P E R  D  PF       SF  LFD+++D +D  NP+FY+  EG++ P+E  +YI G+Q
Sbjct: 421 PVEKRAKDESPFHVAAFKHSFNLLFDFKHDKIDTNNPLFYITLEGYFTPEEDANYIFGLQ 480

Query: 481 VFGTAVLYVDGKLVVDNKTNQRKGTFCFSSGTVEETAVLSLKRGQVYRFKVEYGSGPTSK 540
           V+GT +LY+D +L++D K  Q +G FCF +GT E+T  ++L++G+ Y+ ++EYGSGPTS+
Sbjct: 481 VYGTGLLYLDEELLIDQKKGQTRGGFCFGAGTNEKTKTVTLQKGKSYKVRIEYGSGPTSQ 540

Query: 541 FGEDFGAGGLQIGISKVIDEDAEIQNAAELAKKHEKVVLCIGLNGEWESEGYDRRDMTLP 600
              +FGAG LQ+G++K ID D EI+ AA+LA  H+K +LCIGLN EWESEG+DR DMTLP
Sbjct: 541 LVSEFGAGALQVGVAKAIDADEEIKKAAKLAAGHDKAILCIGLNAEWESEGHDREDMTLP 600

Query: 601 RRTDDLVRAVLEANPNTIVVNQSGTPVEMP 630
            RT+DLVRAVLEANPNT++VNQSGTPVE P
Sbjct: 601 GRTNDLVRAVLEANPNTVIVNQSGTPVEFP 630

>YMR239C Chr13 complement(748262..749677) [1416 bp, 471 aa] {ON}
           RNT1RNAase III; involved in rDNA transcription and rRNA
           processing; also cleaves a stem-loop structure at the 3'
           end of U2 snRNA to ensure formation of the correct U2 3'
           end; involved in polyadenylation-independent
           transcription termination
          Length = 471

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 45/94 (47%), Gaps = 13/94 (13%)

Query: 293 GIQENGPEDTKNNTPETSKALRWFASESIVLLKNNGNILPLKKEESVVVIGPNAKAQAYS 352
           G+ E+ P   +NN P+  K LR  A    V+ +   N + L+K +    +  NAK Q YS
Sbjct: 325 GLMEDDP---RNNLPKIRKWLRKLAKP--VIEEATRNQVALEKTDK---LDMNAKRQLYS 376

Query: 353 GGGSASLNPYYVVSPYEGIKQKTGKDVEYTVGCQ 386
             G ASL  +YV      +K+ T  D    V C+
Sbjct: 377 LIGYASLRLHYVT-----VKKPTAVDPNSIVECR 405

>KAFR0H03030 Chr8 (579798..580541) [744 bp, 247 aa] {ON} Anc_1.431
           YCR016W
          Length = 247

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 32/53 (60%), Gaps = 4/53 (7%)

Query: 764 STESKIGRPVKELKGFDKVYLQPGEKKTVKLNLVLKDSISFF-DEYENKWCAE 815
           +T  K+ +P K+ K  DK+   P E++ +K NLVLKD + +  D Y+ K  AE
Sbjct: 60  ATSKKVSKPGKKEKKRDKL---PKEERLLKKNLVLKDQLRYLIDFYKKKISAE 109

>Skud_13.410 Chr13 complement(723047..724471) [1425 bp, 474 aa] {ON}
           YMR239C (REAL)
          Length = 474

 Score = 33.1 bits (74), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 46/94 (48%), Gaps = 13/94 (13%)

Query: 293 GIQENGPEDTKNNTPETSKALRWFASESIVLLKNNGNILPLKKEESVVVIGPNAKAQAYS 352
           G+ E+ P   +NN P+  K LR  A    V+ +   + + L+K + + +   NAK Q YS
Sbjct: 328 GLMEDDP---RNNLPKIRKWLRKLAKP--VIEEATHSQIALEKTDKLDM---NAKRQLYS 379

Query: 353 GGGSASLNPYYVVSPYEGIKQKTGKDVEYTVGCQ 386
             G ASL  +YV      +K+ T  D    V C+
Sbjct: 380 LIGYASLRLHYVT-----VKKPTSVDPNSIVECR 408

>KAFR0D00610 Chr4 (99088..101541) [2454 bp, 817 aa] {ON} Anc_1.66
           YLR187W
          Length = 817

 Score = 33.1 bits (74), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 62/146 (42%), Gaps = 13/146 (8%)

Query: 34  ERLGIPSIRVSDGPNGVRGTKFFDSVPSAAFPNGTGLAATFNKELLEKAGELMGREAIHK 93
            +L +P I  S+ P+     K   ++ SAA P+ TG    FN   +E+  ++MG E  + 
Sbjct: 677 RKLDVPEI--SETPSA---NKTISNLQSAANPSYTGEQDIFNSSFMEQ-DQMMGAENSYM 730

Query: 94  NAAVILGPTTNMQRGPLGGRGFESFSEDPYLAGVATSSVVNGIQSQGIAATVKHFVCNDL 153
                  PT N  +GP      +SF   P+  G+     V  +      + VK  VC+ +
Sbjct: 731 TQTYNHVPTLNGSKGPTS--QIKSF---PHSRGIKNLKNVTALNDSSHVSPVKS-VCSGI 784

Query: 154 ED-QRFSSNSIVTERALREIYLEPFR 178
           ++ ++   NS   +      Y +  R
Sbjct: 785 DNSEKIPDNSTFIQPRTTHPYADRIR 810

>Suva_13.424 Chr13 complement(729834..731243) [1410 bp, 469 aa] {ON}
           YMR239C (REAL)
          Length = 469

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 46/94 (48%), Gaps = 13/94 (13%)

Query: 293 GIQENGPEDTKNNTPETSKALRWFASESIVLLKNNGNILPLKKEESVVVIGPNAKAQAYS 352
           G+ E+ P   +NN P+  K LR  A    V+ +   + + L+K + + +   NAK Q YS
Sbjct: 323 GLMEDDP---RNNLPKIRKWLRKLAKP--VIEEATHSQVALEKTDKLDM---NAKRQLYS 374

Query: 353 GGGSASLNPYYVVSPYEGIKQKTGKDVEYTVGCQ 386
             G ASL  +YV      +K+ T  D    V C+
Sbjct: 375 LIGYASLRLHYVT-----VKKPTAIDPNSIVECR 403

>Smik_13.451 Chr13 complement(732656..734074) [1419 bp, 472 aa] {ON}
           YMR239C (REAL)
          Length = 472

 Score = 32.7 bits (73), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 46/94 (48%), Gaps = 13/94 (13%)

Query: 293 GIQENGPEDTKNNTPETSKALRWFASESIVLLKNNGNILPLKKEESVVVIGPNAKAQAYS 352
           G+ E+ P   +NN P+  K LR  A    V+ +   + + L+K + + +   NAK Q YS
Sbjct: 326 GLMEDDP---RNNLPKIRKWLRKLAKP--VIEEATHSQVALEKTDKLDM---NAKRQLYS 377

Query: 353 GGGSASLNPYYVVSPYEGIKQKTGKDVEYTVGCQ 386
             G ASL  +YV      +K+ T  D    V C+
Sbjct: 378 LIGYASLRLHYVT-----VKKPTAVDPNSIVECR 406

>TDEL0F00540 Chr6 complement(90867..93965) [3099 bp, 1032 aa] {ON}
           Anc_1.506 YKL197C
          Length = 1032

 Score = 32.0 bits (71), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 24/111 (21%), Positives = 52/111 (46%), Gaps = 10/111 (9%)

Query: 315 WFASESIVLLKNNGNILPLKKEESVVVIGPNAKAQAYSGGGSASLNPYYVVSPYEGIKQK 374
           ++ + SI+LL N   + P     S+    P  +A    GG +++    +++   EGI  K
Sbjct: 517 YWNNPSILLLDNAEGLFP-----SIKTDDPQQQAMQQRGGSNSTKLALFLIKMVEGITAK 571

Query: 375 TGKDVEYTVGCQSHKSLSNLV--EQLILDTSK---PVEDGNVGVLAKFYAQ 420
             + +     C++   L++++  +  I +T K   P  D   G++  F+++
Sbjct: 572 CPEAIRVVFSCRNQNELNSILFDKHFICETFKRRSPDVDERGGLIEFFFSR 622

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.135    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 93,973,087
Number of extensions: 4408384
Number of successful extensions: 10798
Number of sequences better than 10.0: 23
Number of HSP's gapped: 11096
Number of HSP's successfully gapped: 23
Length of query: 847
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 729
Effective length of database: 39,950,811
Effective search space: 29124141219
Effective search space used: 29124141219
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)