Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E00814g6.9ON39838118820.0
KLTH0C11550g6.9ON39838112701e-174
Ecym_30126.9ON39738512231e-167
Kwal_56.223456.9ON39638112231e-167
NDAI0K029006.9ON43839411681e-158
ACR017W6.9ON42337711651e-158
TDEL0G046206.9ON39238511521e-156
ZYRO0F00462g6.9ON39338311341e-154
KLLA0D00814g6.9ON40839211331e-153
NCAS0F001906.9ON41138611301e-153
Kpol_1045.786.9ON39238411071e-149
Skud_5.336.9ON40137910561e-142
YEL056W (HAT2)6.9ON40138010541e-141
Suva_5.126.9ON40138010481e-140
TPHA0M001906.9ON39138610421e-140
Smik_5.316.9ON42737910381e-139
KAFR0L003206.9ON39137010331e-138
KNAG0E009806.9ON41436910201e-136
CAGL0B03575g6.9ON41938710181e-136
TBLA0A071206.9ON4073929431e-124
TDEL0B029808.548ON4124033394e-35
NDAI0C055108.548ON4194023395e-35
KLLA0E23541g8.548ON4173933352e-34
TBLA0H036508.548ON4194143325e-34
Ecym_70428.548ON4143963282e-33
Kwal_27.120708.548ON4184033212e-32
AEL250C8.548ON4174003169e-32
ZYRO0A13068g8.548ON3973993132e-31
YBR195C (MSI1)8.548ON4224073132e-31
TPHA0L017208.548ON4194003132e-31
Smik_2.3358.548ON4224073115e-31
CAGL0M05291g8.548ON4194033107e-31
Skud_2.3218.548ON4224113107e-31
KLTH0E12694g8.548ON4184033091e-30
NCAS0B021708.548ON4144023071e-30
Suva_4.4498.548ON4244143072e-30
Kpol_1024.398.548ON4174023044e-30
KAFR0I008408.548ON4134003044e-30
KNAG0A036708.548ON4264173011e-29
SAKL0H09900g8.548ON4254032992e-29
KLTH0G12430g8.316ON3672741585e-11
NCAS0E037507.310ON12762201597e-11
Kpol_1048.598.544ON8502161598e-11
KAFR0A003802.401ON5164161579e-11
TPHA0G026502.401ON5164051499e-10
NCAS0G011206.276ON4941681491e-09
KLLA0E07085g3.25ON4522181481e-09
Suva_4.537.310ON12711941482e-09
KNAG0E021802.401ON5174041472e-09
TDEL0C023607.310ON12642161482e-09
Suva_13.3112.401ON5102371462e-09
KLTH0B03410g5.201ON4771641434e-09
ADR242C2.401ON5214111435e-09
Skud_4.637.310ON12731961445e-09
TDEL0G033402.401ON5142421435e-09
YMR131C (RRB1)2.401ON5112421436e-09
NCAS0F019702.401ON5114061427e-09
Sklu_YGOB_Anc_2.4012.401ON5204151427e-09
ADL184W3.25ON4492091419e-09
KLTH0F19294g3.25ON4512191419e-09
KNAG0I009208.316ON3813001401e-08
TBLA0B092502.401ON5264041411e-08
NDAI0H027502.401ON5124061401e-08
Suva_13.2952.431ON3192441381e-08
Skud_13.2752.431ON3192441381e-08
Smik_13.3052.431ON3192441381e-08
YMR116C (ASC1)2.431ON3192441381e-08
ZYRO0F05808g7.310ON12822151411e-08
Smik_4.457.310ON12701921402e-08
Kpol_1019.307.310ON12522081402e-08
Kwal_56.238958.316ON3672761372e-08
KLLA0F17237g2.401ON5232421382e-08
NDAI0F012406.276ON5241701382e-08
Kwal_33.151365.201ON4731371373e-08
AAL157C5.201ON4791721373e-08
KAFR0B057008.316ON3722771363e-08
SAKL0H15708g8.316ON3682981345e-08
Skud_14.2982.283ON3892061336e-08
Suva_14.3112.283ON3891911336e-08
YNL035C2.283ON3892041336e-08
KAFR0H033402.283ON3672071336e-08
KLTH0G10296g2.283ON4261941337e-08
SAKL0C13266g3.25ON4592131337e-08
Skud_13.2912.401ON5092901347e-08
CAGL0D05588g5.201ON4771261338e-08
AFR199C2.431ON3341901328e-08
Smik_13.3292.401ON5092421339e-08
KLLA0E04093g8.316ON3722931329e-08
Ecym_60672.401ON5222421331e-07
KLTH0E09394g2.401ON5224031321e-07
Kwal_47.178272.401ON5234031321e-07
TDEL0A068906.276ON4472201311e-07
KLLA0F05159g7.310ON12312021331e-07
KAFR0L013207.310ON12402091331e-07
Kpol_1060.246.276ON4861721311e-07
YLL011W (SOF1)5.201ON4891891312e-07
YPL247C6.276ON5232381312e-07
ZYRO0A03234g3.259ON4132691292e-07
ZYRO0A09636g8.435ON8081491312e-07
YDL195W (SEC31)7.310ON12732051312e-07
KLLA0F15598g5.201ON4781641292e-07
KAFR0E012303.259ON3692331283e-07
ADR090W7.310ON12332141303e-07
SAKL0E03960g2.431ON3202431273e-07
KAFR0I005004.309ON5271321293e-07
Ecym_33212.283ON4092571283e-07
YNL317W (PFS2)3.25ON4652361283e-07
Ecym_80617.310ON12282121293e-07
Ecym_20263.25ON4512091283e-07
AGL234W6.363ON6292431293e-07
CAGL0G01628g2.283ON3761881273e-07
NCAS0D027305.201ON4752041284e-07
SAKL0E07766g2.283ON3981361274e-07
Kpol_2002.995.201ON4871381284e-07
SAKL0G12892g5.201ON4761671284e-07
Suva_14.223.25ON4692441274e-07
Ecym_25236.363ON6462461284e-07
TPHA0E030805.201ON4881391274e-07
Ecym_42498.316ON3742441264e-07
KNAG0J016808.672ON3981901265e-07
KLTH0A07282g6.363ON7252471275e-07
Suva_16.5107.534ON4652111266e-07
Skud_14.223.25ON4672361266e-07
KAFR0F010606.276ON5531611266e-07
TPHA0P014903.25ON4592131267e-07
TPHA0G023802.431ON3182431247e-07
KLLA0E21187g5.429ON4291901257e-07
CAGL0H00781g6.276ON5132281267e-07
Smik_14.143.25ON4662361257e-07
SAKL0F10384g7.310ON12612011268e-07
ZYRO0A08690g2.401ON5162421258e-07
NDAI0I021805.201ON4791871258e-07
CAGL0K03861g2.401ON5134091259e-07
ZYRO0E08184g6.276ON5061791241e-06
KNAG0A012303.22ON13212121261e-06
KAFR0J009805.201ON480991241e-06
Suva_16.606.276ON5261901241e-06
AGL190W8.316ON3702951231e-06
Kpol_1041.202.401ON5154061241e-06
Kwal_55.220673.25ON4512171231e-06
TDEL0H003707.534ON4652011231e-06
NDAI0I004606.325ON9172141241e-06
KNAG0A030808.651ON4462121231e-06
Skud_12.2858.435ON8171861241e-06
Kwal_56.244787.310ON12962011241e-06
KNAG0M017505.201ON4851881231e-06
TBLA0F021407.310ON13002151242e-06
NDAI0G038303.25ON5102031222e-06
Smik_16.4427.534ON4701641222e-06
TDEL0A004403.25ON4512071222e-06
KLTH0H02134g7.310ON12992041232e-06
Suva_16.1598.672ON4511541222e-06
Kwal_23.64296.363ON7502471232e-06
TPHA0D035906.276ON5981741232e-06
Kpol_1036.658.316ON3712951212e-06
ZYRO0C03124g3.25ON4452071222e-06
Ecym_60982.431ON3182441212e-06
TDEL0E042805.201ON4811271222e-06
TPHA0I018808.544ON10342341232e-06
AGR180W8.435ON8061791222e-06
KLLA0E08449g2.283ON4222531212e-06
Skud_4.4018.316ON3763071212e-06
Kpol_1014.193.25ON4522141213e-06
Ecym_55285.429ON4711921213e-06
Smik_14.2962.283ON3892041203e-06
TBLA0B087303.25ON4612171203e-06
YKL213C (DOA1)1.534ON7151691213e-06
Skud_16.326.276ON5221871204e-06
TPHA0C008608.316ON3783071194e-06
Suva_10.645.201ON4901281194e-06
CAGL0M02277g8.672ON4271441194e-06
KAFR0I028403.25ON4562181194e-06
TBLA0B059202.283ON4031931194e-06
TDEL0F022304.122ON5561441195e-06
Ecym_71055.201ON4841171185e-06
Ecym_8044na 1ON3111661175e-06
Smik_12.525.201ON4891281186e-06
ACR137W8.672ON4251941186e-06
Smik_6.4516.276ON5231701186e-06
Smik_6.3488.672ON4511571186e-06
Skud_12.565.201ON4891891186e-06
NDAI0E024008.672ON4341931177e-06
KNAG0A012503.25ON4522111177e-06
TBLA0H020005.201ON4731371177e-06
SAKL0F15972g7.534ON4702041177e-06
NDAI0E034408.435ON8571721187e-06
YPL151C (PRP46)8.672ON4511581178e-06
Skud_16.4827.534ON4651771178e-06
Suva_10.3168.435ON8181511179e-06
ZYRO0F07282g8.672ON4271931169e-06
KNAG0I025406.325ON9182401179e-06
Suva_3.936.325ON9202461171e-05
SAKL0A00660g6.363ON6602471171e-05
TBLA0A023106.276ON5311911161e-05
Skud_16.1318.672ON4511571161e-05
YDR142C (PEX7)8.316ON3752281151e-05
KAFR0A056104.309ON6201751161e-05
YPR178W (PRP4)7.534ON4651641161e-05
ZYRO0F06776g8.651ON4322261151e-05
Ecym_70388.544ON8002491161e-05
CAGL0B01529g8.316ON3692231151e-05
NCAS0C044503.25ON4612111151e-05
Kpol_1062.325.429ON4662011151e-05
TPHA0G016108.672ON4141791141e-05
KAFR0H024508.672ON4171581141e-05
Suva_2.3038.316ON3772511142e-05
CAGL0K09284g6.325ON9112131152e-05
KNAG0D007406.276ON5041611142e-05
YJL112W (MDV1)1.247ON7141871152e-05
SAKL0F10648g7.322ON12032231152e-05
NCAS0B036908.288ON11451551152e-05
Kpol_1061.364.122ON5891361142e-05
Kwal_56.236858.288ON11021371152e-05
KAFR0H017508.435ON7831491142e-05
TPHA0F007704.122ON6311361142e-05
KLTH0H02772g6.276ON4201771132e-05
SAKL0G02398g5.429ON4711851132e-05
ACR199C7.338ON2952101122e-05
TBLA0A038908.316ON3622901122e-05
KLTH0B01628g5.139ON7902021142e-05
ZYRO0B10450g5.201ON4821291132e-05
CAGL0M04081g3.25ON4552091133e-05
TDEL0F044308.316ON3672971123e-05
Smik_3.1576.325ON9242461133e-05
KLLA0F19734g8.288ON11331581133e-05
Ecym_21396.276ON4351911123e-05
Ecym_20936.325ON9232161133e-05
NDAI0E013308.651ON4302111123e-05
KLLA0E19515g7.356ON5721681123e-05
Skud_3.1336.325ON9162461133e-05
AAR078W7.356ON5621821123e-05
ZYRO0F09922g5.429ON4551981123e-05
NCAS0G038702.283ON3891231114e-05
KNAG0B028007.310ON13071321134e-05
SAKL0H06666g8.672ON4411861114e-05
NDAI0J010408.316ON3982441104e-05
AEL269C7.534ON4552211114e-05
Smik_5.200na 2ON3911501105e-05
Kpol_1003.342.283ON3881801105e-05
Ecym_46447.338ON2952101095e-05
NCAS0B01440na 3ON4282011106e-05
KLLA0F10263g6.363ON6822551106e-05
NCAS0D044806.325ON9152431116e-05
Kwal_56.245267.322ON12102231116e-05
SAKL0A01738g6.325ON9092451107e-05
TDEL0A061808.672ON4342311097e-05
Kwal_26.87768.672ON4331431097e-05
KLTH0H01892g7.322ON12092391108e-05
TBLA0F041306.340ON5142521098e-05
KNAG0H012903.259ON4641871088e-05
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E00814g
         (398 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...   729   0.0  
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...   493   e-174
Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON} s...   475   e-167
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...   475   e-167
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9     454   e-158
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...   453   e-158
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...   448   e-156
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...   441   e-154
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...   441   e-153
NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}...   439   e-153
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...   431   e-149
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)   411   e-142
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...   410   e-141
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)   408   e-140
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...   405   e-140
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)   404   e-139
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...   402   e-138
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...   397   e-136
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...   396   e-136
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...   367   e-124
TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {O...   135   4e-35
NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON} Anc_8...   135   5e-35
KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} simi...   133   2e-34
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...   132   5e-34
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...   130   2e-33
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...   128   2e-32
AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON} S...   126   9e-32
ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} simi...   125   2e-31
YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}  ...   125   2e-31
TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8....   125   2e-31
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...   124   5e-31
CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa] ...   124   7e-31
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...   124   7e-31
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...   123   1e-30
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...   122   1e-30
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...   122   2e-30
Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa] ...   121   4e-30
KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {O...   121   4e-30
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...   120   1e-29
SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {...   119   2e-29
KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} simi...    65   5e-11
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    66   7e-11
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    66   8e-11
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    65   9e-11
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    62   9e-10
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    62   1e-09
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    62   1e-09
Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W (R...    62   2e-09
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    61   2e-09
TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7....    62   2e-09
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    61   2e-09
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    60   4e-09
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    60   5e-09
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    60   5e-09
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    60   5e-09
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    60   6e-09
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    59   7e-09
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    59   7e-09
ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic ho...    59   9e-09
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    59   9e-09
KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.3...    59   1e-08
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    59   1e-08
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    59   1e-08
Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960...    58   1e-08
Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960...    58   1e-08
Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960...    58   1e-08
YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,...    58   1e-08
ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa] ...    59   1e-08
Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W (R...    59   2e-08
Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON} (56367...    59   2e-08
Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {...    57   2e-08
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    58   2e-08
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    58   2e-08
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    57   3e-08
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    57   3e-08
KAFR0B05700 Chr2 complement(1176020..1177138) [1119 bp, 372 aa] ...    57   3e-08
SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} high...    56   5e-08
Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {...    56   6e-08
Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {...    56   6e-08
YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON} ...    56   6e-08
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...    56   6e-08
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...    56   7e-08
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    56   7e-08
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    56   7e-08
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    56   8e-08
AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,...    55   8e-08
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    56   9e-08
KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} simila...    55   9e-08
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    56   1e-07
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    55   1e-07
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    55   1e-07
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    55   1e-07
KLLA0F05159g Chr6 (506007..509702) [3696 bp, 1231 aa] {ON} simil...    56   1e-07
KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa] ...    56   1e-07
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    55   1e-07
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    55   2e-07
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    55   2e-07
ZYRO0A03234g Chr1 (258942..260183) [1242 bp, 413 aa] {ON} simila...    54   2e-07
ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly...    55   2e-07
YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}  SEC31Comp...    55   2e-07
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    54   2e-07
KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {O...    54   3e-07
ADR090W Chr4 (868742..872443) [3702 bp, 1233 aa] {ON} Syntenic h...    55   3e-07
SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963...    54   3e-07
KAFR0I00500 Chr9 complement(104685..106268) [1584 bp, 527 aa] {O...    54   3e-07
Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}...    54   3e-07
YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integra...    54   3e-07
Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON...    54   3e-07
Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to ...    54   3e-07
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...    54   3e-07
CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {...    54   3e-07
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     54   4e-07
SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} simila...    54   4e-07
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    54   4e-07
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    54   4e-07
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    54   4e-07
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...    54   4e-07
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    54   4e-07
Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}...    53   4e-07
KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8....    53   5e-07
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...    54   5e-07
Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178...    53   6e-07
Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W (...    53   6e-07
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    53   6e-07
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    53   7e-07
TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa...    52   7e-07
KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} simi...    53   7e-07
CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON...    53   7e-07
Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W (...    53   7e-07
SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa] ...    53   8e-07
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    53   8e-07
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    53   8e-07
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    53   9e-07
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    52   1e-06
KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON...    53   1e-06
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    52   1e-06
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    52   1e-06
AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic ho...    52   1e-06
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    52   1e-06
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    52   1e-06
TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}...    52   1e-06
NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325       52   1e-06
KNAG0A03080 Chr1 complement(380346..381686) [1341 bp, 446 aa] {O...    52   1e-06
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...    52   1e-06
Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa...    52   1e-06
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    52   1e-06
TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {...    52   2e-06
NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25      52   2e-06
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    52   2e-06
TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25 ...    52   2e-06
KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} simil...    52   2e-06
Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {...    52   2e-06
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...    52   2e-06
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    52   2e-06
Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa] ...    51   2e-06
ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {...    52   2e-06
Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa] ...    51   2e-06
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    52   2e-06
TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {...    52   2e-06
AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic ...    52   2e-06
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...    51   2e-06
Skud_4.401 Chr4 complement(712131..713261) [1131 bp, 376 aa] {ON...    51   2e-06
Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {O...    51   3e-06
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    51   3e-06
Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {...    51   3e-06
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    51   3e-06
YKL213C Chr11 complement(31960..34107) [2148 bp, 715 aa] {ON}  D...    51   3e-06
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    51   4e-06
TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.3...    50   4e-06
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    50   4e-06
CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa] ...    50   4e-06
KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {O...    50   4e-06
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...    50   4e-06
TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.1...    50   5e-06
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    50   5e-06
Ecym_8044 Chr8 (97649..98584) [936 bp, 311 aa] {ON} similar to A...    50   5e-06
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    50   6e-06
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    50   6e-06
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    50   6e-06
Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C ...    50   6e-06
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    50   6e-06
NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672     50   7e-06
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    50   7e-06
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    50   7e-06
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    50   7e-06
NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {O...    50   7e-06
YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON} ...    50   8e-06
Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178...    50   8e-06
Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {...    50   9e-06
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    49   9e-06
KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.3...    50   9e-06
Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}...    50   1e-05
SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some sim...    50   1e-05
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    49   1e-05
Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {...    49   1e-05
YDR142C Chr4 complement(740473..741600) [1128 bp, 375 aa] {ON}  ...    49   1e-05
KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa] ...    49   1e-05
YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splic...    49   1e-05
ZYRO0F06776g Chr6 (555965..557263) [1299 bp, 432 aa] {ON} simila...    49   1e-05
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    49   1e-05
CAGL0B01529g Chr2 (137174..138283) [1110 bp, 369 aa] {ON} highly...    49   1e-05
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      49   1e-05
Kpol_1062.32 s1062 (69674..71074) [1401 bp, 466 aa] {ON} (69674....    49   1e-05
TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {O...    49   1e-05
KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {O...    49   1e-05
Suva_2.303 Chr2 complement(535706..536839) [1134 bp, 377 aa] {ON...    49   2e-05
CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highl...    49   2e-05
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    49   2e-05
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    49   2e-05
SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highl...    49   2e-05
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    49   2e-05
Kpol_1061.36 s1061 (100800..102569) [1770 bp, 589 aa] {ON} (1008...    49   2e-05
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    49   2e-05
KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {O...    49   2e-05
TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.1...    49   2e-05
KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {...    48   2e-05
SAKL0G02398g Chr7 complement(200123..201538) [1416 bp, 471 aa] {...    48   2e-05
ACR199C Chr3 complement(698881..699768) [888 bp, 295 aa] {ON} Sy...    48   2e-05
TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {O...    48   2e-05
KLTH0B01628g Chr2 (129632..132004) [2373 bp, 790 aa] {ON} simila...    49   2e-05
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    48   2e-05
CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa] ...    48   3e-05
TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {O...    48   3e-05
Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON...    48   3e-05
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    48   3e-05
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    48   3e-05
Ecym_2093 Chr2 (165578..168349) [2772 bp, 923 aa] {ON} similar t...    48   3e-05
NDAI0E01330 Chr5 complement(266071..267363) [1293 bp, 430 aa] {O...    48   3e-05
KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]...    48   3e-05
Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON...    48   3e-05
AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic ho...    48   3e-05
ZYRO0F09922g Chr6 complement(805666..807033) [1368 bp, 455 aa] {...    48   3e-05
NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283     47   4e-05
KNAG0B02800 Chr2 (537056..540979) [3924 bp, 1307 aa] {ON} Anc_7....    48   4e-05
SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {...    47   4e-05
NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8....    47   4e-05
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    47   4e-05
Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W ...    47   5e-05
Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {O...    47   5e-05
Ecym_4644 Chr4 (1256560..1257447) [888 bp, 295 aa] {ON} similar ...    47   5e-05
NCAS0B01440 Chr2 (236104..237390) [1287 bp, 428 aa] {ON}               47   6e-05
KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON} unipro...    47   6e-05
NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {O...    47   6e-05
Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON} YDL...    47   6e-05
SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly...    47   7e-05
TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON} Anc_8...    47   7e-05
Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C...    47   7e-05
KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa] ...    47   8e-05
TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa] ...    47   8e-05
KNAG0H01290 Chr8 (227947..229341) [1395 bp, 464 aa] {ON} Anc_3.2...    46   8e-05
TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa] ...    47   9e-05
TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {O...    46   9e-05
NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363     47   9e-05
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     46   9e-05
YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}  ...    47   9e-05
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    47   1e-04
CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} simila...    46   1e-04
Kpol_2001.63 s2001 complement(171777..175607) [3831 bp, 1276 aa]...    47   1e-04
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    47   1e-04
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    47   1e-04
CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON...    46   1e-04
Smik_4.386 Chr4 complement(701174..702304) [1131 bp, 376 aa] {ON...    46   1e-04
NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4....    46   1e-04
TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {O...    46   1e-04
TDEL0F00270 Chr6 complement(40832..42949) [2118 bp, 705 aa] {ON}...    46   1e-04
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...    46   1e-04
TPHA0G01740 Chr7 complement(357600..358946) [1347 bp, 448 aa] {O...    46   1e-04
Kpol_1058.31 s1058 (85899..87926) [2028 bp, 675 aa] {ON} (85899....    46   1e-04
Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {O...    46   1e-04
TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {...    46   1e-04
Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON} (63032....    46   1e-04
TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1....    45   1e-04
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    46   1e-04
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    46   1e-04
ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highl...    46   2e-04
Kpol_2001.68 s2001 complement(187786..188673) [888 bp, 295 aa] {...    45   2e-04
AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}...    45   2e-04
KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]...    45   2e-04
TDEL0C02080 Chr3 (360056..360940) [885 bp, 294 aa] {ON} Anc_7.33...    45   2e-04
Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON...    45   2e-04
KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {...    45   2e-04
CAGL0J03960g Chr10 complement(375780..377087) [1308 bp, 435 aa] ...    45   2e-04
NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {O...    45   2e-04
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...    45   2e-04
TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.6...    45   2e-04
Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar ...    45   2e-04
KNAG0C04950 Chr3 (955701..957023) [1323 bp, 440 aa] {ON} Anc_5.4...    45   2e-04
SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]...    45   2e-04
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    45   2e-04
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    45   2e-04
ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {...    45   2e-04
Smik_7.287 Chr7 complement(484376..486076) [1701 bp, 566 aa] {ON...    45   2e-04
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    45   2e-04
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    45   2e-04
KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.3...    45   2e-04
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    45   2e-04
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...    45   2e-04
SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {...    45   2e-04
NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {O...    45   2e-04
Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W...    44   2e-04
YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protei...    44   2e-04
Skud_7.536 Chr7 complement(874704..877070) [2367 bp, 788 aa] {ON...    45   3e-04
KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {...    45   3e-04
Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON...    45   3e-04
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    45   3e-04
ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON} ...    45   3e-04
KLLA0C16643g Chr3 complement(1457590..1458498) [909 bp, 302 aa] ...    44   3e-04
KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.39...    44   3e-04
KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON} Anc_4...    45   3e-04
NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {...    45   3e-04
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    45   3e-04
CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some sim...    45   3e-04
TBLA0A03750 Chr1 complement(937167..938510) [1344 bp, 447 aa] {O...    44   4e-04
KLLA0C08976g Chr3 (784536..787271) [2736 bp, 911 aa] {ON} highly...    45   4e-04
KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} simi...    45   4e-04
NDAI0E01320 Chr5 complement(262712..263995) [1284 bp, 427 aa] {O...    44   4e-04
YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}  ...    45   4e-04
Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON} (1007...    44   4e-04
CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa] ...    45   4e-04
CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa] ...    44   4e-04
YFL009W Chr6 (116145..118484) [2340 bp, 779 aa] {ON}  CDC4F-box ...    44   4e-04
SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} simila...    44   4e-04
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    44   4e-04
NCAS0B01910 Chr2 (312479..313456) [978 bp, 325 aa] {ON} Anc_8.585      44   4e-04
ZYRO0D05852g Chr4 (498219..499334) [1116 bp, 371 aa] {ON} simila...    44   4e-04
NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa] ...    44   4e-04
TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8....    44   4e-04
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    45   4e-04
Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {O...    44   4e-04
ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly...    44   4e-04
KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.5...    44   4e-04
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    44   4e-04
KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON...    44   4e-04
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    44   5e-04
NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340       44   5e-04
Ecym_7078 Chr7 complement(156495..157436) [942 bp, 313 aa] {ON} ...    44   5e-04
Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR1...    44   5e-04
Kwal_56.24399 s56 (981153..982262) [1110 bp, 369 aa] {ON} [conti...    44   5e-04
AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {...    44   5e-04
AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic ho...    44   5e-04
ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {...    44   5e-04
KAFR0C03190 Chr3 complement(639680..641698) [2019 bp, 672 aa] {O...    44   5e-04
Ecym_6169 Chr6 complement(314473..316128) [1656 bp, 551 aa] {ON}...    44   5e-04
Suva_10.302 Chr10 (532343..533236) [894 bp, 297 aa] {ON} YLR208W...    44   5e-04
YGL003C Chr7 complement(492474..494174) [1701 bp, 566 aa] {ON}  ...    44   5e-04
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    44   5e-04
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     44   5e-04
Skud_4.634 Chr4 complement(1131614..1132978) [1365 bp, 454 aa] {...    44   5e-04
ZYRO0F11484g Chr6 complement(943018..943902) [885 bp, 294 aa] {O...    44   5e-04
TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {...    44   6e-04
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    44   6e-04
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    44   6e-04
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    44   6e-04
TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {O...    44   6e-04
NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721       44   6e-04
Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR27...    44   7e-04
KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} simila...    44   7e-04
ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]...    44   7e-04
Skud_7.284 Chr7 complement(495549..497249) [1701 bp, 566 aa] {ON...    44   7e-04
Smik_6.70 Chr6 (129582..131933) [2352 bp, 783 aa] {ON} YFL009W (...    44   7e-04
Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON...    44   7e-04
Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON...    44   7e-04
Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON...    44   7e-04
Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON} c...    43   8e-04
YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}  ...    44   8e-04
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    44   8e-04
AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON} S...    44   8e-04
SAKL0F11022g Chr6 (863614..864504) [891 bp, 296 aa] {ON} highly ...    43   8e-04
SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {...    44   8e-04
TBLA0F02400 Chr6 complement(590293..591189) [897 bp, 298 aa] {ON...    43   8e-04
Kwal_56.24596 s56 complement(1068314..1069198) [885 bp, 294 aa] ...    43   8e-04
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    44   8e-04
KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {O...    43   9e-04
Suva_2.537 Chr2 complement(959258..960625) [1368 bp, 455 aa] {ON...    43   9e-04
Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON...    44   9e-04
NDAI0A05790 Chr1 (1315884..1317374) [1491 bp, 496 aa] {ON}             43   9e-04
TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.4...    43   0.001
Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa] ...    43   0.001
Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364...    43   0.001
SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly...    43   0.001
NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON...    43   0.001
ADL322C Chr4 complement(128828..130333) [1506 bp, 501 aa] {ON} S...    43   0.001
TBLA0E04570 Chr5 (1163562..1165349) [1788 bp, 595 aa] {ON} Anc_4...    43   0.001
TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.1...    43   0.001
Skud_4.283 Chr4 complement(493677..495191) [1515 bp, 504 aa] {ON...    43   0.001
TPHA0F02890 Chr6 complement(640553..641440) [888 bp, 295 aa] {ON...    42   0.001
NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {O...    43   0.001
TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa] ...    43   0.001
ACR116W Chr3 (555946..557307) [1362 bp, 453 aa] {ON} Syntenic ho...    43   0.001
TPHA0I00460 Chr9 (89882..91564) [1683 bp, 560 aa] {ON} Anc_8.817...    43   0.001
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    43   0.001
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    43   0.001
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    43   0.001
Smik_12.266 Chr12 (506562..507455) [894 bp, 297 aa] {ON} YLR208W...    42   0.001
NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {O...    42   0.001
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    43   0.001
Smik_16.106 Chr16 (194195..196564) [2370 bp, 789 aa] {ON} YGR200...    43   0.001
TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {O...    42   0.002
YLR208W Chr12 (559551..560444) [894 bp, 297 aa] {ON}  SEC13Struc...    42   0.002
Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}...    43   0.002
Kpol_530.39 s530 (90456..91340) [885 bp, 294 aa] {ON} (90456..91...    42   0.002
Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON...    43   0.002
KNAG0A03070 Chr1 complement(378279..379604) [1326 bp, 441 aa] {O...    42   0.002
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...    42   0.002
KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {...    42   0.002
TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.5...    42   0.002
KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]...    42   0.002
TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {O...    42   0.002
CAGL0M08646g Chr13 (861488..862501) [1014 bp, 337 aa] {ON} simil...    42   0.002
Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]...    42   0.002
Suva_7.279 Chr7 complement(484066..485766) [1701 bp, 566 aa] {ON...    42   0.002
NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON}             42   0.002
Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272...    42   0.002
ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly...    42   0.002
KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.2...    42   0.002
Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON...    42   0.002
SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {...    42   0.002
KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {O...    42   0.002
TPHA0A03100 Chr1 (679875..683672) [3798 bp, 1265 aa] {ON} Anc_7....    42   0.002
KLTH0D12276g Chr4 (998921..1000258) [1338 bp, 445 aa] {ON} highl...    42   0.002
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    42   0.002
TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {O...    42   0.002
Skud_11.7 Chr11 complement(15413..17566) [2154 bp, 717 aa] {ON} ...    42   0.002
NCAS0B01430 Chr2 (233965..235317) [1353 bp, 450 aa] {ON}               42   0.002
Kwal_56.24332 s56 (959476..960732) [1257 bp, 418 aa] {ON} YPL247...    42   0.003
TPHA0F03650 Chr6 (793481..795703) [2223 bp, 740 aa] {ON} Anc_1.5...    42   0.003
NCAS0J01110 Chr10 (189535..191322) [1788 bp, 595 aa] {ON}              42   0.003
Skud_4.530 Chr4 complement(945231..946247) [1017 bp, 338 aa] {ON...    42   0.003
KNAG0G00130 Chr7 complement(8702..10888) [2187 bp, 728 aa] {ON} ...    42   0.003
AFL007C Chr6 complement(424004..425659) [1656 bp, 551 aa] {ON} S...    42   0.003
Suva_2.181 Chr2 complement(312873..314396) [1524 bp, 507 aa] {ON...    42   0.003
KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}...    42   0.003
TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {O...    42   0.003
KAFR0G01890 Chr7 (400922..402274) [1353 bp, 450 aa] {ON}               42   0.003
Kpol_1054.60 s1054 (148854..151013) [2160 bp, 719 aa] {ON} (1488...    42   0.003
KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} simi...    42   0.003
Kpol_1061.6 s1061 complement(19407..20762) [1356 bp, 451 aa] {ON...    42   0.003
KNAG0C01410 Chr3 (277054..279015) [1962 bp, 653 aa] {ON} Anc_1.2...    42   0.003
Smik_4.265 Chr4 complement(483300..484820) [1521 bp, 506 aa] {ON...    42   0.003
Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W (...    42   0.003
YDR030C Chr4 complement(501753..503273) [1521 bp, 506 aa] {ON}  ...    42   0.003
Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR17...    41   0.003
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    41   0.003
TDEL0A06650 Chr1 (1160677..1162032) [1356 bp, 451 aa] {ON} Anc_8...    41   0.003
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    41   0.003
KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON} Anc_7...    42   0.003
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    42   0.003
KLLA0E24487g Chr5 complement(2175775..2176758) [984 bp, 327 aa] ...    41   0.003
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    42   0.003
CAGL0I03454g Chr9 (292823..293734) [912 bp, 303 aa] {ON} similar...    41   0.003
CAGL0A04037g Chr1 complement(404063..405814) [1752 bp, 583 aa] {...    41   0.003
AGR207C Chr7 complement(1146704..1147666) [963 bp, 320 aa] {ON} ...    41   0.004
TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7....    42   0.004
KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly...    41   0.004
NCAS0E02840 Chr5 (558336..560159) [1824 bp, 607 aa] {ON} Anc_7.3...    41   0.004
Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON...    41   0.004
YDR364C Chr4 complement(1202843..1204210) [1368 bp, 455 aa] {ON}...    41   0.004
NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {O...    41   0.004
KLLA0E11331g Chr5 complement(994770..996308) [1539 bp, 512 aa] {...    41   0.004
Skud_12.272 Chr12 (506157..507050) [894 bp, 297 aa] {ON} YLR208W...    40   0.004
AER081C Chr5 complement(785301..788372) [3072 bp, 1023 aa] {ON} ...    41   0.004
KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {O...    41   0.004
SAKL0B02244g Chr2 (212226..214547) [2322 bp, 773 aa] {ON} simila...    41   0.005
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    41   0.005
CAGL0J01287g Chr10 (120215..122047) [1833 bp, 610 aa] {ON} simil...    41   0.005
Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar...    41   0.005
NDAI0A02880 Chr1 (644069..647938) [3870 bp, 1289 aa] {ON} Anc_7....    41   0.005
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    41   0.005
KLTH0D10648g Chr4 (875331..875337,875409..876751) [1350 bp, 449 ...    41   0.005
Ecym_3243 Chr3 (460611..463448) [2838 bp, 945 aa] {ON} similar t...    41   0.005
Ecym_7028 Chr7 (52132..52136,52211..54083) [1878 bp, 625 aa] {ON...    41   0.005
NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON} Anc_4...    41   0.005
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    41   0.005
Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429...    41   0.005
CAGL0K00275g Chr11 complement(26129..28276) [2148 bp, 715 aa] {O...    41   0.005
Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON} (27192....    41   0.005
YOR229W Chr15 (768409..769812) [1404 bp, 467 aa] {ON}  WTM2Trans...    41   0.005
NCAS0H00700 Chr8 (125259..126152) [894 bp, 297 aa] {ON} Anc_7.33...    40   0.006
CAGL0J08998g Chr10 (884779..888624) [3846 bp, 1281 aa] {ON} high...    41   0.006
KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {...    41   0.006
KNAG0G02820 Chr7 (623677..625050) [1374 bp, 457 aa] {ON} Anc_8.7...    40   0.006
Smik_15.413 Chr15 (718053..719462) [1410 bp, 469 aa] {ON} YOR229...    40   0.006
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...    41   0.006
KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highl...    40   0.006
Kwal_33.15591 s33 (1174119..1176263) [2145 bp, 714 aa] {ON} YKL2...    41   0.006
CAGL0M06193g Chr13 (643917..644867) [951 bp, 316 aa] {ON} simila...    40   0.006
NDAI0D00630 Chr4 (139065..139967) [903 bp, 300 aa] {ON} Anc_7.33...    40   0.007
ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} simi...    40   0.007
Kwal_47.17567 s47 complement(459443..461215) [1773 bp, 590 aa] {...    40   0.007
SAKL0H07150g Chr8 complement(626019..627341,627428..627430) [132...    40   0.007
CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highl...    40   0.007
Smik_4.518 Chr4 complement(935380..936372) [993 bp, 330 aa] {ON}...    40   0.007
SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, ...    40   0.007
Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa] ...    40   0.007
CAGL0J04818g Chr10 (458449..460413) [1965 bp, 654 aa] {ON} highl...    40   0.008
Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429...    40   0.008
NDAI0G00150 Chr7 complement(18719..20887) [2169 bp, 722 aa] {ON}...    40   0.008
YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}  ...    40   0.008
NDAI0J02410 Chr10 complement(586395..589244) [2850 bp, 949 aa] {...    40   0.008
SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {O...    40   0.008
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...    40   0.008
KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa] ...    40   0.008
AER448W Chr5 (1497416..1499560) [2145 bp, 714 aa] {ON} Syntenic ...    40   0.008
KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.3...    40   0.008
KLLA0F27511g Chr6 (2546533..2548404) [1872 bp, 623 aa] {ON} simi...    40   0.009
KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363...    40   0.009
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    40   0.009
Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}...    40   0.009
SAKL0H05456g Chr8 complement(490546..491886) [1341 bp, 446 aa] {...    40   0.009
TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7....    40   0.009
ZYRO0B13838g Chr2 (1121025..1123079) [2055 bp, 684 aa] {ON} some...    40   0.010
Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON...    40   0.010
Smik_15.454 Chr15 (782403..783788) [1386 bp, 461 aa] {ON} YOR272...    40   0.010
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    40   0.010
Suva_8.265 Chr8 (481783..483054) [1272 bp, 423 aa] {ON} YOR212W ...    40   0.011
KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} high...    40   0.011
Ecym_3481 Chr3 complement(897444..898958) [1515 bp, 504 aa] {ON}...    40   0.011
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    40   0.012
Kwal_23.4118 s23 (579251..582070) [2820 bp, 939 aa] {ON} YLR409C...    40   0.012
KLTH0H01518g Chr8 (138469..139353) [885 bp, 294 aa] {ON} highly ...    39   0.012
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    40   0.012
ABR101C Chr2 complement(567358..569841) [2484 bp, 827 aa] {ON} S...    40   0.012
Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429...    40   0.012
AER337W Chr5 (1256750..1258087) [1338 bp, 445 aa] {ON} Syntenic ...    40   0.012
AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}...    40   0.012
KLLA0C07425g Chr3 complement(647673..649007) [1335 bp, 444 aa] {...    39   0.013
ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408) ...    39   0.013
NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON} Anc_...    40   0.013
Smik_15.398 Chr15 (692606..693883) [1278 bp, 425 aa] {ON} YOR212...    39   0.013
ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON} S...    39   0.013
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    40   0.013
NDAI0E04440 Chr5 (1002113..1003858) [1746 bp, 581 aa] {ON} Anc_7...    40   0.014
SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 ...    40   0.014
YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coron...    39   0.014
TDEL0E00950 Chr5 (197384..200206) [2823 bp, 940 aa] {ON} Anc_4.2...    40   0.014
NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {...    40   0.014
Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LS...    39   0.015
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    40   0.015
NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.5...    39   0.015
Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa] ...    39   0.015
TDEL0C01920 Chr3 (337685..339376) [1692 bp, 563 aa] {ON} Anc_7.3...    39   0.015
SAKL0A10406g Chr1 (910452..912587) [2136 bp, 711 aa] {ON} simila...    39   0.015
NCAS0A10500 Chr1 complement(2087347..2088783) [1437 bp, 478 aa] ...    39   0.016
SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly...    39   0.016
CAGL0J06512g Chr10 complement(622640..624277) [1638 bp, 545 aa] ...    39   0.016
YDR267C Chr4 complement(1002510..1003502) [993 bp, 330 aa] {ON} ...    39   0.016
Kwal_14.1710 s14 (433526..435250) [1725 bp, 574 aa] {ON} YGL116W...    39   0.016
KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa] ...    39   0.016
KLLA0A04928g Chr1 (439349..441934) [2586 bp, 861 aa] {ON} simila...    39   0.017
KAFR0G01900 Chr7 (403294..404574) [1281 bp, 426 aa] {ON}               39   0.018
TBLA0C00990 Chr3 (195791..196972) [1182 bp, 393 aa] {ON} Anc_2.6...    39   0.018
KLTH0A02750g Chr1 complement(239284..241545) [2262 bp, 753 aa] {...    39   0.019
Smik_12.495 Chr12 complement(873068..875887) [2820 bp, 939 aa] {...    39   0.019
Suva_10.525 Chr10 complement(900164..902983) [2820 bp, 939 aa] {...    39   0.019
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    39   0.019
CAGL0A02772g Chr1 complement(293966..295291) [1326 bp, 441 aa] {...    39   0.019
YOR212W Chr15 (742910..744181) [1272 bp, 423 aa] {ON}  STE4G pro...    39   0.020
KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa] ...    39   0.020
NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534      39   0.020
NCAS0A07270 Chr1 complement(1442956..1445355) [2400 bp, 799 aa] ...    39   0.021
TBLA0G02090 Chr7 (545989..547911) [1923 bp, 640 aa] {ON} Anc_4.3...    39   0.022
Skud_15.395 Chr15 (707395..708789) [1395 bp, 464 aa] {ON} YOR229...    39   0.022
TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [...    39   0.022
Smik_12.256 Chr12 (490929..492659) [1731 bp, 576 aa] {ON} YLR196...    39   0.023
NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {O...    39   0.023
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...    39   0.023
TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {...    39   0.024
NDAI0E00910 Chr5 complement(182574..183968) [1395 bp, 464 aa] {O...    39   0.024
KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]...    39   0.024
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    39   0.024
KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {O...    39   0.026
Smik_13.32 Chr13 (64435..65841) [1407 bp, 468 aa] {ON} YML102W (...    39   0.027
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    39   0.027
Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON...    38   0.027
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    39   0.027
KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} simi...    39   0.027
TDEL0C00940 Chr3 (150797..152719) [1923 bp, 640 aa] {ON} Anc_8.6...    39   0.027
TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa] ...    39   0.028
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    39   0.028
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    39   0.029
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    39   0.029
Suva_7.494 Chr7 complement(856266..858641) [2376 bp, 791 aa] {ON...    39   0.030
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    39   0.030
KNAG0G01080 Chr7 (235280..237520) [2241 bp, 746 aa] {ON}  YER066W      39   0.030
TPHA0D00580 Chr4 (100671..102869) [2199 bp, 732 aa] {ON} Anc_8.6...    39   0.030
KNAG0D01690 Chr4 (286791..288755) [1965 bp, 654 aa] {ON} Anc_7.2...    39   0.030
YLR196W Chr12 (543968..545698) [1731 bp, 576 aa] {ON}  PWP1Prote...    39   0.030
CAGL0L10890g Chr12 (1165380..1166753) [1374 bp, 457 aa] {ON} hig...    38   0.031
ZYRO0F14960g Chr6 complement(1228479..1229438) [960 bp, 319 aa] ...    38   0.031
CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa] ...    39   0.031
KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {O...    39   0.033
KNAG0B02580 Chr2 (501215..502957) [1743 bp, 580 aa] {ON} Anc_7.3...    38   0.033
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    38   0.034
NDAI0J02490 Chr10 complement(613859..615748) [1890 bp, 629 aa] {...    38   0.035
Ecym_3619 Chr3 (1183531..1185666) [2136 bp, 711 aa] {ON} similar...    38   0.035
TBLA0D02630 Chr4 (645439..648027) [2589 bp, 862 aa] {ON} Anc_8.6...    38   0.036
KNAG0J02460 Chr10 complement(465585..466361) [777 bp, 258 aa] {O...    38   0.036
ZYRO0C11242g Chr3 complement(871160..872170) [1011 bp, 336 aa] {...    38   0.037
NDAI0D02250 Chr4 complement(526907..529294) [2388 bp, 795 aa] {O...    38   0.037
SAKL0G15994g Chr7 complement(1374780..1377614) [2835 bp, 944 aa]...    38   0.038
NCAS0J01860 Chr10 (350125..352011) [1887 bp, 628 aa] {ON} Anc_4....    38   0.039
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    38   0.039
TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.3...    38   0.039
KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly ...    38   0.040
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    38   0.040
ZYRO0F11374g Chr6 complement(934451..935983) [1533 bp, 510 aa] {...    38   0.040
KNAG0F02420 Chr6 complement(453743..455668) [1926 bp, 641 aa] {O...    38   0.040
CAGL0J03806g Chr10 (363777..365039) [1263 bp, 420 aa] {ON} simil...    38   0.041
Ecym_2287 Chr2 (558921..561386) [2466 bp, 821 aa] {ON} similar t...    38   0.042
KLLA0E07965g Chr5 (717476..718648) [1173 bp, 390 aa] {ON} simila...    38   0.042
CAGL0E02805g Chr5 complement(265374..267896) [2523 bp, 840 aa] {...    38   0.043
NCAS0A02800 Chr1 (533712..535517) [1806 bp, 601 aa] {ON} Anc_4.3...    38   0.043
YLR409C Chr12 complement(934414..937233) [2820 bp, 939 aa] {ON} ...    38   0.044
SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]...    38   0.044
KLTH0B00924g Chr2 complement(79302..81446) [2145 bp, 714 aa] {ON...    38   0.044
KAFR0A04110 Chr1 (826618..828000) [1383 bp, 460 aa] {ON} Anc_8.7...    38   0.044
TDEL0A00410 Chr1 complement(70940..74728) [3789 bp, 1262 aa] {ON...    38   0.046
TBLA0C02090 Chr3 complement(495831..498683) [2853 bp, 950 aa] {O...    38   0.047
KLLA0D07282g Chr4 (621115..622467) [1353 bp, 450 aa] {ON} simila...    38   0.048
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    38   0.048
Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON...    38   0.048
Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar...    38   0.049
TPHA0P00330 Chr16 (63488..65419) [1932 bp, 643 aa] {ON} Anc_8.67...    38   0.050
Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W (...    37   0.051
Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to...    37   0.055
SAKL0B11836g Chr2 complement(1020766..1023195) [2430 bp, 809 aa]...    38   0.056
CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highl...    38   0.058
Skud_12.493 Chr12 complement(874622..877441) [2820 bp, 939 aa] {...    38   0.059
Skud_12.261 Chr12 (490588..492330) [1743 bp, 580 aa] {ON} YLR196...    37   0.059
AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {...    37   0.061
AFL014C Chr6 complement(409496..411169) [1674 bp, 557 aa] {ON} S...    37   0.061
Kpol_1065.30 s1065 complement(61425..62993) [1569 bp, 522 aa] {O...    37   0.063
KNAG0C02890 Chr3 (571926..574418) [2493 bp, 830 aa] {ON} Anc_4.1...    37   0.065
TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.4...    37   0.066
NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 ...    37   0.066
Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)    37   0.070
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    37   0.070
TBLA0C04110 Chr3 complement(994729..997278) [2550 bp, 849 aa] {O...    37   0.075
Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093...    37   0.076
KLLA0B01958g Chr2 (170646..170663,170896..173550) [2673 bp, 890 ...    37   0.077
KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {O...    37   0.079
YML102W Chr13 (68294..69700) [1407 bp, 468 aa] {ON}  CAC2Subunit...    37   0.079
TPHA0E03760 Chr5 complement(791726..794116) [2391 bp, 796 aa] {O...    37   0.080
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    37   0.080
KLLA0E21781g Chr5 complement(1944865..1945866) [1002 bp, 333 aa]...    37   0.083
KNAG0B02670 Chr2 (517131..518042) [912 bp, 303 aa] {ON} Anc_7.33...    37   0.083
Skud_2.216 Chr2 complement(393230..394006) [777 bp, 258 aa] {ON}...    37   0.084
Suva_2.435 Chr2 complement(769135..770127) [993 bp, 330 aa] {ON}...    37   0.084
CAGL0L02629g Chr12 complement(309320..311707) [2388 bp, 795 aa] ...    37   0.086
Suva_4.335 Chr4 complement(593913..594689) [777 bp, 258 aa] {ON}...    36   0.086
Smik_2.229 Chr2 complement(408029..408805) [777 bp, 258 aa] {ON}...    36   0.086
YBR088C Chr2 complement(424990..425766) [777 bp, 258 aa] {ON}  P...    36   0.086
TBLA0D04870 Chr4 complement(1194448..1195431) [984 bp, 327 aa] {...    37   0.087
KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {O...    37   0.088
ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON} S...    37   0.088
Kwal_23.5035 s23 (975572..977806) [2235 bp, 744 aa] {ON} YFL009W...    37   0.088
TDEL0A02070 Chr1 (372046..372582,372798..373220) [960 bp, 319 aa...    37   0.089
KAFR0L01440 Chr12 complement(266463..267377) [915 bp, 304 aa] {O...    37   0.093
Kpol_1055.64 s1055 (170524..173340) [2817 bp, 938 aa] {ON} (1705...    37   0.097
Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa] ...    37   0.098
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    37   0.099
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    37   0.10 
ACR194C Chr3 complement(690186..691727) [1542 bp, 513 aa] {ON} S...    37   0.10 
YMR049C Chr13 complement(368094..370517) [2424 bp, 807 aa] {ON} ...    37   0.10 
KAFR0I01050 Chr9 complement(205792..208320) [2529 bp, 842 aa] {O...    37   0.11 
NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON}      36   0.11 
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    37   0.11 
CAGL0M02563g Chr13 complement(295156..296529) [1374 bp, 457 aa] ...    37   0.11 
ADR108C Chr4 complement(899198..900097) [900 bp, 299 aa] {ON} NO...    36   0.12 
TBLA0C01740 Chr3 (409315..410889) [1575 bp, 524 aa] {ON} Anc_8.6...    37   0.12 
KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 a...    36   0.13 
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    36   0.13 
TDEL0B07580 Chr2 (1329080..1330252) [1173 bp, 390 aa] {ON} Anc_2...    36   0.13 
Skud_9.123 Chr9 (237466..239385) [1920 bp, 639 aa] {ON} YIL046W ...    36   0.14 
NDAI0C00170 Chr3 complement(24683..25888) [1206 bp, 401 aa] {ON}...    36   0.14 
Skud_13.39 Chr13 (67722..69146) [1425 bp, 474 aa] {ON} YML102W (...    36   0.14 
TBLA0I00360 Chr9 (56206..57300) [1095 bp, 364 aa] {ON} Anc_7.405...    36   0.15 
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    36   0.15 
Suva_14.89 Chr14 (164766..166034) [1269 bp, 422 aa] {ON} YNL253W...    36   0.15 
NCAS0B01020 Chr2 complement(161030..162634) [1605 bp, 534 aa] {O...    36   0.16 
Suva_11.7 Chr11 complement(15456..17615) [2160 bp, 719 aa] {ON} ...    36   0.16 
KNAG0A04990 Chr1 complement(726567..727844) [1278 bp, 425 aa] {O...    36   0.16 
Suva_8.280 Chr8 (507390..508796) [1407 bp, 468 aa] {ON} YOR229W ...    36   0.16 
TPHA0F00550 Chr6 complement(127250..129736) [2487 bp, 828 aa] {O...    36   0.16 
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    36   0.17 
KNAG0G00800 Chr7 (147792..150164) [2373 bp, 790 aa] {ON} Anc_5.1...    36   0.17 
TBLA0B04390 Chr2 (1014987..1015997) [1011 bp, 336 aa] {ON} Anc_8...    36   0.17 
Skud_15.379 Chr15 (681934..683211) [1278 bp, 425 aa] {ON} YOR212...    36   0.17 
TPHA0D01130 Chr4 (236199..237554) [1356 bp, 451 aa] {ON} Anc_8.6...    36   0.18 
TDEL0F02410 Chr6 complement(447058..449568) [2511 bp, 836 aa] {O...    36   0.18 
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    36   0.18 
Smik_2.377 Chr2 complement(671569..672723) [1155 bp, 384 aa] {ON...    36   0.19 
KLLA0F26653g Chr6 (2461876..2464251) [2376 bp, 791 aa] {ON} simi...    36   0.19 
CAGL0K11836g Chr11 complement(1143042..1144610) [1569 bp, 522 aa...    36   0.19 
ACR091W Chr3 (520609..521595) [987 bp, 328 aa] {ON} Syntenic hom...    35   0.20 
YBR103W Chr2 (447709..449316) [1608 bp, 535 aa] {ON}  SIF2WD40 r...    36   0.20 
Smik_4.631 Chr4 complement(1128746..1130113) [1368 bp, 455 aa] {...    36   0.20 
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    36   0.20 
TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.3...    36   0.20 
TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.5...    36   0.21 
NDAI0B05630 Chr2 complement(1376242..1377549) [1308 bp, 435 aa] ...    35   0.21 
Ecym_6228 Chr6 (425765..427102) [1338 bp, 445 aa] {ON} similar t...    35   0.21 
Skud_7.135 Chr7 (254246..254263,254479..257154) [2694 bp, 897 aa...    36   0.21 
TDEL0F01740 Chr6 complement(322088..325102) [3015 bp, 1004 aa] {...    36   0.21 
YBR175W Chr2 (582408..583355) [948 bp, 315 aa] {ON}  SWD3Essenti...    35   0.22 
KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly...    36   0.22 
Kpol_1032.61 s1032 (141357..143825) [2469 bp, 822 aa] {ON} (1413...    36   0.22 
Kwal_56.24661 s56 complement(1093040..1094725) [1686 bp, 561 aa]...    35   0.22 
NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 ...    35   0.22 
NCAS0J01650 Chr10 complement(294247..297069) [2823 bp, 940 aa] {...    36   0.22 
ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON...    35   0.23 
Suva_8.281 Chr8 (509873..511183) [1311 bp, 436 aa] {ON} YOR230W ...    35   0.24 
KAFR0A05800 Chr1 (1177423..1180245) [2823 bp, 940 aa] {ON} Anc_4...    36   0.24 
KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.2...    35   0.24 
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    35   0.24 
NCAS0I01270 Chr9 (229975..230754) [780 bp, 259 aa] {ON} Anc_3.33...    35   0.25 
ZYRO0G10054g Chr7 (802784..805312) [2529 bp, 842 aa] {ON} simila...    35   0.25 
NCAS0A09610 Chr1 complement(1920171..1922258) [2088 bp, 695 aa] ...    35   0.26 
NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa...    35   0.26 
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    35   0.26 
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    35   0.27 
TPHA0J01890 Chr10 (430218..432287) [2070 bp, 689 aa] {ON} Anc_6....    35   0.28 
YBL008W Chr2 (209653..212175) [2523 bp, 840 aa] {ON}  HIR1Subuni...    35   0.28 
Suva_2.117 Chr2 (203652..206174) [2523 bp, 840 aa] {ON} YBL008W ...    35   0.30 
NCAS0A03470 Chr1 (684361..686811) [2451 bp, 816 aa] {ON} Anc_4.106     35   0.30 
YGR200C Chr7 complement(899904..902270) [2367 bp, 788 aa] {ON}  ...    35   0.31 
ACR166W Chr3 (647933..649102) [1170 bp, 389 aa] {ON} Syntenic ho...    35   0.31 
Smik_2.112 Chr2 (202544..205069) [2526 bp, 841 aa] {ON} YBL008W ...    35   0.32 
ZYRO0F03784g Chr6 (314914..317247) [2334 bp, 777 aa] {ON} simila...    35   0.33 
Kpol_530.25 s530 (67445..69169) [1725 bp, 574 aa] {ON} (67445..6...    35   0.33 
Skud_2.103 Chr2 (193155..195677) [2523 bp, 840 aa] {ON} YBL008W ...    35   0.33 
Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar t...    35   0.33 
NDAI0E00410 Chr5 (72769..74559) [1791 bp, 596 aa] {ON} Anc_8.817...    35   0.34 
SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]...    35   0.34 
SAKL0D03740g Chr4 (303240..304676) [1437 bp, 478 aa] {ON} simila...    35   0.34 
Suva_4.491 Chr4 complement(855726..856880) [1155 bp, 384 aa] {ON...    35   0.34 
NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON} Anc_7...    35   0.35 
YBR234C Chr2 complement(685438..686592) [1155 bp, 384 aa] {ON}  ...    35   0.35 
Suva_4.427 Chr4 (751909..752856) [948 bp, 315 aa] {ON} YBR175W (...    35   0.37 
NCAS0H03530 Chr8 (671246..672400) [1155 bp, 384 aa] {ON} Anc_2.663     35   0.37 
Smik_15.414 Chr15 (720454..721767) [1314 bp, 437 aa] {ON} YOR230...    35   0.38 
NDAI0A03310 Chr1 (750920..753373) [2454 bp, 817 aa] {ON} Anc_4.106     35   0.39 
TDEL0A05970 Chr1 (1047306..1048733) [1428 bp, 475 aa] {ON} Anc_8...    35   0.39 
KAFR0E00180 Chr5 complement(35535..37721) [2187 bp, 728 aa] {ON}...    35   0.40 
Kwal_55.21559 s55 complement(889630..890685) [1056 bp, 351 aa] {...    35   0.41 
Kpol_1057.12 s1057 (22322..23515) [1194 bp, 397 aa] {ON} (22322....    35   0.41 
TPHA0F03030 Chr6 complement(661801..663549) [1749 bp, 582 aa] {O...    35   0.42 
KLTH0E07700g Chr5 (705358..707778) [2421 bp, 806 aa] {ON} simila...    35   0.42 
TDEL0B00800 Chr2 (152025..153452) [1428 bp, 475 aa] {ON} Anc_8.8...    35   0.44 
KAFR0G01610 Chr7 complement(355067..355843) [777 bp, 258 aa] {ON...    34   0.44 
Kwal_47.17465 s47 (415977..418379) [2403 bp, 800 aa] {ON} YBL008...    35   0.44 
Kpol_1045.33 s1045 (77282..78367) [1086 bp, 361 aa] {ON} (77284....    34   0.45 
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    35   0.46 
TBLA0B02560 Chr2 (586575..587351) [777 bp, 258 aa] {ON} Anc_3.33...    34   0.46 
Kwal_26.7738 s26 (493416..495251) [1836 bp, 611 aa] {ON} YMR092C...    35   0.47 
KLTH0H05962g Chr8 (525898..527019) [1122 bp, 373 aa] {ON} highly...    34   0.47 
NDAI0I01440 Chr9 (343925..345076) [1152 bp, 383 aa] {ON} Anc_6.1...    34   0.47 
NCAS0B01660 Chr2 complement(270046..271320) [1275 bp, 424 aa] {O...    34   0.48 
NCAS0C01570 Chr3 (289762..291063) [1302 bp, 433 aa] {ON}               34   0.48 
Skud_2.366 Chr2 complement(654186..655340) [1155 bp, 384 aa] {ON...    34   0.50 
TBLA0A06060 Chr1 (1493832..1493849,1494107..1496755) [2667 bp, 8...    35   0.51 
Kwal_14.884 s14 complement(95068..96255) [1188 bp, 395 aa] {ON} ...    34   0.51 
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    35   0.52 
NDAI0F02240 Chr6 (542551..545610) [3060 bp, 1019 aa] {ON} Anc_6....    35   0.52 
KNAG0F00620 Chr6 (105380..106768) [1389 bp, 462 aa] {ON} Anc_1.1...    34   0.53 
TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON}               34   0.54 
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    34   0.54 
CAGL0L00781g Chr12 (97503..99524) [2022 bp, 673 aa] {ON} similar...    34   0.55 
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    35   0.55 
YER107C Chr5 complement(373448..374545) [1098 bp, 365 aa] {ON}  ...    34   0.58 
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    34   0.58 
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    34   0.58 
YGL137W Chr7 (249869..249886,250087..252738) [2670 bp, 889 aa] {...    34   0.59 
TPHA0D04530 Chr4 complement(988612..989496) [885 bp, 294 aa] {ON...    34   0.60 
KLTH0C06358g Chr3 (556638..557741) [1104 bp, 367 aa] {ON} highly...    34   0.61 
KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672) [...    34   0.63 
NCAS0C05310 Chr3 complement(1079501..1080550) [1050 bp, 349 aa] ...    34   0.63 
TPHA0G00680 Chr7 complement(127929..129302) [1374 bp, 457 aa] {O...    34   0.64 
Smik_15.204 Chr15 (345627..346652) [1026 bp, 341 aa] {ON} YOR026...    34   0.64 
KNAG0C03490 Chr3 (684848..685936) [1089 bp, 362 aa] {ON} Anc_7.4...    34   0.64 
TPHA0E00770 Chr5 (154048..155115) [1068 bp, 355 aa] {ON} Anc_7.4...    34   0.68 
TBLA0A01870 Chr1 (455007..458021) [3015 bp, 1004 aa] {ON} Anc_6....    34   0.68 
TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {O...    34   0.68 
KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {O...    34   0.68 
ZYRO0C03190g Chr3 (245542..249363) [3822 bp, 1273 aa] {ON} simil...    34   0.71 
CAGL0J08778g Chr10 (868299..869195) [897 bp, 298 aa] {ON} highly...    33   0.71 
NCAS0A14470 Chr1 complement(2848835..2849923) [1089 bp, 362 aa] ...    34   0.72 
Ecym_7229 Chr7 (475040..477529) [2490 bp, 829 aa] {ON} similar t...    34   0.73 
KAFR0F03630 Chr6 complement(718854..720935) [2082 bp, 693 aa] {O...    34   0.76 
Smik_7.135 Chr7 (244035..244445,244446..246698) [2664 bp, 887 aa...    34   0.78 
NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON} Anc_1...    34   0.79 
ZYRO0C15730g Chr3 complement(1232565..1233341) [777 bp, 258 aa] ...    33   0.79 
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    34   0.81 
CAGL0K07095g Chr11 (698857..699972) [1116 bp, 371 aa] {ON} highl...    33   0.82 
Ecym_7149 Chr7 (308042..309139) [1098 bp, 365 aa] {ON} similar t...    33   0.82 
KNAG0B06260 Chr2 complement(1228060..1230876) [2817 bp, 938 aa] ...    34   0.84 
Suva_7.127 Chr7 (246249..246659,246660..248924) [2676 bp, 891 aa...    34   0.84 
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    34   0.85 
Kwal_27.10385 s27 (317980..319590) [1611 bp, 536 aa] {ON} YML102...    34   0.86 
CAGL0F06853g Chr6 (671942..673108) [1167 bp, 388 aa] {ON} highly...    33   0.86 
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    34   0.87 
KLLA0E18899g Chr5 (1680775..1683747) [2973 bp, 990 aa] {ON} simi...    34   0.89 
CAGL0K00957g Chr11 (95657..98038) [2382 bp, 793 aa] {ON} similar...    34   0.90 
NCAS0A13430 Chr1 complement(2641588..2643414) [1827 bp, 608 aa] ...    33   0.91 
KLLA0B02827g Chr2 (254447..257275) [2829 bp, 942 aa] {ON} highly...    34   0.91 
KAFR0H02550 Chr8 complement(487226..488521) [1296 bp, 431 aa] {O...    33   0.92 
CAGL0D01716g Chr4 (179249..180025) [777 bp, 258 aa] {ON} highly ...    33   0.93 
KLLA0E20703g Chr5 complement(1841092..1842207) [1116 bp, 371 aa]...    33   0.93 
KAFR0H00550 Chr8 (97619..98683) [1065 bp, 354 aa] {ON} Anc_5.631...    33   1.00 
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    33   1.0  
Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C ...    33   1.1  
CAGL0B00748g Chr2 (65727..68165) [2439 bp, 812 aa] {ON} similar ...    33   1.1  
Ecym_5501 Chr5 (1021675..1022658) [984 bp, 327 aa] {ON} similar ...    33   1.1  
CAGL0M13409g Chr13 complement(1317818..1322401) [4584 bp, 1527 a...    33   1.1  
NDAI0I01520 Chr9 complement(358776..360710) [1935 bp, 644 aa] {O...    33   1.1  
Kpol_1041.35 s1041 complement(87507..89612) [2106 bp, 701 aa] {O...    33   1.1  
NDAI0A00340 Chr1 (50320..53166) [2847 bp, 948 aa] {ON} Anc_1.34 ...    33   1.2  
KAFR0A04480 Chr1 (889486..890616) [1131 bp, 376 aa] {ON} Anc_6.1...    33   1.2  
KNAG0D03740 Chr4 complement(680549..682639) [2091 bp, 696 aa] {O...    33   1.2  
KLLA0F13772g Chr6 (1276532..1278094) [1563 bp, 520 aa] {ON} high...    33   1.2  
TBLA0A09610 Chr1 (2369818..2370978) [1161 bp, 386 aa] {ON} Anc_5...    33   1.2  
SAKL0H21846g Chr8 (1905888..1908134) [2247 bp, 748 aa] {ON} simi...    33   1.2  
Ecym_5635 Chr5 (1285780..1286937) [1158 bp, 385 aa] {ON} similar...    33   1.2  
Smik_2.315 Chr2 (568572..569519) [948 bp, 315 aa] {ON} YBR175W (...    33   1.2  
NDAI0A01560 Chr1 (352038..353129) [1092 bp, 363 aa] {ON} Anc_5.6...    33   1.3  
NCAS0D03330 Chr4 (623172..625046) [1875 bp, 624 aa] {ON} Anc_6.135     33   1.3  
KLTH0H01122g Chr8 (113798..115537) [1740 bp, 579 aa] {ON} simila...    33   1.3  
TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {O...    33   1.3  
TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {O...    33   1.3  
CAGL0C01441g Chr3 complement(156930..159947) [3018 bp, 1005 aa] ...    33   1.3  
NDAI0I00880 Chr9 complement(203097..205763) [2667 bp, 888 aa] {O...    33   1.3  
NCAS0I02490 Chr9 complement(465916..467796) [1881 bp, 626 aa] {O...    33   1.4  
KAFR0B04210 Chr2 (874621..875803,875906..876507) [1785 bp, 594 a...    33   1.4  
ABL043W Chr2 (314670..316490) [1821 bp, 606 aa] {ON} Syntenic ho...    33   1.4  
Kpol_1070.11 s1070 (30012..32012) [2001 bp, 666 aa] {ON} (30012....    33   1.4  
TPHA0A03680 Chr1 complement(804355..806004) [1650 bp, 549 aa] {O...    33   1.5  
Kpol_264.9 s264 complement(18422..19198) [777 bp, 258 aa] {ON} c...    33   1.5  
NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {O...    33   1.5  
Kpol_1018.103 s1018 complement(268887..269966) [1080 bp, 359 aa]...    33   1.5  
SAKL0C01188g Chr3 (104624..106948) [2325 bp, 774 aa] {ON} simila...    33   1.5  
TDEL0A04820 Chr1 (848835..849815) [981 bp, 326 aa] {ON} Anc_5.61...    33   1.5  
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    33   1.6  
TPHA0M01470 Chr13 complement(313985..314761) [777 bp, 258 aa] {O...    32   1.6  
Skud_15.396 Chr15 (709746..711059) [1314 bp, 437 aa] {ON} YOR230...    33   1.7  
CAGL0M09845g Chr13 (975007..977817) [2811 bp, 936 aa] {ON} highl...    33   1.7  
Suva_13.43 Chr13 (68221..68556,68574..69404) [1167 bp, 388 aa] {...    33   1.7  
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    33   1.8  
Kwal_26.8953 s26 (1017811..1019187) [1377 bp, 458 aa] {ON} YOR26...    33   1.8  
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    33   1.8  
KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {O...    33   1.9  
KLLA0C01177g Chr3 (89978..92131) [2154 bp, 717 aa] {ON} similar ...    33   1.9  
TPHA0N01850 Chr14 (393690..394910) [1221 bp, 406 aa] {ON} Anc_2....    32   1.9  
ZYRO0B12980g Chr2 complement(1045283..1048102) [2820 bp, 939 aa]...    33   1.9  
NDAI0A07740 Chr1 complement(1781144..1781920) [777 bp, 258 aa] {...    32   1.9  
KNAG0H00180 Chr8 complement(26550..27719) [1170 bp, 389 aa] {ON}...    32   1.9  
Kpol_361.3 s361 complement(3792..5675) [1884 bp, 627 aa] {ON} co...    33   2.0  
CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} simila...    33   2.0  
YOR230W Chr15 (770800..772113) [1314 bp, 437 aa] {ON}  WTM1Trans...    32   2.0  
NDAI0A02610 Chr1 (585697..588000) [2304 bp, 767 aa] {ON} Anc_7.231     33   2.0  
Kwal_27.10785 s27 (495263..496366) [1104 bp, 367 aa] {ON} YER107...    32   2.0  
KLTH0C00616g Chr3 complement(62501..63724) [1224 bp, 407 aa] {ON...    32   2.0  
KLTH0F01166g Chr6 (90708..92939) [2232 bp, 743 aa] {ON} similar ...    33   2.1  
TBLA0I01220 Chr9 (261925..263460) [1536 bp, 511 aa] {ON} Anc_2.4...    32   2.2  
ZYRO0F06314g Chr6 (526555..527850) [1296 bp, 431 aa] {ON} simila...    32   2.2  
NDAI0H02330 Chr8 complement(564240..567221) [2982 bp, 993 aa] {O...    32   2.3  
Skud_2.229 Chr2 (415869..417506) [1638 bp, 545 aa] {ON} YBR103W ...    32   2.4  
KNAG0C06240 Chr3 complement(1212466..1213533) [1068 bp, 355 aa] ...    32   2.4  
Smik_11.10 Chr11 complement(16139..18292) [2154 bp, 717 aa] {ON}...    32   2.4  
TBLA0B08980 Chr2 complement(2125687..2129208) [3522 bp, 1173 aa]...    32   2.4  
Suva_10.292 Chr10 (516694..518436) [1743 bp, 580 aa] {ON} YLR196...    32   2.5  
ZYRO0G09372g Chr7 (747001..749052) [2052 bp, 683 aa] {ON} simila...    32   2.5  
Smik_7.173 Chr7 (308539..309588) [1050 bp, 349 aa] {ON} YGL100W ...    32   2.6  
ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly ...    32   2.6  
Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093...    32   2.6  
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    32   2.7  
SAKL0G01628g Chr7 complement(133626..136505) [2880 bp, 959 aa] {...    32   2.7  
AGR168W Chr7 (1061516..1063993) [2478 bp, 825 aa] {ON} Syntenic ...    32   2.7  
ZYRO0D00616g Chr4 complement(47163..48347) [1185 bp, 394 aa] {ON...    32   2.8  
NCAS0F01450 Chr6 complement(287070..289796) [2727 bp, 908 aa] {O...    32   2.8  
KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.4...    32   2.9  
KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 ...    32   2.9  
KLLA0C07513g Chr3 complement(656060..657379) [1320 bp, 439 aa] {...    32   2.9  
KAFR0A00700 Chr1 (126326..128149) [1824 bp, 607 aa] {ON} Anc_2.4...    32   2.9  
NDAI0F04030 Chr6 complement(958364..959839) [1476 bp, 491 aa] {O...    32   3.0  
TPHA0J02160 Chr10 (484299..487313) [3015 bp, 1004 aa] {ON} Anc_6...    32   3.0  
KLLA0B14410g Chr2 (1264616..1266736) [2121 bp, 706 aa] {ON} simi...    32   3.1  
TPHA0B02080 Chr2 (477775..480600) [2826 bp, 941 aa] {ON} Anc_4.2...    32   3.1  
Ecym_7373 Chr7 complement(776909..779269) [2361 bp, 786 aa] {ON}...    32   3.1  
YMR102C Chr13 complement(469848..472352) [2505 bp, 834 aa] {ON} ...    32   3.2  
Kwal_33.13148 s33 (94593..96614) [2022 bp, 673 aa] {ON} YCL039W ...    32   3.3  
TDEL0C02650 Chr3 complement(460884..461978) [1095 bp, 364 aa] {O...    32   3.3  
Smik_5.253 Chr5 complement(382390..383487) [1098 bp, 365 aa] {ON...    32   3.4  
TBLA0D03580 Chr4 complement(885182..887353) [2172 bp, 723 aa] {O...    32   3.5  
AGL024W Chr7 (667533..669803) [2271 bp, 756 aa] {ON} Syntenic ho...    32   3.5  
Kwal_56.23035 s56 complement(373146..374420) [1275 bp, 424 aa] {...    32   3.6  
TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON} Anc_7...    32   3.6  
KAFR0G01170 Chr7 (265249..267603) [2355 bp, 784 aa] {ON} Anc_5.1...    32   3.7  
KLTH0C07634g Chr3 (654087..655364) [1278 bp, 425 aa] {ON} weakly...    32   3.7  
ZYRO0D16742g Chr4 complement(1385330..1387156) [1827 bp, 608 aa]...    32   3.7  
Kpol_262.1 s262 (224..2131) [1908 bp, 635 aa] {ON} (224..2131) [...    32   3.8  
KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {O...    32   3.8  
ZYRO0B03652g Chr2 complement(301728..302804) [1077 bp, 358 aa] {...    32   4.0  
NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {O...    32   4.0  
KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.2...    32   4.0  
YGL100W Chr7 (313234..314283) [1050 bp, 349 aa] {ON}  SEH1Compon...    31   4.2  
SAKL0H08932g Chr8 (763703..764647) [945 bp, 314 aa] {ON} similar...    31   4.2  
SAKL0H20922g Chr8 (1826071..1828179) [2109 bp, 702 aa] {ON} high...    32   4.3  
TPHA0F00520 Chr6 (121962..124103) [2142 bp, 713 aa] {ON} Anc_4.7...    32   4.5  
Ecym_2695 Chr2 complement(1343162..1344724) [1563 bp, 520 aa] {O...    31   4.6  
Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222...    32   4.6  
KLTH0F16764g Chr6 complement(1358483..1359478) [996 bp, 331 aa] ...    31   4.7  
KLTH0C04378g Chr3 (381355..382860) [1506 bp, 501 aa] {ON} simila...    31   4.7  
TPHA0G02840 Chr7 (604491..605033) [543 bp, 180 aa] {ON} Anc_2.43...    30   4.7  
CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa] ...    31   4.7  
CAGL0F07337g Chr6 complement(714870..716735) [1866 bp, 621 aa] {...    31   4.8  
AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON} S...    32   4.8  
KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3....    32   4.8  
TBLA0B04000 Chr2 complement(913726..915084) [1359 bp, 452 aa] {O...    31   5.1  
CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly ...    31   5.1  
Ecym_4343 Chr4 (733111..734862) [1752 bp, 583 aa] {ON} similar t...    31   5.1  
KAFR0A04080 Chr1 (820402..821889) [1488 bp, 495 aa] {ON} Anc_8.7...    31   5.4  
TPHA0F00240 Chr6 complement(44772..46340) [1569 bp, 522 aa] {ON}...    31   5.5  
TBLA0A04150 Chr1 (1027635..1029005) [1371 bp, 456 aa] {ON} Anc_8...    31   5.5  
AAL009C Chr1 complement(325785..326696) [912 bp, 303 aa] {ON} Sy...    31   5.5  
Smik_11.233 Chr11 complement(384291..385538) [1248 bp, 415 aa] {...    31   5.6  
Suva_7.519 Chr7 (900889..901503) [615 bp, 205 aa] {ON} YGR225W (...    30   5.7  
TBLA0G03080 Chr7 complement(817595..818923) [1329 bp, 442 aa] {O...    31   6.1  
TDEL0E05480 Chr5 complement(1002913..1005540,1005640..1005657) [...    31   6.1  
Suva_4.348 Chr4 (616802..618448) [1647 bp, 548 aa] {ON} YBR103W ...    31   6.4  
TDEL0A02460 Chr1 (439489..441321) [1833 bp, 610 aa] {ON} Anc_2.4...    31   6.5  
TBLA0B08930 Chr2 complement(2117704..2119536) [1833 bp, 610 aa] ...    31   6.5  
KLTH0A04114g Chr1 complement(344618..346594) [1977 bp, 658 aa] {...    31   6.5  
KLLA0A04653g Chr1 complement(417313..419415) [2103 bp, 700 aa] {...    31   6.5  
Skud_7.174 Chr7 (317467..318516) [1050 bp, 349 aa] {ON} YGL100W ...    31   6.5  
NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {...    31   6.6  
TDEL0A04970 Chr1 complement(877816..878817) [1002 bp, 333 aa] {O...    31   6.6  
KLTH0E08096g Chr5 complement(743809..745041) [1233 bp, 410 aa] {...    31   6.6  
SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {...    31   6.6  
Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {O...    31   6.9  
ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [269...    31   7.1  
TDEL0E04900 Chr5 complement(913381..915738) [2358 bp, 785 aa] {O...    31   7.2  
KNAG0D02720 Chr4 complement(489642..494267) [4626 bp, 1541 aa] {...    31   7.2  
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    31   7.5  
NCAS0H01060 Chr8 complement(197867..200875) [3009 bp, 1002 aa] {...    31   7.6  
TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {...    31   7.7  
ZYRO0G11660g Chr7 (924314..926665) [2352 bp, 783 aa] {ON} simila...    31   7.9  
Suva_5.228 Chr5 complement(347755..348852) [1098 bp, 365 aa] {ON...    30   8.0  
Skud_13.261 Chr13 complement(445193..447697) [2505 bp, 834 aa] {...    31   8.0  
TBLA0A01540 Chr1 complement(355418..357592) [2175 bp, 724 aa] {O...    30   8.5  
ACL116W Chr3 (140589..143003) [2415 bp, 804 aa] {ON} Syntenic ho...    30   8.6  
Suva_13.269 Chr13 complement(433166..435016) [1851 bp, 616 aa] {...    30   8.6  
Kwal_23.5769 s23 complement(1311598..1313481) [1884 bp, 627 aa] ...    30   8.7  
Ecym_1412 Chr1 (856549..858708) [2160 bp, 719 aa] {ON} similar t...    30   8.7  
NCAS0A04400 Chr1 (888188..890743) [2556 bp, 851 aa] {ON} Anc_2.4...    30   8.7  
KAFR0D01700 Chr4 complement(339178..340785) [1608 bp, 535 aa] {O...    30   9.1  
NCAS0H03450 Chr8 complement(653985..654968) [984 bp, 327 aa] {ON...    30   9.3  
Ecym_2282 Chr2 complement(552170..553879) [1710 bp, 569 aa] {ON}...    30   9.3  
Smik_13.289 Chr13 complement(454351..456864) [2514 bp, 837 aa] {...    30   9.4  
KNAG0E02460 Chr5 complement(488247..490064) [1818 bp, 605 aa] {O...    30   9.6  
YMR092C Chr13 complement(451632..453479) [1848 bp, 615 aa] {ON} ...    30   9.7  
CAGL0D02090g Chr4 (214357..214893,215564..215860) [834 bp, 277 a...    30   9.9  

>SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 398

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/381 (92%), Positives = 354/381 (92%)

Query: 18  LWKTNVPLMYDFVSETKLTWPSLTIQWLPGNSSSTKQEMILGTHTSGEDDNYLKIASIEL 77
           LWKTNVPLMYDFVSETKLTWPSLTIQWLPGNSSSTKQEMILGTHTSGEDDNYLKIASIEL
Sbjct: 18  LWKTNVPLMYDFVSETKLTWPSLTIQWLPGNSSSTKQEMILGTHTSGEDDNYLKIASIEL 77

Query: 78  PEDILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMPQDPNFIATINGV 137
           PEDILGA             QQRNVQSR              RARFMPQDPNFIATINGV
Sbjct: 78  PEDILGAEFSETPESTEETEQQRNVQSRIKITKKIKHEEEITRARFMPQDPNFIATINGV 137

Query: 138 GKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTS 197
           GKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTS
Sbjct: 138 GKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTS 197

Query: 198 PSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFS 257
           PSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFS
Sbjct: 198 PSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFS 257

Query: 258 KHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRV 317
           KHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRV
Sbjct: 258 KHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRV 317

Query: 318 LLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVW 377
           LLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVW
Sbjct: 318 LLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVW 377

Query: 378 KVSKKLTSPGLIQDYDIRSLE 398
           KVSKKLTSPGLIQDYDIRSLE
Sbjct: 378 KVSKKLTSPGLIQDYDIRSLE 398

>KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} similar
           to uniprot|P39984 Saccharomyces cerevisiae YEL056W
          Length = 398

 Score =  493 bits (1270), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 237/381 (62%), Positives = 284/381 (74%)

Query: 18  LWKTNVPLMYDFVSETKLTWPSLTIQWLPGNSSSTKQEMILGTHTSGEDDNYLKIASIEL 77
           LWK+NVPLMYDFVSETKL WPSLTIQWLP N  S +QE+ILGTHTSG + NYLKIAS+ L
Sbjct: 18  LWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNEQELILGTHTSGTEQNYLKIASVHL 77

Query: 78  PEDILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMPQDPNFIATINGV 137
           P++++                    QS+              RAR+ P +PN IATI+G 
Sbjct: 78  PDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPFNPNLIATISGS 137

Query: 138 GKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTS 197
           GKVFL+DRSKD + AL +E +FHK+NGYGL+F+  + GELLSCSDDG+IA+W+V     +
Sbjct: 138 GKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNT 197

Query: 198 PSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFS 257
           P K  T+H +IVN+C WHE +  LFGSVS+D TL IHDKR +  V ++  S P+NTL FS
Sbjct: 198 PVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFS 257

Query: 258 KHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRV 317
           KHS NLFAAAGTDS V LYDLR     +H+MSGH DSVTSLEF+PHKDGILCS  SDRRV
Sbjct: 258 KHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRV 317

Query: 318 LLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVW 377
           L+WDL QIG+EQ QEDA DGVPEL+MMHAGHKS VNDFS + NIPWLMASVEE+N+V +W
Sbjct: 318 LIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIW 377

Query: 378 KVSKKLTSPGLIQDYDIRSLE 398
           K SKKLTSP + +DY+IRSLE
Sbjct: 378 KASKKLTSPYIPRDYNIRSLE 398

>Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON}
           similar to Ashbya gossypii ACR017W
          Length = 397

 Score =  475 bits (1223), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 230/385 (59%), Positives = 288/385 (74%), Gaps = 13/385 (3%)

Query: 18  LWKTNVPLMYDFVSETKLTWPSLTIQWLP---GNSSSTKQEMILGTHTSGEDDNYLKIAS 74
           LWK+NV LMYDFVSETKLTWPSL+IQWLP    N    +QEMILGTHTSG+++NYLKIA+
Sbjct: 22  LWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGTHTSGDENNYLKIAA 81

Query: 75  IELPEDILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMPQDPNFIATI 134
           I+LP +++G                  V+S               RAR+MP++   IATI
Sbjct: 82  IDLPYEVVG--------LPDEDNSSEPVKSMIKVTKKFEHEDEVIRARYMPKNDKIIATI 133

Query: 135 NGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGT 194
           NG GK+F++DRSK K+E L    ++HKDNGYGL+FNP+ +GELLS SDD T+ALW++  T
Sbjct: 134 NGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINST 193

Query: 195 NTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRT-NSTVHRLTLSSPFNT 253
           +  P   V  H DIVND  WHEF+EN+FG+VSEDKTLQ+HDKR+ +++   L +  P N 
Sbjct: 194 D-RPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNA 252

Query: 254 LDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGS 313
           L FSKHS+NL AAAGTD+ VYLYDLR  ++ LHTM+GH+D+VTS+EFS HKDGILCSSGS
Sbjct: 253 LAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGS 312

Query: 314 DRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNI 373
           DRR+ +WDL QIG+EQAQEDA DGVPELMMMHAGH+SA+NDFSFN  +PWL+AS EEDN+
Sbjct: 313 DRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNV 372

Query: 374 VHVWKVSKKLTSPGLIQDYDIRSLE 398
           V VWK+SKKL S  + +  D++SLE
Sbjct: 373 VQVWKISKKLVSNIIPEYTDLKSLE 397

>Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON}
           YEL056W (HAT2) - subunit of a cytoplasmic histone
           acetyltransferase [contig 186] FULL
          Length = 396

 Score =  475 bits (1223), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 226/381 (59%), Positives = 282/381 (74%), Gaps = 2/381 (0%)

Query: 18  LWKTNVPLMYDFVSETKLTWPSLTIQWLPGNSSSTKQEMILGTHTSGEDDNYLKIASIEL 77
           LWK+NVPLMYDFVSET+L WPSLTIQWLP    ST+QE+++GTHTS  + NYLKIA I L
Sbjct: 18  LWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTEQELLVGTHTSDSEQNYLKIAEINL 77

Query: 78  PEDILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMPQDPNFIATINGV 137
           P++IL               +Q  V S+              RAR+ P D N IATI+G 
Sbjct: 78  PQEILSNEGPVLQNDNNGSDEQ--VPSKIKIIKKFKHENEVTRARYAPFDSNLIATISGT 135

Query: 138 GKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTS 197
           G VFL+DR+KD   AL  ++A+HK+NGYGL+F+  + GEL+SCSDDG+IA+W++    T 
Sbjct: 136 GTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTV 195

Query: 198 PSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFS 257
           P+   + H DIVN+C WHE + N++GSVSED  L IHDKR+   + +L    PFNT+ FS
Sbjct: 196 PTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFS 255

Query: 258 KHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRV 317
           KHS NLFAAAGTD++VYL+D R   +ALH+MSGH+++VTSLEF+ HKDGILCS GSDRRV
Sbjct: 256 KHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRV 315

Query: 318 LLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVW 377
           LLWDL QIG+EQ +EDA DG PEL+MMHAGHKSA+NDFSF+ N+PWLMASVEE+NIV +W
Sbjct: 316 LLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIW 375

Query: 378 KVSKKLTSPGLIQDYDIRSLE 398
           K S+KLT+P   Q YDIRSLE
Sbjct: 376 KPSRKLTNPYFPQGYDIRSLE 396

>NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9
          Length = 438

 Score =  454 bits (1168), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 223/394 (56%), Positives = 285/394 (72%), Gaps = 13/394 (3%)

Query: 18  LWKTNVPLMYDFVSETKLTWPSLTIQWLPGNSSST----KQEMILGTHTSGEDDNYLKIA 73
           LWK+NVPLMYDFVSETKLTWP+LT++WLP + SST    +QE+ILGTHTSGE+DNYLKIA
Sbjct: 45  LWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTSGEEDNYLKIA 104

Query: 74  SIELPEDIL----GAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMPQDPN 129
           +I+LP++++     +             Q++  +S               RARFMPQ+ +
Sbjct: 105 AIDLPDEVVQPSTNSLKAQREDDEDEDDQKQKPRSNIKIVKKFKHEEEITRARFMPQNTD 164

Query: 130 FIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALW 189
            IATING G VF++++S DK  AL+S   FHK+NGYGLSFNP  KG+LLS SDDGTIALW
Sbjct: 165 IIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALW 224

Query: 190 NVMGTNTSPSKAV----TTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKR-TNSTVHR 244
           ++   +T   K +    + H DIVNDC W+EFN N+F SVSED TLQ+HD+R  N+ ++ 
Sbjct: 225 DIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINS 284

Query: 245 LTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHK 304
           +  + PFNTL FSKHSQ L AAAGTDSLVYLYD RN +  L++M+GHEDS+T+LEFSPH 
Sbjct: 285 IKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHT 344

Query: 305 DGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWL 364
           DG+L SSG+DRRV++WD+  IG+EQ  +DA DG PE++M+HAGH+SAVNDFS N NIPWL
Sbjct: 345 DGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWL 404

Query: 365 MASVEEDNIVHVWKVSKKLTSPGLIQDYDIRSLE 398
           MAS EE+NI+ VWK S KL   G   +  +  LE
Sbjct: 405 MASAEEENIIQVWKCSHKLPIVGGTPEVSVSILE 438

>ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL056W (HAT2)
          Length = 423

 Score =  453 bits (1165), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 218/377 (57%), Positives = 270/377 (71%), Gaps = 11/377 (2%)

Query: 18  LWKTNVPLMYDFVSETKLTWPSLTIQWLPGNSSSTKQEMILGTHTSGEDDNYLKIASIEL 77
           LW +NVP+MY+FVSETKLTWPSLTIQWLP +  S +Q +I GTHT+GE+ NYLK+A+I L
Sbjct: 50  LWNSNVPVMYEFVSETKLTWPSLTIQWLPSDGQSPEQSLIFGTHTAGEEVNYLKVATINL 109

Query: 78  PEDILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMPQDPNFIATINGV 137
           P  I G               + N  S               RAR+MP + N IATING 
Sbjct: 110 PAGIAG-------LDQGDEEDEANDHSSFAIANKFPHIEEVIRARYMPANSNIIATINGK 162

Query: 138 GKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTS 197
           G + +FDR+ ++++A VS  AFHK+NGYGL+FNP   GELLS SDD T+ALW++      
Sbjct: 163 GTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAK-K 221

Query: 198 PSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTN-STVHRLTLSSPFNTLDF 256
           P   +T+H+DIVND  WHEF  N+FG+VSEDKTLQ+HDKR     V +L  +SPFNTL F
Sbjct: 222 PKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSF 281

Query: 257 SKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRR 316
           SKHS+NL AAAG DS +YLYD+R+ +  LH MSGH+DSVT++EFSPH DGI+CSSGSDRR
Sbjct: 282 SKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRR 341

Query: 317 VLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHV 376
            ++WDL QIG+EQ+Q+DA DG PELMMMHAGH+S VN+FSFN  IPWL+AS EEDN++  
Sbjct: 342 AIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQA 401

Query: 377 WKVSKKLT--SPGLIQD 391
           WKVS KL   SP  I D
Sbjct: 402 WKVSMKLVNASPPAISD 418

>TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9
           YEL056W
          Length = 392

 Score =  448 bits (1152), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 225/385 (58%), Positives = 276/385 (71%), Gaps = 14/385 (3%)

Query: 18  LWKTNVPLMYDFVSETKLTWPSLTIQWLPGNSSSTKQEMILGTHTSGEDDNYLKIASIEL 77
           LW++NVPLMYDFVSET LTWP+LT++WLPGNS S +QE+ILGTHTS E+ NYLKIA+I+L
Sbjct: 18  LWRSNVPLMYDFVSETNLTWPTLTLEWLPGNSHSNRQELILGTHTSEEEPNYLKIAAIDL 77

Query: 78  PEDILGAXXXXXXXXXXXXXQQRN--VQSRXXXXXXXXXXXXXXRARFMPQDPNFIATIN 135
           P++I+               ++R+   +S               RAR+MPQD N IATIN
Sbjct: 78  PDEIVPGKED----------RERDGFTKSNIKIIKKFKHEQEVTRARYMPQDSNLIATIN 127

Query: 136 GVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTN 195
           G G VFL+DRSKD +E L+S   FH+DNGYGLSFNP  KG+LLS SDD  IALW++   +
Sbjct: 128 GSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNS 187

Query: 196 TSP-SKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTV-HRLTLSSPFNT 253
           T P S   + H+D VNDC WHE N N FGSVSED TLQ+HD+R   +V  ++   + FNT
Sbjct: 188 TKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNT 247

Query: 254 LDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGS 313
           + FSKHS NLFAAAGTDSL+YLYD R T + LHTMSGHE +VT+LEF   KDGI+ SSG 
Sbjct: 248 IAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGE 307

Query: 314 DRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNI 373
           DRRV++WDLM+IG+EQ  +DA DG PE++M+HAGH+S VNDFS N NIPWLMAS EE+NI
Sbjct: 308 DRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENI 367

Query: 374 VHVWKVSKKLTSPGLIQDYDIRSLE 398
           V VWK S KL   G +   D   LE
Sbjct: 368 VQVWKCSSKLPRVGGLPKVDDSVLE 392

>ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 393

 Score =  441 bits (1134), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 213/383 (55%), Positives = 269/383 (70%), Gaps = 10/383 (2%)

Query: 18  LWKTNVPLMYDFVSETKLTWPSLTIQWLPGNSSSTKQEMILGTHTSGEDDNYLKIASIEL 77
           LWK+NVPLMYDFVSET LTWPSLT++WLPG+ SS +QEMILGTHTS E+ NYLKIA+I L
Sbjct: 19  LWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSSNRQEMILGTHTSDEEQNYLKIAAIYL 78

Query: 78  PEDILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMPQDPNFIATINGV 137
           P++++               ++  ++S               RAR+MPQD N IATI+GV
Sbjct: 79  PDEVV--------PDAEPKEEEEVLKSNVKIIKKFEHENEVTRARYMPQDDNLIATISGV 130

Query: 138 GKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTS 197
           G ++L++R+ +    L+S   FH +NGYGLSFNP  KG+LLS SDD  I LW+V G +  
Sbjct: 131 GTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQE 190

Query: 198 PSKAVT-THEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRT-NSTVHRLTLSSPFNTLD 255
           P    T  H DIVNDC WH F++N+FGSVSED TLQ+HD+R  ++ V ++    P+NTL 
Sbjct: 191 PILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLA 250

Query: 256 FSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDR 315
           FS HS NLFAAAGTDS+VYLYD R  +  LH M GHED+VTSLEF P +DG+L S+GSDR
Sbjct: 251 FSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDR 310

Query: 316 RVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVH 375
           R +LWDL +IG+EQ  +DA DG PE+MM+HAGH+S++NDFS N NIPWL A+ EE+NIV 
Sbjct: 311 RTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQ 370

Query: 376 VWKVSKKLTSPGLIQDYDIRSLE 398
           VWK S KL   G     D + LE
Sbjct: 371 VWKPSSKLPRIGGTPSVDTQLLE 393

>KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 408

 Score =  441 bits (1133), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 212/392 (54%), Positives = 274/392 (69%), Gaps = 13/392 (3%)

Query: 18  LWKTNVPLMYDFVSETKLTWPSLTIQWLPGNSSST--------KQEMILGTHTSGEDDNY 69
           LW +NVP+MYDFVSET+LTWPSLT+QWLP              +QE+++GT T+  + NY
Sbjct: 19  LWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQELLIGTLTTDNEPNY 78

Query: 70  LKIASIELPEDILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMPQDPN 129
           LKIA+I+LPE++  +               R  QS+              RAR+MPQ PN
Sbjct: 79  LKIAAIDLPENVTSSKPSVSDDAKENELSHR--QSKIKIVRKFKHEQEVTRARYMPQSPN 136

Query: 130 FIATINGVGKVFLFDRS-KDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIAL 188
            IAT+NG G V++FDR+ K+K+   ++  ++HK+NGYGL+FNP   G+LLS SDDGT+AL
Sbjct: 137 IIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVAL 196

Query: 189 WNVMGT-NTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTL 247
           W+V  T N SPS+    H DIVNDC WHEF  +LFG+VSED TL IHD  ++  + +L++
Sbjct: 197 WDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSV 256

Query: 248 SSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGI 307
           SS FNTL FSK S+NL AAAGTDS VYLYDLR     LH+M+GHEDSVTSLEFSPH+DG+
Sbjct: 257 SSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGL 316

Query: 308 LCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMAS 367
           L SSGSDRR+++WDL  IG+EQ  +DA DGVPEL MMH GH+S VN+FS N N+PWLM S
Sbjct: 317 LTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCS 376

Query: 368 VEEDNIVHVWKVSKKLTSPGL-IQDYDIRSLE 398
           VEE+N++ +WK + K+  P     D+DI +LE
Sbjct: 377 VEEENVLQIWKPANKIVRPPQPPADFDITTLE 408

>NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}
           Anc_6.9 YEL056W
          Length = 411

 Score =  439 bits (1130), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 215/386 (55%), Positives = 274/386 (70%), Gaps = 9/386 (2%)

Query: 18  LWKTNVPLMYDFVSETKLTWPSLTIQWLPGNSSS---TKQEMILGTHTSGEDDNYLKIAS 74
           LW++NVPLMYDFVSET+LTWPSL+++WLP   S+    +QE+I+GTHTSGE+DNYLKIA+
Sbjct: 30  LWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELIIGTHTSGEEDNYLKIAA 89

Query: 75  IELPEDILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMPQDPNFIATI 134
           I+LP DI+ +              + N++                RAR+MPQ+ N +ATI
Sbjct: 90  IDLPNDIIPSTEKLEDQQKGETTTKSNIK----IIKKFKHEEEITRARYMPQNSNLVATI 145

Query: 135 NGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGT 194
           NG GKVFL+DRSKDK+  LVS   +HK+NGYGLSFN    G+LLS SDDGTIALWNV  +
Sbjct: 146 NGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNS 205

Query: 195 NTSPSKA-VTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNST-VHRLTLSSPFN 252
           N+SP     + H DIVNDC W  F+ N+FGSVSED TLQ+HD+R   T   +  + +PFN
Sbjct: 206 NSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFN 265

Query: 253 TLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSG 312
           TL FSKHSQ LFAAAGTDS VYL+D R+ +  LH+M+GH+ +VT++EFSP +DGIL +SG
Sbjct: 266 TLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSG 325

Query: 313 SDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDN 372
            DRR ++WD+  IG EQ  +DA DG PE++M+HAGH+SA+NDFS N NIPWLMAS EE+N
Sbjct: 326 EDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEEN 385

Query: 373 IVHVWKVSKKLTSPGLIQDYDIRSLE 398
           I+ VWK S KL   G      +  LE
Sbjct: 386 IIQVWKCSHKLPRVGGTPTVSVSQLE 411

>Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON}
           (183046..184224) [1179 nt, 393 aa]
          Length = 392

 Score =  431 bits (1107), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 210/384 (54%), Positives = 272/384 (70%), Gaps = 13/384 (3%)

Query: 18  LWKTNVPLMYDFVSETKLTWPSLTIQWLPGNSSSTKQEMILGTHTSGEDDNYLKIASIEL 77
           LWKTNVPLMYDFVSET+LTWPSLT QWLPG+   T+Q MILGTHTSGE+ +YLK+A+++L
Sbjct: 19  LWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDTRQYMILGTHTSGEEVDYLKVAALDL 78

Query: 78  PEDILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMPQDPNFIATINGV 137
           P++++                 R  +S               RAR+MP+D N IATING 
Sbjct: 79  PDEVVTGEAND---------DNRRTKSNIKIVKKFEHDGEINRARYMPKDSNIIATINGE 129

Query: 138 GKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTS 197
           G V ++DRSK +++ L +   +HK+NGYGLSFNP    EL+S SDD TIALW++   + S
Sbjct: 130 GNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKS 189

Query: 198 PSKAV--TTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTV-HRLTLSSPFNTL 254
           P K+V    H DIVNDC+WH F+ENLFGSVSED TL++HDKR+ S V + +   + FNTL
Sbjct: 190 P-KSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTL 248

Query: 255 DFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSD 314
            FSKHS NLFAAAG D+ +YLYD R T   LH M+GHED++T L+F P +DGIL S G+D
Sbjct: 249 AFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGAD 308

Query: 315 RRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIV 374
           RRV+LWDL +IG+EQ  ++A DG PE++M+HAGH+SA+NDF+ +  IPWL ASVEEDN+V
Sbjct: 309 RRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVV 368

Query: 375 HVWKVSKKLTSPGLIQDYDIRSLE 398
            VWK SK L+  G   + D + L+
Sbjct: 369 QVWKCSKNLSRVGGTPEIDTKMLQ 392

>Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  411 bits (1056), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 209/379 (55%), Positives = 255/379 (67%), Gaps = 13/379 (3%)

Query: 18  LWKTNVPLMYDFVSETKLTWPSLTIQWLP-----GNSSSTKQEMILGTHTSGEDDNYLKI 72
           LWK+NVPLMYDFVSET+LTWPSLT+QWLP           KQE+I+GTHTSGE++NYLK 
Sbjct: 16  LWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGTHTSGEEENYLKF 75

Query: 73  ASIELPEDILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMPQDPNFIA 132
           A I LP+++L                    +S               RAR+MPQDPN +A
Sbjct: 76  AEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEEITRARYMPQDPNMVA 135

Query: 133 TINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVM 192
           TING G VFL+ RS    + L S   FHKDNGY LSF+P  KG LLS SDD ++ALW+V 
Sbjct: 136 TINGQGTVFLYSRS----DGLQSTLKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVS 191

Query: 193 GTNTSPSKAVT---THEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRT-NSTVHRLTLS 248
           G + S +   T    H DIVND  WH FN++LFG+VSED  L+I+D R  N+T+      
Sbjct: 192 GGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCP 251

Query: 249 SPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGIL 308
            PFNTL FS HS N+ AAAG DS VYLYDLRN  + LH MSGHED+VT+LEFSPH DG++
Sbjct: 252 QPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHVDGVV 311

Query: 309 CSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASV 368
            SSGSD R+++WDL QIG+EQ  +DA DGVPEL+M+HAGH+SAVNDF  N  +PWL+AS 
Sbjct: 312 VSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIAST 371

Query: 369 EEDNIVHVWKVSKKLTSPG 387
           EE+NI+ VWK S  L   G
Sbjct: 372 EEENILQVWKCSHSLPIVG 390

>YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit of
           the Hat1p-Hat2p histone acetyltransferase complex;
           required for high affinity binding of the complex to
           free histone H4, thereby enhancing Hat1p activity;
           similar to human RbAp46 and 48; has a role in telomeric
           silencing
          Length = 401

 Score =  410 bits (1054), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 211/380 (55%), Positives = 255/380 (67%), Gaps = 15/380 (3%)

Query: 18  LWKTNVPLMYDFVSETKLTWPSLTIQWLPG-----NSSSTKQEMILGTHTSGEDDNYLKI 72
           LWK+NVPLMYDFVSET+LTWPSLT+QWLP      +    KQE+I+GTHTSGE++NYLK 
Sbjct: 16  LWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGTHTSGEEENYLKF 75

Query: 73  ASIELPEDILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMPQDPNFIA 132
           A I LP++IL                    +S               RAR+MPQDPN +A
Sbjct: 76  AEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEEITRARYMPQDPNIVA 135

Query: 133 TINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVM 192
           TING G VFL+ RS    E L S   FHKDNGY LSF+   KG LLS SDD T+ALW V 
Sbjct: 136 TINGQGTVFLYSRS----EGLQSTLKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEV- 190

Query: 193 GTNTSPSKAVTT----HEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTN-STVHRLTL 247
           G+   P+K V T    H DI+ND  WH FN++LFG+VSED  L+I+D R N +T+  +  
Sbjct: 191 GSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKC 250

Query: 248 SSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGI 307
             PFNTL FS HS NL AAAG DS VYLYDLRN  + LH MSGHED+V +LEFS H DG+
Sbjct: 251 PQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHVDGV 310

Query: 308 LCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMAS 367
           + SSGSD R+++WDL QIG+EQ  +DA DGVPEL+M+HAGH+S+VNDF  N  IPWL+AS
Sbjct: 311 VVSSGSDNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVAS 370

Query: 368 VEEDNIVHVWKVSKKLTSPG 387
            EE+NI+ VWK S  L   G
Sbjct: 371 AEEENILQVWKCSHSLPIVG 390

>Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  408 bits (1048), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 210/380 (55%), Positives = 256/380 (67%), Gaps = 15/380 (3%)

Query: 18  LWKTNVPLMYDFVSETKLTWPSLTIQWLP-----GNSSSTKQEMILGTHTSGEDDNYLKI 72
           LWK+NVPLMYDFVSET+LTWPSLT+QWLP           KQE+I+GTHTSGE++NYLK 
Sbjct: 16  LWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIGTHTSGEEENYLKF 75

Query: 73  ASIELPEDILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMPQDPNFIA 132
           A I LP++IL                    +S               RAR+MPQ+P  +A
Sbjct: 76  AEINLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEEITRARYMPQNPGTVA 135

Query: 133 TINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVM 192
           TING G VF++ RS    E L S   FH++NGY LSF+P  +G LLS SDD T+ALW+V 
Sbjct: 136 TINGQGTVFIYSRS----EGLQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVN 191

Query: 193 GTNTSPSKAVTT----HEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRT-NSTVHRLTL 247
           G N+  ++ + T    H DIVND  WH FN++LFG+VSED  L+I+D R  N+T      
Sbjct: 192 G-NSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKC 250

Query: 248 SSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGI 307
             PFNTL FS HS NL AAAGTDS VYLYDLRN  + LH MSGHED+VT+LEFSPH DG+
Sbjct: 251 PEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHVDGV 310

Query: 308 LCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMAS 367
           + SSGSD R+++WDL QIG+EQ  +DA DGVPEL+M+HAGHKSAVNDF  N  IPWL+AS
Sbjct: 311 VVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVAS 370

Query: 368 VEEDNIVHVWKVSKKLTSPG 387
            EE+NI+ VWK S  L   G
Sbjct: 371 TEEENILQVWKCSHSLPVVG 390

>TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON}
           Anc_6.9 YEL056W
          Length = 391

 Score =  405 bits (1042), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 203/386 (52%), Positives = 267/386 (69%), Gaps = 18/386 (4%)

Query: 18  LWKTNVPLMYDFVSETKLTWPSLTIQWLPGNSSSTKQEMILGTHTSGEDDNYLKIASIEL 77
           LWK+NVPL+YDFVSET+LTWPSLT+QWLPG+ +ST+Q +ILGT TSG + +YLKIA+++L
Sbjct: 19  LWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTSTRQHLILGTLTSGAETDYLKIAALDL 78

Query: 78  PEDILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMPQDPNFIATINGV 137
           P++I+                 + V+S               RAR+MPQ+ N IAT+NG 
Sbjct: 79  PDEII-----------IGKKSDKVVKSNLKVVKKFAHDGEINRARYMPQNTNIIATVNGE 127

Query: 138 GKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTS 197
           G +F++D S+DK  AL+S   +HKDN YGL+FNP  +GEL+S SDD TIALW+   TN  
Sbjct: 128 GTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWD--ATNDK 185

Query: 198 PSKAV----TTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVH-RLTLSSPFN 252
             + +    T+H DIVNDC WH FN N+FGSVSED TLQ+ DKR       +++    +N
Sbjct: 186 LKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYN 245

Query: 253 TLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSG 312
           ++ FS  S+NLFAAAGT + +YLYD+RNT   LH+M+GHE+ VTSLEFS  KDGIL S  
Sbjct: 246 SIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGS 305

Query: 313 SDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDN 372
           SDRRV++WDL +IG+EQ  ++A DG+PE+MM+HAG +SA+ND S + +IPWL ASVEE+N
Sbjct: 306 SDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNASVEENN 365

Query: 373 IVHVWKVSKKLTSPGLIQDYDIRSLE 398
           IV VWK S KL       +  I  LE
Sbjct: 366 IVQVWKCSSKLPRISGTPEVSISDLE 391

>Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)
          Length = 427

 Score =  404 bits (1038), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 206/379 (54%), Positives = 252/379 (66%), Gaps = 13/379 (3%)

Query: 18  LWKTNVPLMYDFVSETKLTWPSLTIQWLP-----GNSSSTKQEMILGTHTSGEDDNYLKI 72
           LWK+NVPLMYDFVSET+LTWPSL++QWLP           +QE+I+GTHTSGE++NYLK 
Sbjct: 42  LWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELIIGTHTSGEEENYLKF 101

Query: 73  ASIELPEDILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMPQDPNFIA 132
           A I +P++IL                    +S               RAR+MPQ+P+F+A
Sbjct: 102 AEINIPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEEEITRARYMPQNPDFVA 161

Query: 133 TINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVM 192
           T+NG G VFL+ RS      L S   FHKDNGY LSFN   +G+LLS SDD T+ALW V 
Sbjct: 162 TLNGQGTVFLYSRSG----GLQSTLKFHKDNGYALSFNALVEGQLLSGSDDHTVALWEVG 217

Query: 193 GTNTSPSKAVT---THEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRT-NSTVHRLTLS 248
             +TS S   T    H DIVND  WH FNE LFG+VSED  L+I+D R  N T+  +   
Sbjct: 218 SNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCP 277

Query: 249 SPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGIL 308
            PFNTL FS HS NL AAAG DS VYLYDLRN  + LH MSGHED+VT++EFS H DG++
Sbjct: 278 QPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHVDGVV 337

Query: 309 CSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASV 368
            SSGSD R+++WDL QIG+EQ  +DA DGVPEL+M+HAGH+S+VNDF  N  IPWL+AS 
Sbjct: 338 VSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASS 397

Query: 369 EEDNIVHVWKVSKKLTSPG 387
           EE+NI+ VWK S  L   G
Sbjct: 398 EEENILQVWKCSHNLPIVG 416

>KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9
           YEL056W
          Length = 391

 Score =  402 bits (1033), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 200/370 (54%), Positives = 260/370 (70%), Gaps = 16/370 (4%)

Query: 18  LWKTNVPLMYDFVSETKLTWPSLTIQWLPGNSSS--TKQEMILGTHTSGEDDNYLKIASI 75
           LWK+NVPLMYDFVSETKLTWPSLT++WLP +  +  T+QEMI+GTHTS ++ NY+KIASI
Sbjct: 18  LWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMIIGTHTSDQEPNYVKIASI 77

Query: 76  ELPEDILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMPQDPNFIATIN 135
           ELP +++                   V+S               R+R+M QDPN I+TI+
Sbjct: 78  ELPNEVIDPHNVSDAP----------VKSNVRITKKFKLEKEITRSRYMVQDPNIISTID 127

Query: 136 GVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTN 195
           G G V +FDR  + +++ V  +++HKDNGYGLSFNP +KG+LLS +DDG IA++++   +
Sbjct: 128 GNGTVSIFDR--NSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAES 185

Query: 196 TSPSKA-VTTHEDIVNDCTWHEFNENLFGSVSEDK-TLQIHDKRTNSTVHRLTLSSPFNT 253
             P +   +T   I+ND  WH F+  LFG+VSE+K TL I+D RT   V  + +  PFN+
Sbjct: 186 EDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQPFNS 245

Query: 254 LDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGS 313
           L FSKHS+NLF+AAGTD  VYLYDLRNT   LH+MSGHE  VT+LEF    DGIL SS  
Sbjct: 246 LAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSE 305

Query: 314 DRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNI 373
           DRR+++WDLM+IGSEQ  EDA D  PELMM+HAGH+S+VNDFS N +IPWL+AS EE+NI
Sbjct: 306 DRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENI 365

Query: 374 VHVWKVSKKL 383
           + VWK S +L
Sbjct: 366 IQVWKSSSRL 375

>KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {ON}
           Anc_6.9 YEL056W
          Length = 414

 Score =  397 bits (1020), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 191/369 (51%), Positives = 251/369 (68%), Gaps = 11/369 (2%)

Query: 18  LWKTNVPLMYDFVSETKLTWPSLTIQWLPGNSSS--TKQEMILGTHTSGEDDNYLKIASI 75
           LWK+NVP+MYDFVSET+L WPSLT+QWLP ++ +  T+QE+ILGTHTS E+ NYLKIA +
Sbjct: 39  LWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGTHTSDEEQNYLKIAVV 98

Query: 76  ELPEDILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMPQDPNFIATIN 135
           +LP ++                 +  V+S               RAR+MPQDPN +ATI+
Sbjct: 99  DLPTEVTDTSNLTES-------DEEQVRSNIRVTRKFKHDSEVTRARYMPQDPNILATIS 151

Query: 136 GVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTN 195
           G G V+++DRS +++ A ++   +H DNGYGL+FNP  KG LLS SDD  +ALW+V    
Sbjct: 152 GTGTVYIYDRSNERDTASITLQ-YHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDR 210

Query: 196 TSP-SKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTL 254
             P  K    H DIVNDC WH F ++LFG+VSED +LQIHD R +  V  +  + PFNTL
Sbjct: 211 NEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNTL 270

Query: 255 DFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSD 314
            FS HS+NL A  G +S VYLYD R   + LH MSGH D+VTSL+FS   DGI+ S+G+D
Sbjct: 271 SFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGAD 330

Query: 315 RRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIV 374
           +RV++WD+  IG+EQ  EDA D   E+MM+HAGH+S +NDF+ N +IPWL+AS EE+NIV
Sbjct: 331 KRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIV 390

Query: 375 HVWKVSKKL 383
            +WK S KL
Sbjct: 391 QLWKCSHKL 399

>CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056w HAT2
          Length = 419

 Score =  396 bits (1018), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 190/387 (49%), Positives = 263/387 (67%), Gaps = 9/387 (2%)

Query: 18  LWKTNVPLMYDFVSETKLTWPSLTIQWLPGN---SSSTKQEMILGTHTSGEDDNYLKIAS 74
           LWK+NVP++YDFVSET+LTWP+LT++WLP     ++ T+Q++ILGTHTSGE+ NYLKI +
Sbjct: 36  LWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLILGTHTSGEEQNYLKIGA 95

Query: 75  IELPEDILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMPQDPNFIATI 134
           ++LP ++                 +  V S               RAR+MPQD N IATI
Sbjct: 96  VDLPVEV---TENSKKDREIDEEDEDMVLSNVKIVKKFPHDGEITRARYMPQDDNIIATI 152

Query: 135 NGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGT 194
           NG GK+F++DRSK+  EAL+S   +H +NGYGL+FN   K  LLS SDD  IALW++   
Sbjct: 153 NGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNF 212

Query: 195 NTSPSKAVT---THEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPF 251
             +    +T    H DI+ND  WH    ++FGSVSED T+++ DKR++  +H +    P+
Sbjct: 213 EKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPY 272

Query: 252 NTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSS 311
           NTL FS  S NLFAAAGTD+LVYLYD+R+ ++ L+ M+GHED+VT++EF P+ DGIL SS
Sbjct: 273 NTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSS 332

Query: 312 GSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEED 371
           GSDRR ++WDL +IG+EQ Q++  DG PE++M+HAGHK+++ND + N NI WL+AS EED
Sbjct: 333 GSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEED 392

Query: 372 NIVHVWKVSKKLTSPGLIQDYDIRSLE 398
           NIV +WK S  +   G   + D+  L+
Sbjct: 393 NIVQIWKCSSNIPRIGGEPEVDLSILD 419

>TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa]
           {ON} Anc_6.9 YEL056W
          Length = 407

 Score =  367 bits (943), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 192/392 (48%), Positives = 253/392 (64%), Gaps = 26/392 (6%)

Query: 18  LWKTNVPLMYDFVSETKLTWPSLTIQWLPGNSS----STKQEMILGTHTSGEDDNYLKIA 73
           LWK+NVPL+YDFVSETKL WPSLT++WLP N +    S +Q ++LGTHTSGE+ NYLKIA
Sbjct: 28  LWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLGTHTSGEEQNYLKIA 87

Query: 74  SIELPEDILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMPQDPNFIAT 133
            I LP+ I+                 ++V+S               RA +MPQD   IAT
Sbjct: 88  EITLPDQIINEKTEDNS--------DKHVKSNIRIIKKFKHELEVTRAHYMPQDSTIIAT 139

Query: 134 INGVGKVFLFDRSKDKNEA--LVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNV 191
           ING G VF++D S D+N++  ++S+ + HK+NGYGL+FNP  KG+LLS SDDG++A WN+
Sbjct: 140 INGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNI 199

Query: 192 MGTNTSPSKAVTTHE-DIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNS------TVHR 244
             +       +T  E  I+ND  W++FN+NLFG V+E   L + D R N+      + H 
Sbjct: 200 QKS----IPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHD 255

Query: 245 LTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHK 304
           +   S FN + FS HS+ L AA+G DSL+YLYD RN    LH M GHEDSVTSL+F    
Sbjct: 256 IKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALN 315

Query: 305 DGILCSSGSDRRVLLWDLMQIGSEQAQEDAADG-VPELMMMHAGHKSAVNDFSFNWNIPW 363
           DGI+ S GSD+RV +WDL QIG EQ  ++  DG VPEL+M+HAGH+S +NDFS + N+ W
Sbjct: 316 DGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNW 375

Query: 364 LMASVEEDNIVHVWKVSKKLTSPGLIQDYDIR 395
           L AS+EEDNIV VWK++  L    L+    IR
Sbjct: 376 LCASIEEDNIVQVWKMNNSLREDPLVNMNVIR 407

>TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {ON}
           Anc_8.548 YBR195C
          Length = 412

 Score =  135 bits (339), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 101/403 (25%), Positives = 189/403 (46%), Gaps = 50/403 (12%)

Query: 19  WKTNVPLMYDFVSETKLTWPSLTIQWLPG-NSSSTKQEMILGTHTSGE--DDNYLKIASI 75
           WK N  L+YD+++     WPSLT ++ P  ++++    ++L + TS +  +D  + I+ I
Sbjct: 22  WKKNTKLLYDYLNTNSAKWPSLTCEFFPDLDTTTDSHRLLLSSFTSSQLPEDESIYISRI 81

Query: 76  ELPEDI----LGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMPQDPNFI 131
              + +    L                +   ++               RAR++PQ+P+ I
Sbjct: 82  STLKHLHWSSLNNFDMDEMEFKPENSTKLPPRNLTDDISIRIPSGDSNRARYLPQNPDVI 141

Query: 132 ATINGVGKVFLFDRSKDKNE----------------ALVSEHAFHKDNGYGLSFNPRTKG 175
           +  +  G +++FDR+K  +                 A   E     +    L +N R +G
Sbjct: 142 SAASSDGSIYIFDRTKHNSTISRSTTSRPYEIKLEVAPQVELMDSPNEVVSLDWNKRKEG 201

Query: 176 ELLSCSDDGTIALWNV---MGTNTSPSKAVTTHEDI----VNDCTWHEFNENLFGSVSED 228
            L SC   G + +W++   + +N +    + + +D      ND TW   +++L  +  E 
Sbjct: 202 ILASCHSRGQLLVWDISQYLHSNPTIQTPICSIDDFDPQGANDITWMPSHDSLLAACGES 261

Query: 229 KTLQIHDKRTNSTVHRLTL---SSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNT-ADA 284
            T+ I+D R+ S V ++     +   N+ DF+ H+  L A+A +   V+++D+R    D 
Sbjct: 262 NTVAIYDTRSKSQVSKIQPGLHNGGINSCDFNAHNDYLLASADSIGTVHMWDIRKLDQDP 321

Query: 285 LHTMSGHEDSVTSLEFSPHKDGILCSSGS-DRRVLLWDLMQIGSEQAQEDAADGVPELMM 343
           + ++S H  S+++++++P+   I+  +G  D  V LWD            A++G  +L+ 
Sbjct: 322 IQSVS-HGSSISTVKWNPNVATIIAVAGQEDGLVKLWD------------ASNG--QLIF 366

Query: 344 MHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKLTSP 386
            H GH   VND ++N + PWLM SV  DN +H+W+ S  L  P
Sbjct: 367 THGGHMLGVNDIAWNAHDPWLMCSVSNDNSIHLWRPSSHLVEP 409

>NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON}
           Anc_8.548
          Length = 419

 Score =  135 bits (339), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 104/402 (25%), Positives = 183/402 (45%), Gaps = 48/402 (11%)

Query: 19  WKTNVPLMYDFVSETKLTWPSLTIQWLPG-NSSSTKQEMILGTHTSGE--DDNYLKIASI 75
           WK N  L+YD+++     WPSLT Q+ P  +++S    +++ + TS +  +D  + I+ I
Sbjct: 24  WKKNTKLLYDYLNTNATKWPSLTCQFFPDLDTTSDTHRILISSFTSSQLPEDEAIHISKI 83

Query: 76  ELPEDILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXX----XXXRARFMPQDPNFI 131
              + +  A                N++                    RAR++PQ+P+ I
Sbjct: 84  STLKHLNWASVNNFDMDEMEFKPDTNLKLPSKHLVNDLTIKFPNGDCNRARYLPQNPDVI 143

Query: 132 ATINGVGKVFLFDRSKD-------------------KNEALVSEHAFHKDNGYGLSFNPR 172
           A  +  G V++FDR+K                     N   V E   + +    L++N +
Sbjct: 144 AAASSNGSVYIFDRTKHGSSRIRQSKNLKPYDAVLFNNSETVEELHENTNEAISLAWNYQ 203

Query: 173 TKGELLSCSDDGTIALWNV---MGTNTSPSKAVTTHE-DI--VNDCTWHEFNENLFGSVS 226
            +G L SC   G + +W++     +N    K V   + D   VND +W   +++LF +  
Sbjct: 204 KEGTLASCYLQGQVQIWDIKQYFHSNPVLDKPVLNIQFDALGVNDVSWMPSHDSLFVACG 263

Query: 227 EDKTLQIHDKRTNSTVHRLTLS---SPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTAD 283
           E  TL + D+R    V R+  +      N+  F+  +  L A+A ++ LV ++D+RN   
Sbjct: 264 ESDTLALFDQRIGKEVSRIAQNRHNGGVNSCKFNYQNNMLLASADSEGLVNMWDIRNLDQ 323

Query: 284 ALHTMSGHEDSVTSLEFSPHKDGILCSSG-SDRRVLLWDLMQIGSEQAQEDAADGVPELM 342
                  H  S++++E++P+ D I+ ++G +D  V LWD+    +E            L+
Sbjct: 324 YPIKSINHGSSISTIEWNPNLDTIIATAGQNDGLVKLWDVSNTDNE------------LL 371

Query: 343 MMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKLT 384
            +H GH   VND S++ +  WLM SV  DN + +WK +  L 
Sbjct: 372 FVHGGHMLGVNDISWDLHDSWLMCSVSNDNSIQIWKPAHNLV 413

>KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 417

 Score =  133 bits (335), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 93/393 (23%), Positives = 183/393 (46%), Gaps = 32/393 (8%)

Query: 19  WKTNVPLMYDFVSETKLTWPSLTIQWLPGNS-SSTKQEMILGTHTSGE--DDNYLKIASI 75
           WK N  L+YD+++     WPSL+ Q+ P  + ++ KQ ++L + TS +   D  + I SI
Sbjct: 27  WKKNTKLLYDYLNTNTSKWPSLSCQFFPDRTLTNDKQRILLSSFTSQQLPQDESIYIGSI 86

Query: 76  ELPEDI----LGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMPQDPNFI 131
                +    +                + N ++               R R+MPQ+P+ I
Sbjct: 87  STMNHMKWSSINNFDMDEMEFKLDNSLKLNDKTLEEEVRITYPDGDCNRCRYMPQNPDII 146

Query: 132 ATINGVGKVFLFDRSKDKNEALVSEHAFH----------KDNGYGLSFNPRTKGELLSCS 181
            T +  G V++FDR+K  N+ + +   F           +D    L++N + +G L +C 
Sbjct: 147 GTASSNGSVYIFDRTKHGNK-ISTGRKFEIECRNNGDDEQDESLSLAWNYQLEGTLATCQ 205

Query: 182 DDGTIALWNVMGTNTS------PSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHD 235
            +G + +W++   + S      P +      + VND +W   + ++  S  E   + + D
Sbjct: 206 SNGKVKVWDLTKFDKSKQRMEIPERESVMDANGVNDVSWMVNHTSILASCGESNVIGLID 265

Query: 236 KRTNS---TVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMS-GH 291
            R ++   T+HR T +   N ++F+  +  +     +   + ++D+R+  + +     G 
Sbjct: 266 IRQDTKMDTLHRTTHTDGINAIEFNYKNDMILCTGDSQGQLKIWDIRDFKEPIKEWEHGD 325

Query: 292 EDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSA 351
           +D +++++++P    IL ++  D++  L  +     EQ   +A + +  L+ +H GH   
Sbjct: 326 QDPISAIQWNPQIPQILATA--DQQSGLVKIWDASGEQEDSNAENNM--LLFVHGGHMLG 381

Query: 352 VNDFSFNWNIPWLMASVEEDNIVHVWKVSKKLT 384
           VND S++ + PW M SV  DN +H+WK +  L 
Sbjct: 382 VNDISWSQHDPWTMCSVSNDNSIHIWKPAANLV 414

>TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  132 bits (332), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 99/414 (23%), Positives = 187/414 (45%), Gaps = 58/414 (14%)

Query: 19  WKTNVPLMYDFVSETKLTWPSLTIQWLPG-NSSSTKQEMILGTHTSGE--DDNYLKIASI 75
           WK N  L+YD+++     WPSLT Q+ P  + S+    ++L T TS +  DD  + I+ I
Sbjct: 20  WKKNTKLLYDYLNTNSNKWPSLTCQFFPDIDKSNDTHRLLLSTFTSSQIPDDESIYISHI 79

Query: 76  ELPEDILGAXXXXXXXXXXXXXQQRNVQ----SRXXXXXXXXXXXXXXRARFMPQDPNFI 131
                +  +                 ++    +               +AR+MPQ+P+ I
Sbjct: 80  STLNHLDWSSLNNFDMDEMEFKPDNRIKFPSKNLITDISITFPEGDCNKARYMPQNPDII 139

Query: 132 ATINGVGKVFLFDRSKDKNE------------------ALVSEHAFHKDNG--------Y 165
              +  G +++FDR+K  ++                   L  +  F  ++G         
Sbjct: 140 GCASSNGCIYIFDRTKRGSKLSTTTSARFSSGSKAYEAKLAKQRKFVIEDGTKNDEFECL 199

Query: 166 GLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAV------TTHEDI-VNDCTWHEFN 218
            +++NP+ +G+LLSC  +G I LW+     +S ++ +      T  +D+  N+ TW   +
Sbjct: 200 SIAWNPQQEGQLLSCESNGNIHLWDFQKEFSSKNREINNTIWDTNFDDLGCNEVTWMNGH 259

Query: 219 ENLFGSVSEDKTLQIHDKRTNSTVHRLTLSS---PFNTLDFSKHSQNLFAAAGTDSLVYL 275
            ++F +  E+  + + D R    V+ +   +     N+  F+  +  L A+  ++ ++ L
Sbjct: 260 NSIFATCGENNKMAVFDTRKEGIVNSIEQGNHNGGINSCKFNYENAMLLASGDSNGIINL 319

Query: 276 YDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGS-DRRVLLWDLMQIGSEQAQEDA 334
           +D+R     +  +  H  S++++E+SP  + ++ S G  D  V LWD   I +E+     
Sbjct: 320 WDIRKLNKPIRNLY-HGSSISTIEWSPLMNEMIASGGQEDGLVKLWD---ISNEE----- 370

Query: 335 ADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKLTSPGL 388
                E + +H GH   +ND S++ + PWL+ SV  DN + +WK +K L    L
Sbjct: 371 -----EPIFIHGGHMLGINDLSWDLHDPWLLCSVGSDNSIQIWKPAKHLVETKL 419

>Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to
           Ashbya gossypii AEL250C
          Length = 414

 Score =  130 bits (328), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 102/396 (25%), Positives = 182/396 (45%), Gaps = 42/396 (10%)

Query: 19  WKTNVPLMYDFVSETKLTWPSLTIQWLPG-NSSSTKQEMILGTHTSGE--DDNYLKIASI 75
           WK N  L+Y++++     WPSLT Q++P  + +S K  ++L + TS +  +D  + I+ I
Sbjct: 28  WKKNTRLLYEYLNTNSTKWPSLTCQFMPDMDIASDKHRILLSSFTSAQLPEDEAIYISEI 87

Query: 76  ELPEDILGAXXX---XXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMPQDPNFIA 132
              + I  +                Q +  ++               RAR+MPQ+P+ IA
Sbjct: 88  STMKHIAWSSLNNFHMEEMEFKVDNQVKLSKNLTETIKIQFPEGDCNRARYMPQNPDVIA 147

Query: 133 TINGVGKVFLFDRSK-DKNEALVSEHAFHKD------------NGYGLSFNPRTKGELLS 179
           + + +G V++FDR+K   N   +  + F  D                L++N +  G L +
Sbjct: 148 SASSLGSVYIFDRTKHGSNRPKILGNTFKYDMELKEVESGCNYEASSLAWNYQRSGILAA 207

Query: 180 CSDDGTIALWNVMGTN------TSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQI 233
              DG + +W++   N      T P       ++  N+ +W   + ++     E   L I
Sbjct: 208 SYSDGDVKIWDITKYNKAQPQLTVPDLRWQVDKEGANEVSWMVHHSSILAVCGEGNGLTI 267

Query: 234 HDKRTN---STVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSG 290
            D RT    ST      +   N + F+  +  L  +A ++  + + D+R     + T S 
Sbjct: 268 LDTRTPTTFSTKRHSCHTGGINAVQFNYDNDFLLCSADSEGTLNICDIRQLEHPVKTWS- 326

Query: 291 HEDSVTSLEFSPHKDGILCSSG-SDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHK 349
           H D+V++++++P    ++ S+G +D  V +WDL       AQED       L+ +H GH 
Sbjct: 327 HLDAVSTIQWNPKFPTVIASAGQNDGLVKIWDL-------AQEDDP-----LVFIHGGHM 374

Query: 350 SAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKLTS 385
             VND ++N + PW+M SV  DN VH+WK +  + +
Sbjct: 375 LGVNDIAWNHHDPWVMCSVSNDNSVHIWKPAANIVN 410

>Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR195C
           (MSI1) - p50 subunit of the yeast Chromatin Assembly
           Factor-I (CAF-I) negative regulator of ras-mediated cAMP
           induction; homologous to beta subunit of GTP-binding
           proteins [contig 24] FULL
          Length = 418

 Score =  128 bits (321), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 95/403 (23%), Positives = 182/403 (45%), Gaps = 48/403 (11%)

Query: 19  WKTNVPLMYDFVSETKLTWPSLTIQWLPG-NSSSTKQEMILGTHTSGE--DDNYLKIASI 75
           WK N  L+Y++++     WPSLT Q  P  + +  +  ++L + TS +  +D  + +A +
Sbjct: 28  WKKNCKLLYEYLNTNNTKWPSLTCQLFPDLDLAGDEHRILLSSFTSSQLPEDEAIYVARL 87

Query: 76  ----ELPEDILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMPQDPNFI 131
                +P   L                +   ++               +AR+ P +P+ I
Sbjct: 88  SSMKHIPWSSLNNFDTDEMEFKMDNSLKLPPKNIVEDLRIKFPAGDCNKARYCPSNPDLI 147

Query: 132 ATINGVGKVFLFDRSK--DKNEALVS----EHAFH----------KDNGYGLSFNPRTKG 175
           ++ +  G V++FDR+K     + L+S    +H  H          ++    L++N + +G
Sbjct: 148 SSASSNGSVYVFDRTKHGSARQKLISGGDPDHQIHCQLSTSLEERQNEALNLAWNWQQQG 207

Query: 176 ELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIV------NDCTWHEFNENLFGSVSEDK 229
            L +C   G + +W++   + +    +  H  ++      ND +W   +++L     E  
Sbjct: 208 LLATCYSGGEVCVWDLAKYDKASPTLIDPHSSLLADPQGSNDISWMVNHDSLLAYCGEGN 267

Query: 230 TLQIHDKRTNSTVHRLTLSSP-----FNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADA 284
            L + D R      + + S+P      N   F+ +   L  +A +   + L+D+R+ +  
Sbjct: 268 ALGVLDTRITKQPPQ-SFSNPHHSNGVNACQFNYYKDLLLCSADSAGRINLWDIRDFSSP 326

Query: 285 LHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVL-LWDLMQIGSEQAQEDAADGVPELMM 343
           + ++  H  SV++L+++PH   IL ++G D  ++ +WDL Q   +           EL  
Sbjct: 327 IRSLD-HHGSVSALQWNPHHPTILATAGQDDGLVKIWDLSQPVDQ-----------ELKF 374

Query: 344 MHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKLTSP 386
            H GH   VND S++ N PW+M SV  DN + +WK S+ L +P
Sbjct: 375 THGGHMLGVNDISWDPNDPWMMCSVSNDNSIQLWKPSQNLMTP 417

>AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR195C
           (MSI1)
          Length = 417

 Score =  126 bits (316), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 102/400 (25%), Positives = 180/400 (45%), Gaps = 47/400 (11%)

Query: 19  WKTNVPLMYDFVSETKLTWPSLTIQWLPGNSSST-KQEMILGTHTSGE--DDNYLKIASI 75
           WK N  L+YD+++     WPSLT Q++P     T K  ++L + TS +  +D  + I+ +
Sbjct: 28  WKKNTKLLYDYLNTNSTKWPSLTCQFMPDLEVPTDKHRLLLSSFTSSQLPEDEAVYISEL 87

Query: 76  E----LPEDILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMPQDPNFI 131
                +P   L                +   ++               RA +MPQ+P+ I
Sbjct: 88  STMRHVPWSSLNNFDMDEMEFKVDNQAKLPNKNLVETVRIQFPSGDCNRACYMPQNPDII 147

Query: 132 ATINGVGKVFLFDRSK---DKNEALVSEHAFH-------------KDNGYGLSFNPRTKG 175
             I   G V +FDR+K   ++ + L S  ++                    L++N +  G
Sbjct: 148 GAIASTGAVNIFDRTKHGTNRPKLLGSAASYEIQLNEPESLGDADSAEALSLAWNWQKAG 207

Query: 176 ELLSCSDDGTIALWNV------MGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDK 229
            + S   +G I +W++        T ++P   +   +   ND +W   + ++  +  E  
Sbjct: 208 IIASSYSNGLIKVWDITRYQKSQPTISNPELRILQDKAGTNDVSWMVHHSSILAACGESN 267

Query: 230 TLQIHDKRTNSTVHRLTLSSP----FNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADAL 285
           T+ + D R      + T +SP     N L F+  +  L  AA ++  + L+D R  +  L
Sbjct: 268 TIGLLDTRA-PDAFKPTKASPHTGGINALQFNYANDMLLCAADSNGGIALWDCRAFSKPL 326

Query: 286 HTMSGHEDSVTSLEFSPHKDGILCSSG-SDRRVLLWDLMQIGSEQAQEDAADGVPELMMM 344
              + H DSV++L+++P+   I+ ++G  D  + +WD     + +  ED+      L+ +
Sbjct: 327 SVFN-HGDSVSALQWNPNLPTIVATAGQGDGLIKIWD-----TSREPEDS------LLFV 374

Query: 345 HAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKLT 384
           H GH   VND ++N++ PWLM SV  DN VHVWK +  L 
Sbjct: 375 HGGHMLGVNDIAWNYHDPWLMCSVANDNSVHVWKPAANLV 414

>ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 397

 Score =  125 bits (313), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 103/399 (25%), Positives = 175/399 (43%), Gaps = 46/399 (11%)

Query: 18  LWKTNVPLMYDFVSETKLTWPSLTIQWLPG-NSSSTKQEMILGTHTSGE--DDNYLKIAS 74
           LWK N  L+YD+++     WPSL+ Q+ P  ++SS    ++  + TS +   D  + IAS
Sbjct: 14  LWKKNTKLLYDYLNTNSFKWPSLSCQFFPDLDTSSDTHRLLFTSFTSSQLPQDENVTIAS 73

Query: 75  IE----LPEDILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMPQDPNF 130
           I     +P   L                +   ++               RA ++PQ+P+ 
Sbjct: 74  ISTLRHVPWSSLNNFDMDEMEFKPDLSTKLPPKNLQIQLTINFPHGDCNRATYLPQNPDL 133

Query: 131 IATINGVGKVFLFDRSKDKNEAL------VSEHAFHKDNG------YGLSFNPRTKGELL 178
           I+T +  G V++FDR+K     +              +NG        L +N + +G L 
Sbjct: 134 ISTASSDGSVYIFDRTKRGKSPISHLRGPFEAQLLPNNNGSPIGETVALDWNRQIEGILA 193

Query: 179 SCSDDGTIALWNVMGTN------TSPSK-AVTTHEDIVNDCTWHEFNENLFGSVSEDKTL 231
           S   +G + +W++          + PS   + T     ND +W   ++ L     ED  +
Sbjct: 194 STYSNGQLCIWDIKKFEKRNPIMSQPSADFIDTESQGFNDVSWMPSHDCLLSIAREDNIM 253

Query: 232 QIHDKRTNSTVHRLTLS----SPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHT 287
            + D RTN  + +   S    S  N   F+     L A A  D LV L+D+R   + + T
Sbjct: 254 TLFDTRTNGNIAQTGPSTNHASGINCTKFNPSQPLLVATASGDGLVQLWDIRKLHNPIKT 313

Query: 288 MSGHEDSVTSLEFSPHKDGILCSSGS-DRRVLLWDLMQIGSEQAQEDAADGVPELMMMHA 346
           ++  E  +++LE++P    +L + G  D  V LW+            A++G  +L+  H 
Sbjct: 314 INC-ESPLSALEWNPQLPTVLATGGQEDGLVKLWN------------ASNG--QLLFTHG 358

Query: 347 GHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKLTS 385
           GH   VND +++ +  WLM SV  DN  H+WK + +L +
Sbjct: 359 GHMLGVNDIAWSPHDKWLMCSVANDNSTHLWKPASRLVT 397

>YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}
           MSI1Subunit of chromatin assembly factor I (CAF-1);
           chromatin assembly by CAF-1 is important for multiple
           processes including silencing at telomeres, mating type
           loci, and rDNA; maintenance of kinetochore structure;
           deactivation of the DNA damage checkpoint after DNA
           repair; and chromatin dynamics during transcription;
           Msi1p localizes to both nucleus and cytoplasm and has an
           independent role as a negative regulator of the RAS/cAMP
           pathway via sequestration of Npr1p kinase
          Length = 422

 Score =  125 bits (313), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 101/407 (24%), Positives = 177/407 (43%), Gaps = 56/407 (13%)

Query: 19  WKTNVPLMYDFVSETKLTWPSLTIQWLPG-NSSSTKQEMILGTHTSGE--DDNYLKIASI 75
           WK N  L+YD+++     WPSLT Q+ P  +++S +  ++L + TS +  +D  + I+ I
Sbjct: 26  WKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTSDEHRILLSSFTSSQKPEDETIYISKI 85

Query: 76  ELPEDILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXX----XXXXXRARFMPQDPNFI 131
                I  +              + + +                    RAR++PQ+P+ I
Sbjct: 86  STLGHIKWSSLNNFDMDEMEFKPENSTRFPSKHLVNDISIFFPNGECNRARYLPQNPDII 145

Query: 132 ATINGVGKVFLFDRSKDKNE-------------ALVSEHAFHKD------------NGYG 166
           A  +  G +++FDR+K  +               L   H   +D                
Sbjct: 146 AGASSDGAIYIFDRTKHGSTRIRQSKISHPFETKLFGSHGVIQDVEAMDTSSADINEATS 205

Query: 167 LSFNPRTKGELLSCSDDGTIALWNVMGTNTS------PSKAVTTHEDIVNDCTWHEFNEN 220
           L++N + +  LLS   +G + +W++   +        P  ++ +    VND TW   +++
Sbjct: 206 LAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLPLVSINSDGTAVNDVTWMPTHDS 265

Query: 221 LFGSVSEDKTLQIHDKRTNS---TVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYD 277
           LF + +E   + + D RT       +R       N+  F+  +  + A+A ++  + L+D
Sbjct: 266 LFAACTEGNAVSLLDLRTKKEKLQSNREKHDGGVNSCRFNYKNSLILASADSNGRLNLWD 325

Query: 278 LRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGS-DRRVLLWDLMQIGSEQAQEDAAD 336
           +RN   +      H  SV++LE+SP+ D +L ++G  D  V LWD               
Sbjct: 326 IRNMNKSPIATMEHGTSVSTLEWSPNFDTVLATAGQEDGLVKLWDT-------------- 371

Query: 337 GVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKL 383
              E +  H GH   VND S++ + PWLM SV  DN VH+WK +  L
Sbjct: 372 SCEETIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVHIWKPAGNL 418

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 41/210 (19%), Positives = 73/210 (34%), Gaps = 58/210 (27%)

Query: 218 NENLFGSVSEDKTLQIHD--KRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYL 275
           N ++    S D  + I D  K  ++ + +  +S PF T  F  H                
Sbjct: 141 NPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFETKLFGSHG--------------- 185

Query: 276 YDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDA- 334
             +    +A+ T S   +  TSL ++  ++ +L SS S+ +V +WD+ Q   E    D  
Sbjct: 186 --VIQDVEAMDTSSADINEATSLAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLP 243

Query: 335 -----ADGVP---------------------------------ELMMMHAGHKSAVNDFS 356
                +DG                                   +L      H   VN   
Sbjct: 244 LVSINSDGTAVNDVTWMPTHDSLFAACTEGNAVSLLDLRTKKEKLQSNREKHDGGVNSCR 303

Query: 357 FNWNIPWLMASVEEDNIVHVWKVSKKLTSP 386
           FN+    ++AS + +  +++W +     SP
Sbjct: 304 FNYKNSLILASADSNGRLNLWDIRNMNKSP 333

>TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  125 bits (313), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 99/400 (24%), Positives = 179/400 (44%), Gaps = 50/400 (12%)

Query: 19  WKTNVPLMYDFVSETKLTWPSLTIQWLPG-NSSSTKQEMILGTHTSG-----EDDNYLKI 72
           WK N  L+YD+++     WPSL+ Q+    N+ +    ++L + TSG     E  N + I
Sbjct: 30  WKKNTRLLYDYLNTNSTKWPSLSCQFFQDVNTKNDSHRILLSSFTSGLMPEQESINIMSI 89

Query: 73  ASIE-LPEDILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMPQDPNFI 131
           ++++ +P   L                +   ++               RAR++PQ+ + I
Sbjct: 90  STLKHVPWASLNNFDMDEMEFKPDNNLKLPPKNLHTEQTITFPNGDCNRARYLPQNQDII 149

Query: 132 ATINGVGKVFLFDRSK------------------DKNEALVSEHAFHKDNGYGLSFNPRT 173
           A  +  G V++F+R+K                   + E  V     + +    + +N + 
Sbjct: 150 AGASSDGTVYIFNRTKYGSTLRQTSSFQSYQARFAEPENTVQSVDSNPNEALSIDWNVQR 209

Query: 174 KGELLSCSDDGTIALW------NVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSE 227
           +G L +   DG I  W      N   T T+P+ ++    +  ND TW   +++L  +  E
Sbjct: 210 EGLLAASYSDGEIKTWDLKKFSNANTTITTPTVSIMMDTNGANDVTWMPLHDSLLAACGE 269

Query: 228 DKTLQIHD---KRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADA 284
              L I+D    R ++T+         N   F+  +  + A+A T   V+++D+R + + 
Sbjct: 270 SNKLIIYDIRGSREHTTISSGIHEDGINACRFNYANNLIVASADTVGNVHIWDIRKSNEI 329

Query: 285 LHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVL-LWDLMQIGSEQAQEDAADGVPELMM 343
           + T+  H  S++++E++P+ D IL ++G D  ++ LWD+                 EL+ 
Sbjct: 330 VKTIP-HGSSISTIEWNPNMDTILATAGQDDGLVKLWDVTD--------------SELIF 374

Query: 344 MHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKL 383
            H GH   VND S+N + PWLM SV  DN V +W+ +  L
Sbjct: 375 THGGHMLGVNDISWNRHDPWLMCSVARDNSVQIWRPAHNL 414

>Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  124 bits (311), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 102/407 (25%), Positives = 178/407 (43%), Gaps = 56/407 (13%)

Query: 19  WKTNVPLMYDFVSETKLTWPSLTIQWLPG-NSSSTKQEMILGTHTSGE--DDNYLKIASI 75
           WK N  L+Y++++     WPSLT Q+ P  +++  +  ++L + TS +  +D  + I+ I
Sbjct: 26  WKKNTKLLYEYLNTNSTKWPSLTCQFFPDLDTTLDEHRILLSSFTSSQKPEDESIYISKI 85

Query: 76  ELPEDI----LGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMPQDPNFI 131
                I    L                +   +                RAR++PQ+P+ I
Sbjct: 86  STLGHIKWSSLNNFDMDEMEFKPENSTRYPPKHLVNDISIFFPNGECNRARYLPQNPDII 145

Query: 132 ATINGVGKVFLFDRSKDKN-------------EALVSEHAFHKD------------NGYG 166
           A  +  G +++FDR+K  +               L   H   +D                
Sbjct: 146 AGASSDGAIYIFDRTKHGSTRIRQSKISHPFEAKLFGSHGVIQDVETMDASSADINEATS 205

Query: 167 LSFNPRTKGELLSCSDDGTIALWNVMGTNTS------PSKAVTTHEDIVNDCTWHEFNEN 220
           +++N + +  LLS   +G + +W++   +        P  ++ +    VND TW   +++
Sbjct: 206 IAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLPLVSINSDGSGVNDVTWMPTHDS 265

Query: 221 LFGSVSEDKTLQIHDKRTNSTVHRLTLSS---PFNTLDFSKHSQNLFAAAGTDSLVYLYD 277
           LF + +E  T+ + D RT     +    S     N+  F+  +  + A+A ++  + L+D
Sbjct: 266 LFAACTEGNTVSLLDLRTKKEKLKSNCRSHNGGVNSCKFNYRNSLILASADSNGKLNLWD 325

Query: 278 LRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGS-DRRVLLWDLMQIGSEQAQEDAAD 336
           +RN  D   T   H  SV++LE+SP+ D +L ++G  D  V LWD  +            
Sbjct: 326 IRNMNDCPLTTMEHGGSVSTLEWSPNFDTVLATAGQEDGLVKLWDTSR------------ 373

Query: 337 GVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKL 383
              E +  H GH   VND S++ + PWLM SV  DN VH+WK +  L
Sbjct: 374 --EENIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVHIWKPAVNL 418

>CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa]
           {ON} similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195c MSI1
          Length = 419

 Score =  124 bits (310), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 103/403 (25%), Positives = 179/403 (44%), Gaps = 50/403 (12%)

Query: 19  WKTNVPLMYDFVSETKLTWPSLTIQWLPG-NSSSTKQEMILGTHTSGE--DDNYLKIASI 75
           WK N  L+YD+++     WPSLT Q+ P  ++SS +  ++L + TS +  +D  + I+ I
Sbjct: 28  WKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTSSDQHRLLLSSFTSSQLPEDESVYISKI 87

Query: 76  ELPEDILGAXXXXXXXXXXXXXQQRNVQ----SRXXXXXXXXXXXXXXRARFMPQDPNFI 131
              + +  +                +V+    +               R+R++PQ+P+ I
Sbjct: 88  STLKHLNWSSLNNFDMDEMEFKPDPSVKLPPKNLTTEVSIRFPNGDCNRSRYLPQNPDLI 147

Query: 132 ATINGVGKVFLFDRSKDKNEALVSEH--------------AFHKDN---GYGLSFNPRTK 174
           A  +  G V++F+++K  N  L S+               A + DN      LS+N   +
Sbjct: 148 AAASSDGSVYIFNKTKHGNSVLRSKSSDDFQARLFSGSHDAQNLDNFNEAVSLSWNKHKE 207

Query: 175 GELLSCSDDGTIALWNVMGTNTS------PSKAVTTHEDIVNDCTWHEFNENLFGSVSED 228
           G L      G   +W+V   + S      P   VT   +  ND  W   ++++F +  E 
Sbjct: 208 GILGVSYSQGQCNIWDVKKFSRSNILISQPELTVTFDSNGCNDLDWMPMHDSMFIACGES 267

Query: 229 KTLQIHDKRTNSTVHRLTLSS-----PFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTAD 283
             L + D R N      ++S+       NT  F+  +  L A+A T   + L+D+R    
Sbjct: 268 NKLGLFDMRLNGEKEVNSISNYKHEDGINTCKFNPGNSLLVASADTCGRINLWDIRKLDQ 327

Query: 284 ALHTMSGHEDSVTSLEFSPHKDGILCSSGS-DRRVLLWDLMQIGSEQAQEDAADGVPELM 342
              +   H  S++++E++P+   +  S+G  D  V LWD   +G E             +
Sbjct: 328 EPISTMQHGSSISTIEWNPNIGVVFASAGQEDGLVKLWD-ASVGKE-------------I 373

Query: 343 MMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKLTS 385
            +H GH   VND S++ + PWLMASV  DN + +W+ +K + S
Sbjct: 374 FVHGGHMLGVNDISWDMHDPWLMASVSNDNTIQIWRPAKNIVS 416

>Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  124 bits (310), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 102/411 (24%), Positives = 179/411 (43%), Gaps = 64/411 (15%)

Query: 19  WKTNVPLMYDFVSETKLTWPSLTIQWLPG-NSSSTKQEMILGTHTSGE--DDNYLKIASI 75
           WK N  L+YD+++     WPSLT Q+ P  +++  +  ++L + TS +  +D  + I+ I
Sbjct: 26  WKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTLNEHRILLSSFTSSQKPEDETIYISRI 85

Query: 76  ELPEDILGAXXXXXXXXXXXXXQQRNV----QSRXXXXXXXXXXXXXXRARFMPQDPNFI 131
                I  A              +       +                RAR++PQ+P+ I
Sbjct: 86  STLGHIKWASLNNFDMDEMEFKPENTTTYPSKHLVDDIRIFFPNGECNRARYLPQNPDII 145

Query: 132 ATINGVGKVFLFDRSKDKNE-------------ALVSEHAFHKD------------NGYG 166
           A  +  G +++FDR+K  +               L+  H   +D                
Sbjct: 146 AGASSDGAIYIFDRTKHGSTRIRQSKISHPFEIKLLGSHGVIQDVETMDTSLVDINEATS 205

Query: 167 LSFNPRTKGELLSCSDDGTIALWNVMGTNTS------PSKAVTTHEDIVNDCTWHEFNEN 220
           L++N + +  LLS   +G I +W++   +        P  ++ +    VND TW   +++
Sbjct: 206 LAWNLQQEALLLSSHSNGQIQVWDIKQYSHDNPIIDVPLMSIDSDGSSVNDVTWMPTHDS 265

Query: 221 LFGSVSEDKTLQIHDKRT-------NSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLV 273
           LF + +E   + + D RT       N  +H        N+  F+  +  + A+A ++  +
Sbjct: 266 LFAACTERNAVSLLDLRTKKEKLKSNCKIH----GGGVNSCKFNYKNSLILASADSNGRL 321

Query: 274 YLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGS-DRRVLLWDLMQIGSEQAQE 332
            L+D+RN  +       H  SV++LE+SP+ D +L ++G  D  V LWD  +        
Sbjct: 322 NLWDIRNMNENPIATMEHGASVSTLEWSPNFDTVLATAGQEDGLVKLWDTTR-------- 373

Query: 333 DAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKL 383
                  E +  H GH   VND S++ + PWLM SV  DN VH+WK ++ +
Sbjct: 374 ------EESIFTHGGHMFGVNDISWDVHDPWLMCSVANDNSVHIWKPAENI 418

>KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 418

 Score =  123 bits (309), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 102/403 (25%), Positives = 178/403 (44%), Gaps = 48/403 (11%)

Query: 19  WKTNVPLMYDFVSETKLTWPSLTIQWLPG-NSSSTKQEMILGTHTSGE--DDNYLKIASI 75
           WK N  L YD+++     WPSLT Q  P  + ++ +  ++L + TS +  +D  L +A +
Sbjct: 28  WKKNSKLYYDYLNTNSTKWPSLTCQLFPDLDLATDEHRILLSSFTSSQVPEDESLYVARL 87

Query: 76  ----ELPEDILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMPQDPNFI 131
                +P   L                +   +S               +AR+ P +P+ I
Sbjct: 88  SSMKHIPWSSLNNFDMEEKEFKVDNSLKLPSKSLVEDLRIKFPAGDCNKARYCPSNPDLI 147

Query: 132 ATINGVGKVFLFDRSKD--KNEALVS----EHAFH----------KDNGYGLSFNPRTKG 175
            + +  G +++FDR+K     + L+S    +H  H          K+    L++N + +G
Sbjct: 148 GSASSNGSIYVFDRTKHGFARQKLISAGDTDHQIHCQLSTSLEEHKNEAVSLAWNWQRQG 207

Query: 176 ELLSCSDDGTIALWNVMG------TNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDK 229
            L +    G + +W++        T  +P    T      N+ +W   +++L    SED 
Sbjct: 208 LLATSYSHGQVCVWDLEKYDKNSPTLINPLAMSTVDPRGSNEVSWMVRHDSLLAYCSEDN 267

Query: 230 TLQIHDKRTNSTVHRLTLSSP-----FNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADA 284
            + I D R N    + + S+P      NT  F+ H   L  +A +   + L+D+RN    
Sbjct: 268 LVGIMDIR-NPEKGQSSGSNPHHSNGINTCQFNYHRDMLLCSADSAGRINLWDIRNFTQP 326

Query: 285 LHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVL-LWDLMQIGSEQAQEDAADGVPELMM 343
           L T+  H DS++ L+++P +  +L + G D  ++ +WDL Q   +           EL+ 
Sbjct: 327 LKTLL-HNDSISVLQWNPREPTVLATGGQDGGLVKIWDLSQPEGQ-----------ELIF 374

Query: 344 MHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKLTSP 386
            H GH   VND S++ +  W+M SV  DN + VW+ S  L  P
Sbjct: 375 THGGHMLGVNDISWDPHDTWMMCSVANDNSIQVWRPSNSLVEP 417

>NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {ON}
           Anc_8.548
          Length = 414

 Score =  122 bits (307), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 102/402 (25%), Positives = 182/402 (45%), Gaps = 51/402 (12%)

Query: 19  WKTNVPLMYDFVSETKLTWPSLTIQWLPG-NSSSTKQEMILGTHTSGE--DDNYLKIASI 75
           WK N  L+YD+++     WPSLT Q+    +++S    ++L   TS +  +D  + IA +
Sbjct: 25  WKKNTRLLYDYLNTNSKKWPSLTCQFFHDLDTTSDTHRILLSAFTSSQLPEDEAIYIAKL 84

Query: 76  ELPEDILGAXXXXXXXXXXXXXQQRNVQ----SRXXXXXXXXXXXXXXRARFMPQDPNFI 131
              + +  A              + N++    +                AR++PQ+P+ I
Sbjct: 85  STLKHLEWASINNFDMDEMEFKPENNIKLPSKNLTNDISIRFPDGDCNIARYLPQNPDVI 144

Query: 132 ATINGVGKVFLFDRSK--------DKN----EALVS------EHAFHKDNGYGLSFNPRT 173
           A  +  G +++FDR+K         KN    EA +       E+  + +    +S+N + 
Sbjct: 145 AGASSHGSIYIFDRTKHGSLRMRQSKNLKPYEAALYCPPKGIENVENTNEATSISWNLQR 204

Query: 174 KGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDI------VNDCTWHEFNENLFGSVSE 227
           +G L SC   G I LW++   + S  +  T   ++      VND  WH  ++++  +  E
Sbjct: 205 EGLLASCYSSGQIQLWDLKKYSNSKLEMDTPLLNVDFDALGVNDVNWHPSHDSILAASGE 264

Query: 228 DKTLQIHDKRTNSTVHRLTL---SSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNT-AD 283
              + + D R  + + R      +   N+  F+ H  +L  +  ++  + L+DLR    +
Sbjct: 265 SNIIGLFDNRLGTEILRSNEKMHNGGINSCKFNSHCDSLLISGDSEGRINLWDLRKLDGE 324

Query: 284 ALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVL-LWDLMQIGSEQAQEDAADGVPELM 342
            + T+  H  S+++LE++P+ + I+ S+G D  ++ LWD+                 EL+
Sbjct: 325 PIKTLH-HGSSISTLEWNPNLETIVASAGQDDGLVKLWDV--------------STDELV 369

Query: 343 MMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKLT 384
             H GH   VND S+N +  WLM SV  DN V VWK +  L 
Sbjct: 370 FTHGGHMLGVNDISWNLHDTWLMCSVSNDNSVQVWKPAHNLV 411

>Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON}
           YBR195C (REAL)
          Length = 424

 Score =  122 bits (307), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 105/414 (25%), Positives = 185/414 (44%), Gaps = 58/414 (14%)

Query: 19  WKTNVPLMYDFVSETKLTWPSLTIQWLPG-NSSSTKQEMILGTHTSGE--DDNYLKIASI 75
           WK N  L+YD+++     WPSLT Q+ P  +++  +  ++L + TS +  +D  + I+ I
Sbjct: 26  WKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTLDEHRILLSSFTSSQKPEDETIYISKI 85

Query: 76  ELPEDILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXX----XXXXXRARFMPQDPNFI 131
                I  +              +   +                    RAR++PQ+P+ I
Sbjct: 86  STLGHIKWSSLNNFDMDEMEFKPENTTRLPPSHLVNDISIFFPNGDCNRARYLPQNPDII 145

Query: 132 ATINGVGKVFLFDRSK--------DKNE-----ALVSEHAFHKD------------NGYG 166
           A  +  G +++FDR+K         KN       L   H   +D                
Sbjct: 146 AGASSDGAIYIFDRTKHGSTRIRQSKNSHPFEAKLFGSHGVIQDVEAMDTSSADVNEATS 205

Query: 167 LSFNPRTKGELLSCSDDGTIALWNVMGTN------TSPSKAVTTHEDIVNDCTWHEFNEN 220
           L++N + +  LLS   +G + +W++   +       SP  ++ +    VND TW   +++
Sbjct: 206 LAWNLQQEALLLSSHSNGQVQIWDIKQYSHENPLIDSPLVSIESDASGVNDVTWMPTHDS 265

Query: 221 LFGSVSEDKTLQIHDKRTNS---TVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYD 277
           LF + +E   + + D RT       +R   +   N+  F+  +  + A+A ++  + L+D
Sbjct: 266 LFAACTEGNVVSLLDLRTKKEKLRSNRQNHTGGVNSCKFNYRNSLVLASADSNGRLNLWD 325

Query: 278 LRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGS-DRRVLLWDLMQIGSEQAQEDAAD 336
           +R   ++  T   H  S+++LE++P+   +L ++G  D  V LWD        A+E    
Sbjct: 326 IRKMNESPITTMEHGASISTLEWNPNFSTVLATAGQQDGLVKLWD-------TARE---- 374

Query: 337 GVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKLTSPGLIQ 390
              E +  H GH   VND S++ + PWLM SV  DN VH+WK ++ L   GL Q
Sbjct: 375 ---ETIFTHGGHMLGVNDVSWDVHDPWLMCSVANDNSVHIWKPAENLV--GLEQ 423

>Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa]
           {ON} complement(104336..105589) [1254 nt, 418 aa]
          Length = 417

 Score =  121 bits (304), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 98/402 (24%), Positives = 172/402 (42%), Gaps = 51/402 (12%)

Query: 19  WKTNVPLMYDFVSETKLTWPSLTIQWLPG-NSSSTKQEMILGTHTSG--EDDNYLKIASI 75
           WK N  L+Y++++     WPSLT Q+ P  N+ +    ++L + TS    +D  L I  I
Sbjct: 28  WKKNTKLLYEYLNTNSNKWPSLTCQFFPDVNTKNDSHRILLSSFTSSLVPEDESLYITRI 87

Query: 76  ELPEDILGAXXXXXXXXXXX-XXQQRNVQ----SRXXXXXXXXXXXXXXRARFMPQDPNF 130
              + +  A                 N++    +               RAR++PQ+P+ 
Sbjct: 88  STLKHLSWASLNNFDLDEMEFKPDNSNIKLPPKNLTTELVIRFPNGDCNRARYLPQNPDL 147

Query: 131 IATINGVGKVFLFDRSKDKNEALVSEHAFHK------------------DNGYGLSFNPR 172
           IA  +  G V++FDR+K        +  F +                  +    + +N +
Sbjct: 148 IAAASSDGSVYIFDRTKHGTAMHSRQSGFTQSYQAKLAVNNNSQSLNGENEALTIDWNHQ 207

Query: 173 TKGELLSCSDDGTIALWNVMGTNTS------PSKAVTTHEDIVNDCTWHEFNENLFGSVS 226
            +G L+    DG +  W++     S      P       E   ND  W   + +LF + S
Sbjct: 208 KEGHLVVAYSDGHVKAWDITKYKRSDPVIKAPEYNYKLDESGCNDAVWMPEHNSLFAACS 267

Query: 227 EDKTLQIHDKRTNSTVHRLTLS---SPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTAD 283
           ED  L + D R  S +  ++ S      N   F+  +  L A+  +   + L+D+R    
Sbjct: 268 EDNRLSLFDTRDESNIIDISTSVHKGGINACRFNPRNSLLLASGDSIGNICLWDIRKKET 327

Query: 284 ALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVL-LWDLMQIGSEQAQEDAADGVPELM 342
            ++ +  H  S++++E++P+   +L S+G D  ++ LWD    GS++            +
Sbjct: 328 PINILD-HGSSISTIEWNPNLSTVLASAGQDDGLVKLWD---AGSDKP-----------V 372

Query: 343 MMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKLT 384
            +H GH   VND S+N + PWLM SV +DN + +WK +  L 
Sbjct: 373 FIHGGHMLGVNDISWNMHDPWLMCSVSKDNSIQIWKPAHNLV 414

>KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {ON}
           Anc_8.548 YBR195C
          Length = 413

 Score =  121 bits (304), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 94/400 (23%), Positives = 182/400 (45%), Gaps = 49/400 (12%)

Query: 19  WKTNVPLMYDFVSETKLTWPSLTIQWLPG-NSSSTKQEMILGTHTSGE--DDNYLKIASI 75
           WK N  L+Y +++     WPSLT Q+ P  ++++    ++L T TS +  +D  L IA++
Sbjct: 23  WKKNTKLLYSYLNTNTSKWPSLTCQFFPDLDTTTDTHRILLSTFTSSQLPEDESLYIANL 82

Query: 76  ELPEDI----LGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMPQDPNFI 131
                +    L                +   ++               RAR++PQ+P+ +
Sbjct: 83  STSNHLNWSSLNNFDMDEMEFKPDNSTKFPSKNLNVDISIPFPNGDCNRARYLPQNPDLL 142

Query: 132 ATINGVGKVFLFDRSKDKNEALVS----------------EHAFHKDNGYGLSFNPRTKG 175
           A  +  G +++F+R+K  +  L S                E+  + +    +++N +  G
Sbjct: 143 AAASSNGSIYIFNRTKHGSRRLNSNQRSFEARLYSTDKMDENFTNSNEAVSIAWNLQKNG 202

Query: 176 ELLSCSDDGTIALWNVMGTNTSPSK------AVTTHEDIVNDCTWHEFNENLFGSVSEDK 229
            L S    G+I +W++   + S          +    +  N+ TW   ++++F + SE  
Sbjct: 203 TLASSYSQGSIKIWDITKYSCSDPTLRENELTIPFDPEGCNEVTWMVNHDSIFAACSESN 262

Query: 230 TLQIHDKRTNSTVHRLTL-----SSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADA 284
            L + D RT   + ++T      S   N+  F+ ++  L A+A +   + ++D+R     
Sbjct: 263 KLSLFDVRTKEEMLKMTENIGTHSGGINSCKFNYYNDMLLASADSTGKINMWDIRKLDKE 322

Query: 285 LHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVL-LWDLMQIGSEQAQEDAADGVPELMM 343
                 H  S+++LE++P+ + IL ++G D  ++ +WD             A+G  + + 
Sbjct: 323 PIKSFNHNSSISTLEWNPNLETILVTAGQDDGLVKIWD------------TANG--QNIF 368

Query: 344 MHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKL 383
           +H GH   VND S++ + PWL++SV  DN +HVWK +  L
Sbjct: 369 VHGGHMLGVNDVSWDLHDPWLLSSVSNDNSIHVWKPATNL 408

>KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {ON}
           Anc_8.548 YBR195C
          Length = 426

 Score =  120 bits (301), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 106/417 (25%), Positives = 183/417 (43%), Gaps = 61/417 (14%)

Query: 19  WKTNVPLMYDFVSETKLTWPSLTIQWLPGNSSST-KQEMILGTHTSGE--DDNYLKIASI 75
           WK N  L+YD+++     WPSLT Q+ P   ++T    ++L ++TS +  +D  + +ASI
Sbjct: 22  WKKNTKLLYDYLNTNTAKWPSLTCQFFPDVDANTDTHRILLSSYTSCQLPEDENVYVASI 81

Query: 76  ELPEDILGAXXXXXXXXXXXXXQQRNVQ----SRXXXXXXXXXXXXXXRARFMPQDPNFI 131
                +  A               R  +    +               RAR+MPQ+P+ I
Sbjct: 82  STLAHLDWASLNNFDMDEMEFKPDRTTKFPPKNLATNVSITFPRGDCNRARYMPQNPDVI 141

Query: 132 ATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYG------------------------- 166
           A  +  G V++F+R+K     +    A   +  YG                         
Sbjct: 142 AAASSNGAVYVFNRTKHGTRRIQKHAASDAEQDYGPYEARFYNEETDEARRTPVDNEAVS 201

Query: 167 LSFNPRTKGELLSCSDDGTIALW-----NVMGTNTSPSKAVTTHEDI--VNDCTWHEFNE 219
           L++N   +G L      G + +W     NV  T  S ++   ++ D   VND +W   ++
Sbjct: 202 LAWNHHREGTLAVAYSHGAVKVWDLQRFNVDNTTISETEWECSNFDSRGVNDVSWMSQHD 261

Query: 220 NLFGSVSE-DKTLQIHDKRTNSTVHRLT---LSSPFNTLDFSKHSQNLFAAAGTDSLVYL 275
           ++  +  E   +L + D R  + V ++     S   N   F+  +  L A+  +     L
Sbjct: 262 SILAACGERSDSLALFDTRAQNAVAKIRNQFKSEGINACKFNWENNLLLASTDSTGRTNL 321

Query: 276 YDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSG-SDRRVLLWDL-MQIGSEQAQED 333
           +D+R  +        H  SV++LE++PH   +L ++G SD  + +WD  ++I      ED
Sbjct: 322 WDVRKLSAEPIVHFDHGGSVSTLEWNPHDHSVLATAGQSDGLIKIWDTSLEI------ED 375

Query: 334 AADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWK----VSKKLTSP 386
                 + + +H+GH   VND +++ + PWLM SV  DN VHVWK    + ++ TSP
Sbjct: 376 ------KTIFVHSGHMLGVNDIAWDLHDPWLMCSVSNDNSVHVWKPAANLVQRCTSP 426

>SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {ON}
           similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195C MSI1 Subunit of chromatin assembly factor I
           (CAF- I) regulates the RAS/cAMP pathway via
           sequestration of Npr1p kinase localizes to the nucleus
           and cytoplasm homologous to human retinoblastoma binding
           proteins RbAp48 and RbAp46
          Length = 425

 Score =  119 bits (299), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 99/403 (24%), Positives = 177/403 (43%), Gaps = 54/403 (13%)

Query: 19  WKTNVPLMYDFVSETKLTWPSLTIQWLPG-NSSSTKQEMILGTHTSGE--DDNYLKIASI 75
           WK N  L+YD+++     WPSLT Q+ P  ++++ +  ++L + TS +  +D  + ++ +
Sbjct: 37  WKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTNDQHRLLLSSFTSSQLPEDESIYVSRV 96

Query: 76  ----ELPEDILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMPQDPNFI 131
                LP   L                +   ++                AR++PQ+P+ I
Sbjct: 97  STLKHLPWSSLNNFDMDEMEFKLDNSSKLPSKNLIKELNISFPMGDCNGARYLPQNPDVI 156

Query: 132 ATINGVGKVFLFDRSKDKNEALVSEHAFHKDNG------------------YGLSFNPRT 173
           A  +  G +++FDR+K      ++    H D G                    L++N + 
Sbjct: 157 AAASSNGSIYVFDRTKHG----LTRQKLH-DGGSMFELEFQSSSLEEHQEVVSLAWNWQR 211

Query: 174 KGELLSCSDDGTIALWNVMGTNTS---PSKAVTTHE---DIVNDCTWHEFNENLFGSVSE 227
           +G L +C   G + +W+V   + +     KA  TH       ND +W   + ++     E
Sbjct: 212 EGLLAACYSGGDVKVWDVKKYSRNFPVIDKADYTHNADPRGCNDVSWMVNHASILACCGE 271

Query: 228 DKTLQIHDKRTNSTVHRLTL-----SSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTA 282
             ++ + D R    V   T      S   N+  F+ H+  L  +  +   V L+D+R+  
Sbjct: 272 SNSINVIDTRAQKGVLSSTKDTKHHSRGINSSQFNYHNDMLLCSGDSTGRVNLWDIRDLE 331

Query: 283 DALHTMSGHEDSVTSLEFSPHKDGILCSSG-SDRRVLLWDLMQIGSEQAQEDAADGVPEL 341
             L ++  H  S++  +++P+   IL ++  SD  V LWD+ Q   E           EL
Sbjct: 332 TPLKSLD-HGSSISKTQWNPNLSTILATADQSDGLVKLWDIAQEPGE-----------EL 379

Query: 342 MMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKLT 384
           + +H GH   VND S+N++ PWLM SV  DN V +W+ ++ L 
Sbjct: 380 LFVHGGHMLGVNDISWNYHDPWLMCSVANDNSVQLWRPARNLV 422

>KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} similar
           to uniprot|P39108 Saccharomyces cerevisiae YDR142C PEX7
           May serve as intraperoxisomal receptor for type 2
           peroxisomal proteins (such as thiolase) Member of
           beta-transducin-related (WD-40) protein family
          Length = 367

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 64/274 (23%), Positives = 115/274 (41%), Gaps = 37/274 (13%)

Query: 136 GVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTN 195
           G GK+F+ D   ++   L ++    +D  + +++N   +  +L    DG++ L+++   N
Sbjct: 36  GNGKLFIID-IDNQGRMLETKSFVTQDGLFDVAWNELHENHVLVAQGDGSLRLFDIQ-LN 93

Query: 196 TSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLT--------- 246
             P      HE  V  C W+  N+ LF S S D T+++      S++  LT         
Sbjct: 94  DYPVAIFQEHEKEVFSCNWNLINKQLFVSSSWDGTVKVWTPMRQSSLTTLTPKPMTAHNS 153

Query: 247 -----------------LSSPFNTL---DFSKHSQNLFAAAGTDSLVYLYDLRNTADA-L 285
                            LS   N +    FS H  N+  +   +S V ++DLR  A+A  
Sbjct: 154 ALSSKDIPMSNQKRHTSLSKNKNCIYQSQFSPHDPNIVMSCAGNSYVTMFDLRQPANANQ 213

Query: 286 HTMSGHEDSVT-SLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMM 344
           ++   H    T + +F+ ++  I+ + G D  V +WDL  +    A       V E+   
Sbjct: 214 YSFMAHNGMETLTCDFNKYRSHIIATGGVDNMVKVWDLRMVRKMAANSRQPMSVNEI--- 270

Query: 345 HAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWK 378
             GH  A+   S++ +   ++ S   D    VW+
Sbjct: 271 -CGHDLAIRKVSWSPHHSNMLLSTSYDMTCRVWQ 303

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 73/293 (24%), Positives = 117/293 (39%), Gaps = 48/293 (16%)

Query: 129 NFIATINGVGKVFLFD-RSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIA 187
           N +    G G + LFD +  D   A+  EH   +   +  ++N   K   +S S DGT+ 
Sbjct: 74  NHVLVAQGDGSLRLFDIQLNDYPVAIFQEH---EKEVFSCNWNLINKQLFVSSSWDGTVK 130

Query: 188 LWNVM---GTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKT------LQIHDKRT 238
           +W  M      T   K +T H   ++       N+    S+S++K          HD   
Sbjct: 131 VWTPMRQSSLTTLTPKPMTAHNSALSSKDIPMSNQKRHTSLSKNKNCIYQSQFSPHDPNI 190

Query: 239 ------NSTVHRLTLSSPFN---------------TLDFSKHSQNLFAAAGTDSLVYLYD 277
                 NS V    L  P N               T DF+K+  ++ A  G D++V ++D
Sbjct: 191 VMSCAGNSYVTMFDLRQPANANQYSFMAHNGMETLTCDFNKYRSHIIATGGVDNMVKVWD 250

Query: 278 LRNT----ADALHTMS-----GHEDSVTSLEFSPHKDGILCSSGSDRRVLLW-DLMQIGS 327
           LR      A++   MS     GH+ ++  + +SPH   +L S+  D    +W DL   G 
Sbjct: 251 LRMVRKMAANSRQPMSVNEICGHDLAIRKVSWSPHHSNMLLSTSYDMTCRVWQDLSDDGR 310

Query: 328 E-QAQEDAADGVPELMMMHAGHKSAV--NDFSFNWNIPWLMASVEEDNIVHVW 377
               + ++ D       + + H   V   D+S  W  P  +AS   D  V +W
Sbjct: 311 RPTGKTNSIDPTHGCRFIFSHHTEFVFGADWSL-WGQPGYVASTSWDGDVCIW 362

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 27/125 (21%), Positives = 53/125 (42%), Gaps = 14/125 (11%)

Query: 120 RARFMPQDPNFIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGY---GLSFNPRTKGE 176
           +++F P DPN + +  G   V +FD  +  N    ++++F   NG       FN      
Sbjct: 180 QSQFSPHDPNIVMSCAGNSYVTMFDLRQPAN---ANQYSFMAHNGMETLTCDFNKYRSHI 236

Query: 177 LLSCSDDGTIALWNV-----MGTNTSPSKAV---TTHEDIVNDCTWHEFNENLFGSVSED 228
           + +   D  + +W++     M  N+    +V     H+  +   +W   + N+  S S D
Sbjct: 237 IATGGVDNMVKVWDLRMVRKMAANSRQPMSVNEICGHDLAIRKVSWSPHHSNMLLSTSYD 296

Query: 229 KTLQI 233
            T ++
Sbjct: 297 MTCRV 301

>NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {ON}
           Anc_7.310
          Length = 1276

 Score = 65.9 bits (159), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 62/220 (28%), Positives = 107/220 (48%), Gaps = 28/220 (12%)

Query: 127 DPNFIA-TINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYG-----LSFNPRTKGELLSC 180
           D  FIA  ++  GK+ LF  SK++N+  +S  +  K   +      L FNP+ +  L S 
Sbjct: 75  DNKFIAGALDDNGKIELF--SKEENDTKISLKSLGKFKKHTTAVNTLRFNPKQQNVLASA 132

Query: 181 SDDGTIALWNVMGTNTS-------PSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTL-Q 232
            ++G I +W++  T +S       P  A++T ++I    +W++   ++F S  +  T   
Sbjct: 133 GNNGEILIWDINKTLSSTDYSPSAPGIAMSTQDEI-KSVSWNKSLAHVFASAGDTTTYAS 191

Query: 233 IHDKRTNSTVHRLTLSSPFNTLD--------FSKHSQNLFAAAGTDS--LVYLYDLRNTA 282
           I D +    V  L  +SP   L           K +  +  A+G+DS  ++ ++DLRN+ 
Sbjct: 192 IWDLKAKKEVIHLNYTSPKTGLKPNLAVVEWHPKVTTYVATASGSDSDPVILIWDLRNSN 251

Query: 283 DALHTMSG-HEDSVTSLEFSPHKDGILCSSGSDRRVLLWD 321
             + T+ G H   + SL++    + +L SSG D  V LWD
Sbjct: 252 MPMTTLEGPHTKGIMSLDWCTKDESLLLSSGRDGIVALWD 291

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 59/123 (47%), Gaps = 10/123 (8%)

Query: 226 SEDKTLQI-----HDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLY---- 276
           S D TL++       K+  + V  +T  + F  LD+S  ++ +  A   +  + L+    
Sbjct: 37  SNDSTLELWSLLSDPKKDPTPVASITTDARFKDLDWSFDNKFIAGALDDNGKIELFSKEE 96

Query: 277 -DLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAA 335
            D + +  +L     H  +V +L F+P +  +L S+G++  +L+WD+ +  S      +A
Sbjct: 97  NDTKISLKSLGKFKKHTTAVNTLRFNPKQQNVLASAGNNGEILIWDINKTLSSTDYSPSA 156

Query: 336 DGV 338
            G+
Sbjct: 157 PGI 159

>Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa]
           {ON} complement(166721..169273) [2553 nt, 851 aa]
          Length = 850

 Score = 65.9 bits (159), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 68/216 (31%), Positives = 104/216 (48%), Gaps = 26/216 (12%)

Query: 177 LLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDK 236
           LLS S+D T+ LW+V   +  P  +   HE  V D  +     NLF + S D+T ++   
Sbjct: 589 LLSASEDKTVRLWSVQ--DDKPLVSYKGHEKPVWDVEFSPSCNNLFATASNDQTARLW-- 644

Query: 237 RTNSTVHRL-TLSSPFNTLD-FSKHSQNLFAAAGT-DSLVYLYDLRNTADALHTMSGHED 293
            +   V+ L  ++   N +D  S HS   +   G+ D  V ++D+ NT D++    GH  
Sbjct: 645 -SCDRVYPLRVMAGHLNDVDCVSFHSNGRYIFTGSSDKTVRMWDI-NTGDSVRLFMGHNS 702

Query: 294 SVTSLEFSPHKDGILCSSGSDRRVL-LWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAV 352
           +VTSL  SP  DG   S+GSD  ++ +WD   IGS +          +L  M    KS++
Sbjct: 703 TVTSLSVSP--DGKWISTGSDDGIITIWD---IGSGR----------KLKNMRGHGKSSI 747

Query: 353 NDFSFNWNIPWLMASVEEDNIVHVWKVSKKLTSPGL 388
           +  S+N     L+ S   D  V VW ++K    P L
Sbjct: 748 HSLSYNPE-GTLLVSGGADQSVRVWDLNKGTFEPSL 782

 Score = 37.0 bits (84), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 57/124 (45%), Gaps = 17/124 (13%)

Query: 256 FSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDR 315
           FS   + L +A+  D  V L+ +++    L +  GHE  V  +EFSP  + +  ++ +D+
Sbjct: 582 FSAGDEYLLSAS-EDKTVRLWSVQDDK-PLVSYKGHEKPVWDVEFSPSCNNLFATASNDQ 639

Query: 316 RVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVH 375
              LW             + D V  L +M AGH + V+  SF+ N  ++      D  V 
Sbjct: 640 TARLW-------------SCDRVYPLRVM-AGHLNDVDCVSFHSNGRYIFTG-SSDKTVR 684

Query: 376 VWKV 379
           +W +
Sbjct: 685 MWDI 688

>KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 94/416 (22%), Positives = 162/416 (38%), Gaps = 83/416 (19%)

Query: 24  PLMYDFVSETKLTWPSLTIQWLPGNSSSTKQE------MILGTHTSGEDDNYLKIAS--- 74
           P +YD +    + WP LT+  +P N  S ++       M   T  S + +N L + S   
Sbjct: 119 PTVYDMLHNVTMPWPCLTLDIIPDNLGSQRRNYPQSLLMTTATQASRKKENELMVLSLSQ 178

Query: 75  -----IELPEDILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMP---- 125
                ++  +++                +  N+  R              R R  P    
Sbjct: 179 LAKTLVKDDDEVNSDEEDEDRDETDPIIENENISLRDTTN----------RLRVSPFAQS 228

Query: 126 QDPNFIATINGVGKVFLFD----------------RSKDKNEALVSEHAFHKDNGYGLSF 169
                 AT++  G+V++FD                +S  +    +  H   +  GY L +
Sbjct: 229 NKEVLTATMSENGEVYIFDLGPQSKAFSSPGYQVPKSSKRPVHTIKNHGNVE--GYALDW 286

Query: 170 NPRTK-GELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDI-------VNDCTWHEFNENL 221
           +P  K G LL+    G I L     T  + SK VT  +         V D  W      +
Sbjct: 287 SPLIKTGALLTGDCSGQIYL-----TQRNTSKWVTDKQPFTVGNNKSVEDIQWSRTEATV 341

Query: 222 FGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQN----LFAAAGTDSLVY-LY 276
           F S   D  ++I D R  S  H+  LS   +  D +  S N       A+G D+  + ++
Sbjct: 342 FASCGCDGYVRIWDTR--SKQHKPALSVKASNTDVNVISWNEKIGYLLASGDDNGSWGVW 399

Query: 277 DLR-------NTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL-MQIGSE 328
           DLR       N    +     H+ ++TS+ F+P ++ I+  +  D  V LWDL ++   E
Sbjct: 400 DLRQFTPDNINNVQPVAQYDFHKGAITSISFNPLEESIIAVASEDNTVTLWDLSVEADDE 459

Query: 329 QAQEDAADG------VPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWK 378
           + ++ AA+        P+L+ +H   +  V D  ++  IP  + S   D + ++WK
Sbjct: 460 EIKQQAAETKELESIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NIWK 512

>TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 91/405 (22%), Positives = 151/405 (37%), Gaps = 61/405 (15%)

Query: 24  PLMYDFVSETKLTWPSLTIQWLPGNSSSTKQE------MILGTHTSGEDDNYLKIASIEL 77
           P +Y+ +    L WP LT+  +P N  S ++       M   T  S + DN L +  +  
Sbjct: 119 PTVYEMLHNVNLPWPCLTLDIIPDNLGSERRNYPQSILMTTATQASKKKDNELMVLKLSH 178

Query: 78  PEDILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMP----QDPNFIAT 133
               L                                     R R  P    Q     +T
Sbjct: 179 LTKTL-VKDDDNVDNEDDDEDDDEAGEPILENESLPLRDTTNRLRISPYATVQQEILTST 237

Query: 134 INGVGKVFLFDRSKDKNEALVSEHAFHKD--------------NGYGLSFNPRTK-GELL 178
           ++  G+VF++D +          +   K                GYGL ++P  K G LL
Sbjct: 238 MSENGEVFIYDLTPQTRAFETPGYQIPKTAKRPLHTIRNHGNVEGYGLDWSPLIKTGALL 297

Query: 179 SCSDDGTIALWNVMGTNTSPSKAVTTHEDI-------VNDCTWHEFNENLFGSVSEDKTL 231
           +    G + L     T    SK VT            + D  W      +F +   D  +
Sbjct: 298 TGDCSGMVYL-----TQRHTSKWVTDKTPFTVGNNKSIEDIQWSRTESTVFATAGCDGYI 352

Query: 232 QIHDKRTNSTVHRLTLSSPFNTLDFSKHSQN----LFAAAGTDSLVY-LYDLR----NTA 282
           +I D R  S  H+  +S+  +  D +  S N       A+G D   + ++DLR    N+ 
Sbjct: 353 RIWDTR--SKKHKPVISTVVSNTDVNVISWNEKMGYLLASGDDKGTWGIWDLRQFSPNSE 410

Query: 283 DALHTMSG--HEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLM------QIGSEQAQEDA 334
            AL       H+ ++TS+ F+P  + I+  +  D  V LWDL       +I  ++A+   
Sbjct: 411 KALPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQKAEIKE 470

Query: 335 ADGV-PELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWK 378
            + + P+L+ +H   +  V D  ++  IP  + S   D + +VWK
Sbjct: 471 LEQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NVWK 512

>NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {ON}
           Anc_6.276
          Length = 494

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 75/168 (44%), Gaps = 17/168 (10%)

Query: 169 FNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSED 228
           +NP     L+S S D T  +W++  +N   ++ +  H+  V D  +   +  LF S   D
Sbjct: 240 WNPIDTNLLISSSIDTTCIVWDLQSSNYVKTQLIA-HDSEVYDVRFLTQSTQLFASCGGD 298

Query: 229 KTLQIHDKRTNSTVHRLTLSSP-------------FNTLDFSKHSQNLFAAAGTDS-LVY 274
            ++++ D R  S  H   +  P                L+ S H  N+ A    DS  + 
Sbjct: 299 GSVRVFDLR--SLAHSTIIYEPPVSDLNPDTSQFALLRLEPSPHDPNVMATFAADSNKIL 356

Query: 275 LYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
           + D+RN    L  + GH  SV  +++ P K  +L S G D +VL WDL
Sbjct: 357 ILDMRNPESPLMILEGHSASVNQIKWHPIKRNVLLSGGDDCQVLYWDL 404

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 38/89 (42%), Gaps = 3/89 (3%)

Query: 120 RARFMPQDPNFIATING-VGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELL 178
           R    P DPN +AT      K+ + D    ++  ++ E   H  +   + ++P  +  LL
Sbjct: 334 RLEPSPHDPNVMATFAADSNKILILDMRNPESPLMILEG--HSASVNQIKWHPIKRNVLL 391

Query: 179 SCSDDGTIALWNVMGTNTSPSKAVTTHED 207
           S  DD  +  W++     S     TT +D
Sbjct: 392 SGGDDCQVLYWDLNKCTASSDPVATTKDD 420

>KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} similar
           to uniprot|P42841 Saccharomyces cerevisiae YNL317W PFS2
           Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 452

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 91/218 (41%), Gaps = 16/218 (7%)

Query: 167 LSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVS 226
           +SF+P T  + +SCSDD  + +WN   +N    + ++ H   V  C WH     L  S S
Sbjct: 171 ISFSP-TDQKFVSCSDDNVLKIWNF--SNGQQERVLSGHHWDVKSCDWHP-KMGLIVSGS 226

Query: 227 EDKTLQIHDKRTNSTVHR-LTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADAL 285
           +D  ++  D R+ S V   L       +  F     NL +    D    +YD+R  A  L
Sbjct: 227 KDNLIKFWDPRSGSCVSTMLGFKHTIISTKFQPKQGNLLSVISKDKTCKVYDIRQQAKEL 286

Query: 286 HTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMH 345
            ++    D +T L++ P  + +      D  +  +DL Q   E         +P      
Sbjct: 287 FSVRDDVDYMT-LQWHPIDETVFTVGCYDGSIKHFDLSQ---ENQPNKPTHNIP------ 336

Query: 346 AGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKL 383
             H+  V   +++  I  +MAS  +D  +  W  S+ +
Sbjct: 337 YAHEKCVTSLAYS-PIGHIMASASKDRTIRFWTRSRAV 373

>Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W
           (REAL)
          Length = 1271

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 88/194 (45%), Gaps = 20/194 (10%)

Query: 148 DKNEALVSEHAF--HKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVT-- 203
           D ++ +VS   F  H  +   + FN +    L S  ++G I +W++     SPS      
Sbjct: 93  DAHDTIVSTAKFSNHSSSVKTVKFNSKQDNVLASGGNNGEIFIWDMNKCTESPSSYTPLT 152

Query: 204 -----THEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLD--- 255
                +  D VN   W++   ++F S        I D +    V  L+ +SP + +    
Sbjct: 153 PGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKAKKEVIHLSYTSPNSGIKQQL 212

Query: 256 -----FSKHSQNLFAAAGTDS--LVYLYDLRNTADALHTMS-GHEDSVTSLEFSPHKDGI 307
                  K+S  +  A G+D+   + ++DLRN    L T+S GH+  + SL++    + +
Sbjct: 213 SVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQTLSQGHQKGILSLDWCHQDENL 272

Query: 308 LCSSGSDRRVLLWD 321
           L SSG D  VLLW+
Sbjct: 273 LLSSGRDNTVLLWN 286

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 63/140 (45%), Gaps = 7/140 (5%)

Query: 245 LTLSSPFNTLDFSKHSQNLFAAA--GTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSP 302
           L + S FN LD+S +++ +  A   GT  L  + D  +T  +    S H  SV +++F+ 
Sbjct: 59  LQVDSKFNDLDWSHNNKTIAGALDNGTLELYSIGDAHDTIVSTAKFSNHSSSVKTVKFNS 118

Query: 303 HKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIP 362
            +D +L S G++  + +WD+      +  E  +   P            VN  ++N ++ 
Sbjct: 119 KQDNVLASGGNNGEIFIWDM-----NKCTESPSSYTPLTPGQSMSSVDEVNSLAWNQSLA 173

Query: 363 WLMASVEEDNIVHVWKVSKK 382
            + AS    N   +W +  K
Sbjct: 174 HVFASAGSSNFASIWDLKAK 193

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 70/156 (44%), Gaps = 16/156 (10%)

Query: 181 SDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQI------H 234
           S D ++ LW+++ T++    A    +   ND  W   N+ + G++ ++ TL++      H
Sbjct: 37  STDSSLELWSLLTTDSEKPMASLQVDSKFNDLDWSHNNKTIAGAL-DNGTLELYSIGDAH 95

Query: 235 DKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMS----- 289
           D    ST      SS   T+ F+    N+ A+ G +  ++++D+    ++  + +     
Sbjct: 96  DTIV-STAKFSNHSSSVKTVKFNSKQDNVLASGGNNGEIFIWDMNKCTESPSSYTPLTPG 154

Query: 290 ---GHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
                 D V SL ++     +  S+GS     +WDL
Sbjct: 155 QSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDL 190

>KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.401
           YMR131C
          Length = 517

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 86/404 (21%), Positives = 154/404 (38%), Gaps = 59/404 (14%)

Query: 24  PLMYDFVSETKLTWPSLTIQWLPGNSSSTKQE------MILGTHTSGEDDNYLKIASI-E 76
           P +Y+ +    L WP +T+  +P    S ++       M   T  S + +N L + S+ +
Sbjct: 120 PTVYEMLHNVNLPWPCMTLDVIPDKLGSERRNYPQSILMTTATQASKKKENELMVLSLSQ 179

Query: 77  LPEDILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMPQDPNFI-ATIN 135
           L + ++ +                +                   + F   D   + AT++
Sbjct: 180 LNKTLVKSEEDEDEDEDSDEEDDSDPIIENENIKLNDTTNRLKVSPFASTDKEVLTATMS 239

Query: 136 GVGKVFLFDRSKDKNEALVSEHAFHKD--------------NGYGLSFNPRTK-GELLSC 180
             G+V++FD +          +   K                GY L ++P  K G LL+ 
Sbjct: 240 ENGEVYIFDLAPQSKAFSTPGYQIPKTARRPIHTVRNHGNVEGYALDWSPMIKNGALLTG 299

Query: 181 SDDGTIALWNVMGTNTSPSKAVTTHEDI-------VNDCTWHEFNENLFGSVSEDKTLQI 233
              G I       T    SK +T  +         V D  W      +F S   D  ++I
Sbjct: 300 DCSGQIYF-----TQRHTSKWITDKQPFTAENNKSVEDIQWSRTESTVFASAGCDGYIRI 354

Query: 234 HDKRTNSTVHRLTLS-----SPFNTLDFSKHSQNLFAAAGTDSLVYLYDLR-------NT 281
            D R  S  H+  LS     +  N + +S+    L A+   + L  ++DLR       N 
Sbjct: 355 WDTR--SKKHKPALSVKASNTDVNVISWSEKIGYLLASGDDNGLWGVWDLRQFSPDNIND 412

Query: 282 ADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL-MQIGSEQAQEDAADG--- 337
              +     H+ ++TS+ F+P  D I+  +  D  V LWDL ++   E+ ++  A+    
Sbjct: 413 VQPVAQYDFHKGAITSINFNPLDDSIIAVASEDNTVTLWDLSVEADDEEIKQQIAETKEL 472

Query: 338 ---VPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWK 378
               P+L+ +H   +  V D  ++  IP  + S   D + ++WK
Sbjct: 473 EKIPPQLLFVH--WQKDVKDVKWHKQIPGCLVSTGTDGL-NIWK 513

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 64/130 (49%), Gaps = 11/130 (8%)

Query: 254 LDFSKHSQNLFAAAGTDSLVYLYDLRNTA--DALHTMSGHEDSVTSLEFSPHKDGILCSS 311
           + +S+    +FA+AG D  + ++D R+     AL   + + D V  + +S  K G L +S
Sbjct: 333 IQWSRTESTVFASAGCDGYIRIWDTRSKKHKPALSVKASNTD-VNVISWS-EKIGYLLAS 390

Query: 312 GSDRRVL-LWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEE 370
           G D  +  +WDL Q     + ++  D  P  +  +  HK A+   +FN     ++A   E
Sbjct: 391 GDDNGLWGVWDLRQF----SPDNINDVQP--VAQYDFHKGAITSINFNPLDDSIIAVASE 444

Query: 371 DNIVHVWKVS 380
           DN V +W +S
Sbjct: 445 DNTVTLWDLS 454

>TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7.310
           YDL195W
          Length = 1264

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/216 (27%), Positives = 93/216 (43%), Gaps = 25/216 (11%)

Query: 127 DPNFIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYG--LSFNPRTKGELLSCSDDG 184
           D   IA     G V LF  + D   +L SE  F +  G    + FN +    L S    G
Sbjct: 73  DDKIIAGALDSGVVELFSSTGD---SLKSEARFQQHQGAAKTVKFNSKQNNVLASGGSKG 129

Query: 185 TIALW-------NVMG-TNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDK 236
            I +W       N  G T  +P  A T  E++ +   W++   ++F S        I D 
Sbjct: 130 EIYIWDLNTCLKNSEGYTPLTPGVASTPIEEVTS-LAWNQSLAHVFASAGSTSYASIWDL 188

Query: 237 RTNSTVHRLTLSSPFNTLD--------FSKHSQNLFAAAGTDS--LVYLYDLRNTADALH 286
           +    V  L+ +SP   L           K+S  +  A G+D+  L+ ++DLRN    L 
Sbjct: 189 KAKKEVIHLSYASPSTGLKSQLSVVEWHPKNSTRVATATGSDTEPLILVWDLRNANTPLQ 248

Query: 287 TMS-GHEDSVTSLEFSPHKDGILCSSGSDRRVLLWD 321
            +S GH   + SL++    + +L SSG D  ++LW+
Sbjct: 249 VLSKGHSKGILSLDWCSQDEELLLSSGRDNTIVLWN 284

 Score = 34.3 bits (77), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 34/157 (21%), Positives = 69/157 (43%), Gaps = 20/157 (12%)

Query: 181 SDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNS 240
           S +  + LW+++ ++ S  KA    +   ND  W   ++ + G++ +   +++     +S
Sbjct: 37  SSESALELWSLLASDPSKPKASLAVDAKFNDLDWSNDDKIIAGAL-DSGVVELF----SS 91

Query: 241 TVHRLTLSSPFN-------TLDFSKHSQNLFAAAGTDSLVYLYD----LRNTADALHTMS 289
           T   L   + F        T+ F+    N+ A+ G+   +Y++D    L+N+        
Sbjct: 92  TGDSLKSEARFQQHQGAAKTVKFNSKQNNVLASGGSKGEIYIWDLNTCLKNSEGYTPLTP 151

Query: 290 GHE----DSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
           G      + VTSL ++     +  S+GS     +WDL
Sbjct: 152 GVASTPIEEVTSLAWNQSLAHVFASAGSTSYASIWDL 188

>Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {ON}
           YMR131C (REAL)
          Length = 510

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 107/237 (45%), Gaps = 27/237 (11%)

Query: 164 GYGLSFNPRTK-GELLSCSDDGTIALWNVMGTN--TSPSKAVTTHEDIVNDCTWHEFNEN 220
           GYGL ++P  K G LLS    G I L     +   T       ++ + + D  W      
Sbjct: 275 GYGLDWSPLIKTGALLSGDCSGQIYLTQRHTSRWVTDKQSFTVSNNESIEDIQWSRTEST 334

Query: 221 LFGSVSEDKTLQIHDKRTNSTVHRLTLS-----SPFNTLDFSKHSQNLFAAAGTDSLVYL 275
           +F + + D  ++I D R  S  H+  +S     +  N + +S     L A+   +    +
Sbjct: 335 VFATAACDGYIRIWDTR--SKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGV 392

Query: 276 YDLR----NTADALHTMSG---HEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL-MQIGS 327
           +DLR    + AD +  ++    H+ ++TS+ F+P  + I+     D  V LWDL ++   
Sbjct: 393 WDLRQFTPSNADTVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADD 452

Query: 328 EQAQEDAA------DGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWK 378
           E+ ++ AA      D  P+L+ +H   +  V D  ++  IP  + S   D + +VWK
Sbjct: 453 EEIKQQAAETKELQDIPPQLLFVH--WQREVKDVKWHKQIPGCLVSTGTDGL-NVWK 506

 Score = 37.0 bits (84), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 60/130 (46%), Gaps = 11/130 (8%)

Query: 254 LDFSKHSQNLFAAAGTDSLVYLYDLRNTA--DALHTMSGHEDSVTSLEFSPHKDGILCSS 311
           + +S+    +FA A  D  + ++D R+     A+   + + D V  + +S  K G L +S
Sbjct: 326 IQWSRTESTVFATAACDGYIRIWDTRSKKHKPAISVKASNTD-VNVISWS-DKIGYLLAS 383

Query: 312 GSDRRVL-LWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEE 370
           G D     +WDL Q     A     D V + +  +  HK A+   +FN     ++A   E
Sbjct: 384 GDDNGTWGVWDLRQFTPSNA-----DTV-QPVAQYDFHKGAITSIAFNPLDESIVAVGSE 437

Query: 371 DNIVHVWKVS 380
           DN V +W +S
Sbjct: 438 DNTVTLWDLS 447

 Score = 30.4 bits (67), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 28/56 (50%)

Query: 136 GVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNV 191
           GV  +  F  S       V+++ FHK     ++FNP  +  +   S+D T+ LW++
Sbjct: 391 GVWDLRQFTPSNADTVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDL 446

>KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 477

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 77/164 (46%), Gaps = 5/164 (3%)

Query: 159 FHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFN 218
           FH D  +    + R+K   ++      I LW+   + + P+  ++   D V+   +++  
Sbjct: 170 FHGDYAFLGIDHHRSKPYFVTAG--AEINLWD--SSRSRPTANLSWGADNVSTVKFNQNE 225

Query: 219 ENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDL 278
            ++F S   D ++ ++D RTNS   + T     N L ++      F  A  D   Y YD+
Sbjct: 226 TDIFASAGSDNSVVLYDLRTNSPTQKFTQRMRTNALCWNPMEAYNFVVASEDHNAYYYDM 285

Query: 279 RNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
           RN + ALH    H  +V  ++FSP  D I+  S  D+ + ++ +
Sbjct: 286 RNLSRALHVFKDHVSAVMDVDFSPTGDEIVTGS-YDKTIRIYQV 328

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 86/186 (46%), Gaps = 31/186 (16%)

Query: 160 HKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVND-CTWHEF- 217
           H+D  Y ++ N     +L S S DG +  WN M T      +   H  +V+  C   +  
Sbjct: 66  HRDGVYTIAKNYHALNKLASASADGVVKYWN-MSTREEIC-SFKAHYGLVHGLCVTPQHL 123

Query: 218 ----NENLFGSVSEDKTLQI------------HDKRTNSTVHRL-TLSSPFNTLDFSKH- 259
               NEN   S  +DKT+++            +D+  +ST   + T    +  L    H 
Sbjct: 124 SANKNENYMLSCGDDKTVKLWSVNTEDFSSSKNDEEQSSTDGLIKTFHGDYAFLGIDHHR 183

Query: 260 SQNLFAAAGTDSLVYLYD---LRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRR 316
           S+  F  AG +  + L+D    R TA+    +S   D+V++++F+ ++  I  S+GSD  
Sbjct: 184 SKPYFVTAGAE--INLWDSSRSRPTAN----LSWGADNVSTVKFNQNETDIFASAGSDNS 237

Query: 317 VLLWDL 322
           V+L+DL
Sbjct: 238 VVLYDL 243

>ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR131C
           (RRB1)
          Length = 521

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 87/411 (21%), Positives = 156/411 (37%), Gaps = 74/411 (18%)

Query: 24  PLMYDFVSETKLTWPSLTIQWLPGNSSSTKQE------MILGTHTSGEDDNYLKIASIEL 77
           P +Y+ +    L WP +T+  +P N  S ++       M   T  S + DN L +  +  
Sbjct: 125 PTVYEMLHNVNLPWPCMTLDLIPDNLGSERRNYPQSILMTTATQASKKKDNELLVLKLSQ 184

Query: 78  PEDILGAXXXXXXXXXXXXX--------QQRNVQSRXXXXXXXXXXXXXXRARFMPQDPN 129
               L                       +  N++ R                  +     
Sbjct: 185 LAKTLAKDEDDGAEDDEDDEDEDADPIIENENIKLRDTTNRMQVSPFAAESQEVL----- 239

Query: 130 FIATINGVGKVFLFD----------------RSKDKNEALVSEHAFHKDNGYGLSFNPRT 173
             AT++  G+  +FD                ++  + +  +  H      GYGL ++P  
Sbjct: 240 -AATMSENGEAHIFDLGPQVKAFSSPGYQVPKAAQRPQYTIKNHG--NVEGYGLDWSPLI 296

Query: 174 K-GELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDI-------VNDCTWHEFNENLFGSV 225
           K G LL+    G + L     T  + SK +T  +         + D  W      +F + 
Sbjct: 297 KTGALLTGDCSGRVFL-----TQRTSSKWITDKQPFTVDNNKSIEDIKWSPSENTVFATC 351

Query: 226 SEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQN----LFAAAGTDSLVY-LYDLRN 280
             D  ++I D R  S  H+  LS   +  D +  S N       A G D+  + ++DLR 
Sbjct: 352 GVDGHVRIWDIR--SKKHKPALSVKVSDTDVNVMSWNQKISYLLATGDDNGTWGVWDLRQ 409

Query: 281 TADALHTMSG------HEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL-MQIGSEQAQED 333
            ++    +S       H+ ++TS+ F+P  + I+  +  D  V LWDL ++   E+ ++ 
Sbjct: 410 FSNQQGGVSPVAQYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQ 469

Query: 334 AADG------VPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWK 378
           AA+        P+L+ +H   +  V D  ++  IP  + S   D + +VWK
Sbjct: 470 AAEVKELQQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NVWK 517

>Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W
           (REAL)
          Length = 1273

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 50/196 (25%), Positives = 88/196 (44%), Gaps = 20/196 (10%)

Query: 146 SKDKNEALVSEHAF--HKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVT 203
           + + N+ + S   F  H  +   + FN R    L S  ++G I +W++     SPS    
Sbjct: 91  TNEANDTISSTAKFGSHSSSVKTVKFNARQDNVLASGGNNGEIFIWDMNKCTESPSTYTP 150

Query: 204 -------THEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLD- 255
                  +  D VN   W++   ++F S        I D +    V  L+ +SP + +  
Sbjct: 151 LTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKAKKEVIHLSYTSPSSGIKQ 210

Query: 256 -------FSKHSQNLFAAAGTDS--LVYLYDLRNTADALHTMS-GHEDSVTSLEFSPHKD 305
                    K+S  +  A G+D+   + ++DLRN    + T++ GH+  + SL++    +
Sbjct: 211 QLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPMQTLNQGHQKGILSLDWCDQDE 270

Query: 306 GILCSSGSDRRVLLWD 321
            +L SSG D  VLLW+
Sbjct: 271 NLLLSSGRDNTVLLWN 286

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 72/155 (46%), Gaps = 14/155 (9%)

Query: 181 SDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIH-----D 235
           S D ++ LW+++ T++    A    +   ND  W   NE + G++ ++ TL+++     +
Sbjct: 37  STDSSLELWSLLATDSEKPLASLQVDSKFNDLDWSHNNEIIAGAL-DNGTLELYSTNEAN 95

Query: 236 KRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMS------ 289
              +ST    + SS   T+ F+    N+ A+ G +  ++++D+    ++  T +      
Sbjct: 96  DTISSTAKFGSHSSSVKTVKFNARQDNVLASGGNNGEIFIWDMNKCTESPSTYTPLTPGQ 155

Query: 290 --GHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
                D V SL ++     +  S+GS     +WDL
Sbjct: 156 SMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDL 190

 Score = 30.4 bits (67), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 28/120 (23%), Positives = 53/120 (44%), Gaps = 6/120 (5%)

Query: 182 DDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNST 241
           +D +I +W++   NT        H+  +    W + +ENL  S   D T+ + +  +   
Sbjct: 233 NDPSILVWDLRNANTPMQTLNQGHQKGILSLDWCDQDENLLLSSGRDNTVLLWNPESAEQ 292

Query: 242 VHRLTLSS--PFNTLDFSKHSQNLFAAAGTDSLV---YLYDLRNTADALHTMSGHEDSVT 296
           + +        F T  F+  + +LFA A  D+ +    L +L NT D   + +  ++S T
Sbjct: 293 LSQFPARGNWCFKT-KFAPEAPDLFACASFDNRIEVQTLQNLTNTLDEQESETKQQESET 351

>TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.401
           YMR131C
          Length = 514

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 109/242 (45%), Gaps = 37/242 (15%)

Query: 164 GYGLSFNPRTK-GELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDI-------VNDCTWH 215
           GYGL ++P  K G LL+    G + L     T    SK VT  +         + D  W 
Sbjct: 279 GYGLDWSPLIKTGALLTGDCSGQVYL-----TQRHTSKWVTDKQPFTFSNNKSIEDIQWS 333

Query: 216 EFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQN-----LFAAAGTD 270
                +F +   D  ++I D R  S  H+  +S+  +  D +  S N     L A+   D
Sbjct: 334 RTESTVFATSGCDGYIRIWDTR--SKKHKPAISTRASATDVNVISWNEKIGYLLASGDDD 391

Query: 271 SLVYLYDLR----NTADALHTMSG---HEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL- 322
               ++DLR    N ++ +  ++    H+ ++TS+ F+P  + I+  +  D  V LWDL 
Sbjct: 392 GRWGVWDLRQLSPNNSENVQPVAQYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDLS 451

Query: 323 MQIGSEQAQEDAADG------VPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHV 376
           ++   E+ ++ AA+        P+L+ +H   +  V D  ++  IP  + S   D + +V
Sbjct: 452 VEADDEEIKQQAAETKELQQIPPQLLFVH--WQKEVKDVKWHRQIPGCLVSTGTDGL-NV 508

Query: 377 WK 378
           WK
Sbjct: 509 WK 510

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 59/132 (44%), Gaps = 15/132 (11%)

Query: 254 LDFSKHSQNLFAAAGTDSLVYLYDLRNTA--DALHTMSGHEDSVTSLEFSPHKDGILCSS 311
           + +S+    +FA +G D  + ++D R+     A+ T +   D V  + ++     +L S 
Sbjct: 330 IQWSRTESTVFATSGCDGYIRIWDTRSKKHKPAISTRASATD-VNVISWNEKIGYLLASG 388

Query: 312 GSDRRVLLWDLMQIG---SEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASV 368
             D R  +WDL Q+    SE  Q  A          +  HK A+   SFN     ++A  
Sbjct: 389 DDDGRWGVWDLRQLSPNNSENVQPVA---------QYDFHKGAITSISFNPLDESIIAVA 439

Query: 369 EEDNIVHVWKVS 380
            EDN V +W +S
Sbjct: 440 SEDNTVTLWDLS 451

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 29/56 (51%)

Query: 136 GVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNV 191
           GV  +     +  +N   V+++ FHK     +SFNP  +  +   S+D T+ LW++
Sbjct: 395 GVWDLRQLSPNNSENVQPVAQYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDL 450

>YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON}
           RRB1Essential nuclear protein involved in early steps of
           ribosome biogenesis; physically interacts with the
           ribosomal protein Rpl3p
          Length = 511

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 107/242 (44%), Gaps = 37/242 (15%)

Query: 164 GYGLSFNPRTK-GELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDI-------VNDCTWH 215
           GYGL ++P  K G LLS    G I       T    S+ VT  +         + D  W 
Sbjct: 276 GYGLDWSPLIKTGALLSGDCSGQIYF-----TQRHTSRWVTDKQPFTVSNNKSIEDIQWS 330

Query: 216 EFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLS-----SPFNTLDFSKHSQNLFAAAGTD 270
                +F +   D  ++I D R  S  H+  +S     +  N + +S     L A+   +
Sbjct: 331 RTESTVFATAGCDGYIRIWDTR--SKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDN 388

Query: 271 SLVYLYDLR----NTADALHTMSG---HEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL- 322
               ++DLR    + ADA+  ++    H+ ++TS+ F+P  + I+     D  V LWDL 
Sbjct: 389 GTWGVWDLRQFTPSNADAVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLS 448

Query: 323 MQIGSEQAQEDAADG------VPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHV 376
           ++   E+ ++ AA+        P+L+ +H   +  V D  ++  IP  + S   D + +V
Sbjct: 449 VEADDEEIKQQAAETKELQEIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NV 505

Query: 377 WK 378
           WK
Sbjct: 506 WK 507

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 61/130 (46%), Gaps = 11/130 (8%)

Query: 254 LDFSKHSQNLFAAAGTDSLVYLYDLRNTA--DALHTMSGHEDSVTSLEFSPHKDGILCSS 311
           + +S+    +FA AG D  + ++D R+     A+   + + D V  + +S  K G L +S
Sbjct: 327 IQWSRTESTVFATAGCDGYIRIWDTRSKKHKPAISVKASNTD-VNVISWS-DKIGYLLAS 384

Query: 312 GSDRRVL-LWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEE 370
           G D     +WDL Q     A  DA   V +    +  HK A+   +FN     ++A   E
Sbjct: 385 GDDNGTWGVWDLRQFTPSNA--DAVQPVAQ----YDFHKGAITSIAFNPLDESIVAVGSE 438

Query: 371 DNIVHVWKVS 380
           DN V +W +S
Sbjct: 439 DNTVTLWDLS 448

>NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {ON}
           Anc_2.401 YMR131C
          Length = 511

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 84/406 (20%), Positives = 151/406 (37%), Gaps = 61/406 (15%)

Query: 24  PLMYDFVSETKLTWPSLTIQWLPGNSSSTKQE------MILGTHTSGEDDNYLKIASIEL 77
           P +Y+ +    + WP +T+  +P N  S ++       M   T  S + +N L + S+  
Sbjct: 112 PSVYEMLHNVNVPWPCMTLDIIPDNLGSERRNYPQSLLMATATQASRKKENELMVLSLSN 171

Query: 78  PEDILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMP----QDPNFIAT 133
               L                 R+                  R +  P    ++    AT
Sbjct: 172 LVKTLVKDDEEEEEEDVDNEDDRDDSDPIIENENIPLRDTTNRLKISPFASSKEEVLAAT 231

Query: 134 INGVGKVFLFDRSKDKNEALVSEHAFHKD--------------NGYGLSFNPRTK-GELL 178
           ++  G+V++FD            +   K                GY L ++P TK G LL
Sbjct: 232 MSENGEVYIFDLGPQSKAFSTPGYKVPKAAKRPIHTVKNHGNVEGYALDWSPLTKTGALL 291

Query: 179 SCSDDGTIALWNVMGTNTSPSKAVTTHEDI-------VNDCTWHEFNENLFGSVSEDKTL 231
           +    G I       T    SK +T  +         + D  W      +F S   D  +
Sbjct: 292 TGDCSGQIYF-----TQRHTSKWITDKQPFTVANNQSIEDIQWSRTESTVFASAGCDGYI 346

Query: 232 QIHDKRTNSTVHRLTLS-----SPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRN------ 280
           +I D R  S  H+  +S     +  N + +S+    L A+   +    ++DLR       
Sbjct: 347 RIWDTR--SKKHKPAISVKASNTDVNVISWSEKLGYLLASGDDNGTWGVWDLRQFSPENA 404

Query: 281 -TADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL-MQIGSEQAQEDAADG- 337
            +   +     H+ ++TS+ F+P  + I+     D  V LWDL ++   E+ ++ AA+  
Sbjct: 405 GSVQPVAQYDFHKGAITSISFNPLDESIIAVGSEDNTVTLWDLSVEADDEEIKQQAAETK 464

Query: 338 -----VPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWK 378
                 P+L+ +H   +  V D  ++  IP  + S   D + ++WK
Sbjct: 465 ELQQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NIWK 507

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 62/130 (47%), Gaps = 11/130 (8%)

Query: 254 LDFSKHSQNLFAAAGTDSLVYLYDLRNTA--DALHTMSGHEDSVTSLEFSPHKDGILCSS 311
           + +S+    +FA+AG D  + ++D R+     A+   + + D V  + +S  K G L +S
Sbjct: 327 IQWSRTESTVFASAGCDGYIRIWDTRSKKHKPAISVKASNTD-VNVISWS-EKLGYLLAS 384

Query: 312 GSDRRVL-LWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEE 370
           G D     +WDL Q   E A      G  + +  +  HK A+   SFN     ++A   E
Sbjct: 385 GDDNGTWGVWDLRQFSPENA------GSVQPVAQYDFHKGAITSISFNPLDESIIAVGSE 438

Query: 371 DNIVHVWKVS 380
           DN V +W +S
Sbjct: 439 DNTVTLWDLS 448

>Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 520
           aa] {ON} ANNOTATED BY YGOB -
          Length = 520

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 85/415 (20%), Positives = 156/415 (37%), Gaps = 80/415 (19%)

Query: 24  PLMYDFVSETKLTWPSLTIQWLPGNSSSTKQE------MILGTHTSGEDDNYLKIASIEL 77
           P +Y+ +    + WP +T+  +P +  S ++       M   T  S + DN L +  +  
Sbjct: 122 PTVYEMLHNVNMPWPCMTLDIIPDSLGSERRNYPQSILMTTATQASKKKDNELMVLKLSQ 181

Query: 78  PEDILGAXXXXXXXXXXXXX-------QQRNVQSRXXXXXXXXXXXXXXRARFMP----- 125
               L                      +  N+Q R              R +  P     
Sbjct: 182 LTKTLAKEDNGEDEEEEDDDDTVDPIIENENIQLRDTTN----------RLKVSPFASSS 231

Query: 126 -QDPNFIATINGVGKVFLFDRS--------------KDKNEALVSEHAFHKDNGYGLSFN 170
                  AT++  G+V++FD +              K   + + +  +     GY L ++
Sbjct: 232 NSQEILTATMSENGEVYIFDLASQVKAFKTPGYQIPKAAKKPIHTIKSHGNVEGYALDWS 291

Query: 171 PRTK-GELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDI-------VNDCTWHEFNENLF 222
           P  K G LL+    G + L     T    SK ++  E         V D  W      +F
Sbjct: 292 PLIKTGALLTGDCSGQVYL-----TQRHTSKWISDKEPFTVANNQSVEDIQWSRTESTVF 346

Query: 223 GSVSEDKTLQIHDKRTNSTVHRLTLS-----SPFNTLDFSKHSQNLFAAAGTDSLVYLYD 277
            S   D  +++ D R  S  H+  +S     +  N + +S+    L A+   +    ++D
Sbjct: 347 ASCGCDGYIRVWDTR--SKKHKPAISVKASNTDVNVISWSEKIGYLLASGDDNGTWGVWD 404

Query: 278 LR-------NTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL-MQIGSEQ 329
           LR       N    +     H+ ++TS+ F+P  + I+  +  D  V LWDL ++   E+
Sbjct: 405 LRQFSPSNSNNTSPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEE 464

Query: 330 AQEDAADG------VPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWK 378
            ++ AA+        P+L+ +H   +  V D  ++  IP  + S   D + ++WK
Sbjct: 465 IKQQAAETKELQQIPPQLLFVH--WQKEVKDVKWHRQIPGCLVSTGTDGL-NIWK 516

>ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL317W (PFS2)
          Length = 449

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 87/209 (41%), Gaps = 14/209 (6%)

Query: 176 ELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHD 235
           + ++CSDD  + +WN   +N    + ++ H   V  C WH     L  S S+D  +++ D
Sbjct: 177 KFVTCSDDNVLKIWNF--SNGQQERVLSGHHWDVKSCDWHP-KMGLIVSGSKDNLIKLWD 233

Query: 236 KRTNSTVHR-LTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDS 294
            RT   V   L L        F     NL A    D  + +YD+R     L T+    D 
Sbjct: 234 PRTGRNVSTILGLKHTVIKTKFQPTQGNLLAVVSKDKSIKIYDMRQHMRELQTIRDDMDY 293

Query: 295 VTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVND 354
           + SL + P  + I      +  +  +DL+         D ++  P    +   H+ +V  
Sbjct: 294 M-SLSWHPINETIFSVGCYNGAIKHFDLLH--------DNSNSTPACHTIPYAHEKSVTS 344

Query: 355 FSFNWNIPWLMASVEEDNIVHVWKVSKKL 383
            +++  +  ++AS  +D  +  W  S+ +
Sbjct: 345 LAYS-PVGHILASAAKDRTIRFWARSRPV 372

>KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]
           {ON} similar to uniprot|P42841 Saccharomyces cerevisiae
           YNL317W PFS2 Integral subunit of the pre-mRNA cleavage
           and polyadenylation factor (CPF) complex plays an
           essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 451

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 89/219 (40%), Gaps = 14/219 (6%)

Query: 166 GLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSV 225
           G+SF+  T  + ++CSDD  + +WN   +N      +T H   V  C WH     L  S 
Sbjct: 172 GISFS-GTDSKFVTCSDDNILKIWNF--SNGQQESTLTGHHWDVRSCDWHP-TMGLIASG 227

Query: 226 SEDKTLQIHDKRTNSTVHR-LTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADA 284
           S+D  +++ D R+   +   L       +  F     N+ A    D    ++D+R     
Sbjct: 228 SKDNLIKLWDPRSGQCISTILGCKHTIISTKFQPTKGNMLAVISKDKSCRVFDIRQNMKE 287

Query: 285 LHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMM 344
           L       D + SL + P  + I      D  +  +DLM     Q  +D++ G      +
Sbjct: 288 LAVYRDESDYM-SLTWHPINESIFTVGCYDGSMKHFDLM-----QEPQDSSSGC--FHNI 339

Query: 345 HAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKL 383
              H   +   ++N  +  ++AS  +D  +  W  S+ L
Sbjct: 340 PYAHDKCITSLAYN-PVGHILASASKDRTIRFWTRSRPL 377

>KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.316
           YDR142C
          Length = 381

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 68/300 (22%), Positives = 117/300 (39%), Gaps = 59/300 (19%)

Query: 136 GVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTN 195
           G G + LFD + DK    V +   H+D     +++   +   +S   DG + +W+V   N
Sbjct: 81  GDGSLRLFDTTLDKYPVAVYQE--HRDEVASCNWSLIGRNTFVSSGWDGLVKVWSVGRPN 138

Query: 196 T----------------SPSKAVTTH-EDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRT 238
           +                 P+   TT+ +D V    +   +++L    S D T+ + D R 
Sbjct: 139 SVMTLKPRTRSNTAVLDRPNGTGTTNGKDCVYQAKFSPHDDSLMVCCSGDSTVSLFDLRA 198

Query: 239 N----STVHRLTLSSPFNTL--DFSKHSQNLFAAAGTDSLVYLYDLR------------- 279
           +       H+    S   TL  DF+K+  N+ A  G D+ + ++DLR             
Sbjct: 199 SQPGQGPTHQFMAHSGSETLSVDFNKYRTNVIATGGVDNKIKIWDLRMLRTGPLSIRGKW 258

Query: 280 ----NTADALHT----MSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQ-- 329
                 A  +      + GHE +V  + +SPH    L S+  D    +W  M   +++  
Sbjct: 259 PEGPRGAKQVQCTNEIVGGHELAVRKVNWSPHSSNYLLSTSYDMTCCIWQDMGYATDRTR 318

Query: 330 ----------AQEDAADGVPELMMMHAGHKSAVNDFSFN-WNIPWLMASVEEDNIVHVWK 378
                      + +A+D    L+     H   V D  ++ W  P  +A+   D  V VWK
Sbjct: 319 GNNSGYGVTTGRTNASDLRNGLVSRFTAHTEFVFDGDWSLWGAPGFVATTGWDGNVFVWK 378

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 62/257 (24%), Positives = 106/257 (41%), Gaps = 48/257 (18%)

Query: 163 NGYGLSFNPRTKGELL--SCSDDGTIALWNVMGTNTSPSKAVTTHED-IVNDC----TWH 215
           +GY + ++P     L   + ++ G I    +   + SP   + T  D +  DC     W 
Sbjct: 10  SGYAVQYSPFLDSRLAVATGTNYGLIGNGKLWILDISPEGQMVTRRDYLTQDCLFDLAWS 69

Query: 216 EFNENLFGSVSEDKTLQIHDKRTNSTV------HRLTLSSPFNTLDFSKHSQNLFAAAGT 269
           E NEN       D +L++ D   +         HR  ++S     ++S   +N F ++G 
Sbjct: 70  ELNENQCLVAQGDGSLRLFDTTLDKYPVAVYQEHRDEVAS----CNWSLIGRNTFVSSGW 125

Query: 270 DSLVYLYDL--------------RNTA-----DALHTMSGHEDSVTSLEFSPHKDGILCS 310
           D LV ++ +               NTA     +   T +G +D V   +FSPH D ++  
Sbjct: 126 DGLVKVWSVGRPNSVMTLKPRTRSNTAVLDRPNGTGTTNG-KDCVYQAKFSPHDDSLMVC 184

Query: 311 SGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFS-FNWNIPWLMASVE 369
              D  V L+DL    S+  Q     G     M H+G ++   DF+ +  N+   +A+  
Sbjct: 185 CSGDSTVSLFDLR--ASQPGQ-----GPTHQFMAHSGSETLSVDFNKYRTNV---IATGG 234

Query: 370 EDNIVHVWKVSKKLTSP 386
            DN + +W +    T P
Sbjct: 235 VDNKIKIWDLRMLRTGP 251

>TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON}
           Anc_2.401 YMR131C
          Length = 526

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 87/404 (21%), Positives = 156/404 (38%), Gaps = 61/404 (15%)

Query: 26  MYDFVSETKLTWPSLTIQWLP---GNSSSTKQEMIL---GTHTSGEDDNYLKIASIELPE 79
           +Y+ +    L+WP +++  +P   GN      + IL    T  S + DN L I  +    
Sbjct: 129 VYEMLHNVNLSWPCMSLDIIPDSLGNERRNYPQSILLTTATQASKKKDNELMILQLSQLT 188

Query: 80  DILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMPQDPN-----FIATI 134
             L                +                    R +  P   N       AT+
Sbjct: 189 KTLLKEDDDDNDDEDDEDDEDRESDPILEDANVALRDTTNRLKVTPFATNNNQEILTATM 248

Query: 135 NGVGKVFLFD--------------RSKDKNEALVSEHAFHKDNGYGLSFNPRTK-GELLS 179
           +  G+V++FD               SK     + +  +     G+GL ++P  K G LL+
Sbjct: 249 SENGEVYIFDIINQVKSFQIPGYQVSKQSKRPIHTIRSHGNVEGFGLDWSPLIKSGALLT 308

Query: 180 CSDDGTIALWNVMGTNTSPSKAVTTHEDI-------VNDCTWHEFNENLFGSVSEDKTLQ 232
               G I L     T+   SK +T  +         + D  W +  + +F +   D  ++
Sbjct: 309 GDCSGEIFL-----TSRHTSKWITEKQSFSVGNNKSIEDIQWSKTEQTVFATAGCDGYIR 363

Query: 233 IHDKRTNSTVHRLTLSSPFNTLDFSKHSQN----LFAAAGTDSLVY-LYDLRN------T 281
           I D R  S  H+  +S+  + +D +  S N       A+G D  V+ ++DLR        
Sbjct: 364 IWDTR--SKKHKPAISTRASNVDVNVISWNEKMEYLLASGDDKGVWGVWDLRQFSPSQEN 421

Query: 282 ADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL-MQIGSEQAQEDAADGV-- 338
           A  +     H+ ++TS+ F+P  +  +  +  D  V LWDL ++   E+ ++   +    
Sbjct: 422 ASPVAQYDFHKGAITSISFNPLDESTVAVASEDNTVTLWDLSVEADDEEIKQQTHETKEL 481

Query: 339 ----PELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWK 378
               P+L+ +H   +  V D  ++  IP  + S   D + +VWK
Sbjct: 482 EQIPPQLLFVH--WQKEVKDVKWHRQIPGCLVSTGTDGL-NVWK 522

>NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.401
           YMR131C
          Length = 512

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 85/406 (20%), Positives = 156/406 (38%), Gaps = 61/406 (15%)

Query: 24  PLMYDFVSETKLTWPSLTIQWLPGNSSSTKQE------MILGTHTSGEDDNYLKIASIEL 77
           P +Y+ +    + WP LT+  +P +  S ++       M   T  S + +N L + S+  
Sbjct: 113 PTVYEMLHNVNVPWPCLTLDIIPDSLGSERRNYPQSLLMTTATQASKKKENELMVLSLSN 172

Query: 78  PEDILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMP----QDPNFIAT 133
               L                + N +                R +  P          AT
Sbjct: 173 LTKTLVNEDKEDDEDEDDEDNEDNDKDPVMENENIPLRDTTNRLKVSPFANSSKEVLTAT 232

Query: 134 INGVGKVFLFDRSKDKNEALVSEHAFHKD--------------NGYGLSFNPRTK-GELL 178
           ++  G+V++FD            +   K                GY L ++P  + G LL
Sbjct: 233 MSENGEVYIFDLGPQSKAFSTPGYKIPKTAKRPIHTIKSHGNVEGYALDWSPSIQTGALL 292

Query: 179 SCSDDGTIALWNVMGTNTSPSKAVTTHEDI-------VNDCTWHEFNENLFGSVSEDKTL 231
           +    G I       T    SK VT  +         + D  W      +F S   D  +
Sbjct: 293 TGDCSGQIYF-----TQRHTSKWVTDKQPFTVSNNKSIEDIQWSRTEGTVFASAGCDGYI 347

Query: 232 QIHDKRTNSTVHRLTLS-----SPFNTLDFSKHSQNLFAAAGTDSLVYLYDLR----NTA 282
           +I D R  S  H+  +S     +  N + +S     L A+   + +  ++DLR    +TA
Sbjct: 348 RIWDTR--SKKHKPAISVKASNTDVNVISWSDKLGYLLASGDDNGVWGVWDLRQFSPDTA 405

Query: 283 DALHTMSG---HEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL-MQIGSEQAQEDAADG- 337
           +++  ++    H+ ++TS+ F+P  + I+  +  D  V LWDL ++   E+ ++ AA+  
Sbjct: 406 NSVQPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQAAETK 465

Query: 338 -----VPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWK 378
                 P+L+ +H   +  V D  ++  IP  + S   D + ++WK
Sbjct: 466 ELQQIPPQLLFVH--WQKEVKDVKWHKQIPGALVSTGTDGL-NIWK 508

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 64/130 (49%), Gaps = 11/130 (8%)

Query: 254 LDFSKHSQNLFAAAGTDSLVYLYDLRNTA--DALHTMSGHEDSVTSLEFSPHKDGILCSS 311
           + +S+    +FA+AG D  + ++D R+     A+   + + D V  + +S  K G L +S
Sbjct: 328 IQWSRTEGTVFASAGCDGYIRIWDTRSKKHKPAISVKASNTD-VNVISWS-DKLGYLLAS 385

Query: 312 GSDRRVL-LWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEE 370
           G D  V  +WDL Q        D A+ V + +  +  HK A+   SFN     ++A   E
Sbjct: 386 GDDNGVWGVWDLRQFSP-----DTANSV-QPVAQYDFHKGAITSISFNPLDESIVAVASE 439

Query: 371 DNIVHVWKVS 380
           DN V +W +S
Sbjct: 440 DNTVTLWDLS 449

>Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 63/244 (25%), Positives = 105/244 (43%), Gaps = 30/244 (12%)

Query: 150 NEALVSEHAFHKDNGY--GLSFNPRTKGELLSCSDDGTIALWNVMGTNTS---PSKAVTT 204
           NE LV        NG+   L+ +      LLS S D T+  W + G +     P ++   
Sbjct: 4   NEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKG 63

Query: 205 HEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTL-SSPFNTLDFSKHSQNL 263
           H  IV DCT          S S DKTL++ D  T  T  R     S   ++D  K + ++
Sbjct: 64  HSHIVQDCTLTADGAYAL-SASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKA-SM 121

Query: 264 FAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDG-----ILCSSGSDRRVL 318
             +   D  + ++ ++     L T+ GH D V+ +   P++        + S+G+D+ V 
Sbjct: 122 IISGSRDKTIKVWTIK--GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVK 179

Query: 319 LWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWK 378
            W+L Q   E      AD +        GH S +N  + + +   L+AS  +D  + +W 
Sbjct: 180 AWNLNQFQIE------ADFI--------GHNSNINTLTASPDGT-LIASAGKDGEIMLWN 224

Query: 379 VSKK 382
           ++ K
Sbjct: 225 LAAK 228

>Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 63/244 (25%), Positives = 105/244 (43%), Gaps = 30/244 (12%)

Query: 150 NEALVSEHAFHKDNGY--GLSFNPRTKGELLSCSDDGTIALWNVMGTNTS---PSKAVTT 204
           NE LV        NG+   L+ +      LLS S D T+  W + G +     P ++   
Sbjct: 4   NEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKG 63

Query: 205 HEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTL-SSPFNTLDFSKHSQNL 263
           H  IV DCT          S S DKTL++ D  T  T  R     S   ++D  K + ++
Sbjct: 64  HSHIVQDCTLTADGAYAL-SASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKA-SM 121

Query: 264 FAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDG-----ILCSSGSDRRVL 318
             +   D  + ++ ++     L T+ GH D V+ +   P++        + S+G+D+ V 
Sbjct: 122 IISGSRDKTIKVWTIK--GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVK 179

Query: 319 LWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWK 378
            W+L Q   E      AD +        GH S +N  + + +   L+AS  +D  + +W 
Sbjct: 180 AWNLNQFQIE------ADFI--------GHNSNINTLTASPDGT-LIASAGKDGEIMLWN 224

Query: 379 VSKK 382
           ++ K
Sbjct: 225 LAAK 228

>Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 63/244 (25%), Positives = 105/244 (43%), Gaps = 30/244 (12%)

Query: 150 NEALVSEHAFHKDNGY--GLSFNPRTKGELLSCSDDGTIALWNVMGTNTS---PSKAVTT 204
           NE LV        NG+   L+ +      LLS S D T+  W + G +     P ++   
Sbjct: 4   NEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKG 63

Query: 205 HEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTL-SSPFNTLDFSKHSQNL 263
           H  IV DCT          S S DKTL++ D  T  T  R     S   ++D  K + ++
Sbjct: 64  HSHIVQDCTLTADGAYAL-SASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKA-SM 121

Query: 264 FAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDG-----ILCSSGSDRRVL 318
             +   D  + ++ ++     L T+ GH D V+ +   P++        + S+G+D+ V 
Sbjct: 122 IISGSRDKTIKVWTIK--GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVK 179

Query: 319 LWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWK 378
            W+L Q   E      AD +        GH S +N  + + +   L+AS  +D  + +W 
Sbjct: 180 AWNLNQFQIE------ADFI--------GHNSNINTLTASPDGT-LIASAGKDGEIMLWN 224

Query: 379 VSKK 382
           ++ K
Sbjct: 225 LAAK 228

>YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,
           319 aa] {ON}  ASC1G-protein beta subunit and guanine
           nucleotide dissociation inhibitor for Gpa2p; ortholog of
           RACK1 that inhibits translation; core component of the
           small (40S) ribosomal subunit; represses Gcn4p in the
           absence of amino acid starvation
          Length = 319

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 63/244 (25%), Positives = 105/244 (43%), Gaps = 30/244 (12%)

Query: 150 NEALVSEHAFHKDNGY--GLSFNPRTKGELLSCSDDGTIALWNVMGTNTS---PSKAVTT 204
           NE LV        NG+   L+ +      LLS S D T+  W + G +     P ++   
Sbjct: 4   NEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKG 63

Query: 205 HEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTL-SSPFNTLDFSKHSQNL 263
           H  IV DCT          S S DKTL++ D  T  T  R     S   ++D  K + ++
Sbjct: 64  HSHIVQDCTLTADGAYAL-SASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKA-SM 121

Query: 264 FAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDG-----ILCSSGSDRRVL 318
             +   D  + ++ ++     L T+ GH D V+ +   P++        + S+G+D+ V 
Sbjct: 122 IISGSRDKTIKVWTIK--GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVK 179

Query: 319 LWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWK 378
            W+L Q   E      AD +        GH S +N  + + +   L+AS  +D  + +W 
Sbjct: 180 AWNLNQFQIE------ADFI--------GHNSNINTLTASPDGT-LIASAGKDGEIMLWN 224

Query: 379 VSKK 382
           ++ K
Sbjct: 225 LAAK 228

>ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa]
           {ON} similar to uniprot|P38968 Saccharomyces cerevisiae
           YDL195W SEC31 involved in protein transport from
           endoplasmic reticulum to Golgi Component (p150) of COPII
           coat of secretory pathway vesicles
          Length = 1282

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 93/215 (43%), Gaps = 26/215 (12%)

Query: 138 GKVFLFDRSKDKNEALVSEHAF--HKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMG-- 193
           G V LF  + D   +L SE  F  HK       FN +    L +    G I +W+V    
Sbjct: 84  GSVELFSYNAD---SLKSEAKFQRHKTTAKVARFNAKQFNVLATGGTKGEIFIWDVNKCL 140

Query: 194 ------TNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTL 247
                 T  +P  ++T  E+I +   W++   ++F S        I D +    V  L+ 
Sbjct: 141 ENPNDYTPLTPGNSMTPVEEITS-LAWNQSLAHVFASAGSTSYASIWDLKAKKEVIHLSY 199

Query: 248 SSPFNTLD--------FSKHSQNLFAAAGTDS--LVYLYDLRNTADALHTMS-GHEDSVT 296
           +SP   L           K+S  +  A G+D+   + ++DLRN    L  +S GH   V 
Sbjct: 200 TSPNTGLKAPLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQVLSQGHSKGVL 259

Query: 297 SLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQ 331
           SL++    + +L SSG D  V+LW+  Q G E  Q
Sbjct: 260 SLDWCNQDENLLLSSGRDNTVVLWN-PQEGQELTQ 293

 Score = 31.2 bits (69), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 51/118 (43%), Gaps = 6/118 (5%)

Query: 182 DDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNST 241
           +D +I +W++   NT        H   V    W   +ENL  S   D T+ + + +    
Sbjct: 231 NDPSILVWDLRNANTPLQVLSQGHSKGVLSLDWCNQDENLLLSSGRDNTVVLWNPQEGQE 290

Query: 242 VHRLTLSS--PFNTLDFSKHSQNLFAAAGTDSLVY---LYDLRNTADALHTMSGHEDS 294
           + +    S   F T  F+  + ++FA+A  D+ V    L +L NT D   T S   +S
Sbjct: 291 LTQFPTRSNWVFKT-KFASQAPDIFASASFDNKVQVQTLQNLVNTLDQEQTASKQRES 347

>Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W
           (REAL)
          Length = 1270

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 86/192 (44%), Gaps = 20/192 (10%)

Query: 150 NEALVSEHAF--HKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVT---- 203
           N+A+ S   F  H  +   + FN +    L S  ++G I +W++     SP+        
Sbjct: 95  NDAISSMAKFSNHSSSVKTVKFNAKQDNVLASGGNNGEIFIWDMNKCTESPANYTPLTPG 154

Query: 204 ---THEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLD----- 255
              +  D VN   W++   ++F S        I D +    V  L  +SP + +      
Sbjct: 155 QSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKAKKEVIHLCYTSPNSGIKQQLSV 214

Query: 256 ---FSKHSQNLFAAAGTDS--LVYLYDLRNTADALHTMS-GHEDSVTSLEFSPHKDGILC 309
                K+S  +  A G+D+   + ++DLRN    L T++ GH+  + SL++    + +L 
Sbjct: 215 VEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQTLNQGHQKGILSLDWCHQDENLLL 274

Query: 310 SSGSDRRVLLWD 321
           SSG D  VLLW+
Sbjct: 275 SSGRDNTVLLWN 286

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 66/144 (45%), Gaps = 9/144 (6%)

Query: 242 VHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTM---SGHEDSVTSL 298
           +  L + S FN LD+S H+  + A A  +  + LY      DA+ +M   S H  SV ++
Sbjct: 56  IASLQVDSKFNDLDWS-HNNKIIAGALDNGSLELYSTNEVNDAISSMAKFSNHSSSVKTV 114

Query: 299 EFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFN 358
           +F+  +D +L S G++  + +WD+      +  E  A+  P            VN  ++N
Sbjct: 115 KFNAKQDNVLASGGNNGEIFIWDM-----NKCTESPANYTPLTPGQSMSSVDEVNSLAWN 169

Query: 359 WNIPWLMASVEEDNIVHVWKVSKK 382
            ++  + AS    N   +W +  K
Sbjct: 170 QSLAHVFASAGSSNFASIWDLKAK 193

>Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON}
           (56367..60125) [3759 nt, 1253 aa]
          Length = 1252

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/208 (27%), Positives = 99/208 (47%), Gaps = 22/208 (10%)

Query: 135 NGVGKVFLFDRSKDKNEAL--VSEHAFHKDNGYGLSFNPRTKGELLSCSD-DGTIALW-- 189
           NG  ++F FD      ++L  +S+   HK +   L FN +    L+S SD +G I +W  
Sbjct: 83  NGNIELFNFDNKSQTIKSLGNLSDSNKHKGSVKTLKFNTKQSNLLVSGSDKNGEILIWDL 142

Query: 190 -NVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLS 248
            N+  T  +P   +T   +I +   W++   ++F   S    + I D +    V  L  +
Sbjct: 143 NNLDKTPLTPGMPMTPTNEITS-LAWNKSLSHVFSCSSNTSNVSIFDLKAKKEVIHLNYT 201

Query: 249 SPFNTLD--FS------KHSQNLFAAA-GTDSL----VYLYDLRNTADALHTMS--GHED 293
           +P N +   FS      K+S  +  A    DS     ++++DLRN+   L  +S  GH +
Sbjct: 202 NPVNNVKSLFSVVEWHPKNSTRIATATLNNDSTESDSIFIWDLRNSHTPLQILSKDGHSN 261

Query: 294 SVTSLEFSPHKDGILCSSGSDRRVLLWD 321
            + SL++    + +L SSG D  V+LW+
Sbjct: 262 GILSLDWCSTDENLLLSSGRDNSVMLWN 289

 Score = 37.4 bits (85), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 57/109 (52%), Gaps = 10/109 (9%)

Query: 222 FGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNT 281
           F S S+ +   I+   T + +  L + S FN LD+S  + N+ A A  +  + L++  N 
Sbjct: 36  FSSDSKLELWSINQLDTKTPLFELNVDSKFNDLDWSVDNINI-AGALDNGNIELFNFDNK 94

Query: 282 ADALHTMSG------HEDSVTSLEFSPHKDGILCSSGSDR--RVLLWDL 322
           +  + ++        H+ SV +L+F+  +  +L  SGSD+   +L+WDL
Sbjct: 95  SQTIKSLGNLSDSNKHKGSVKTLKFNTKQSNLLV-SGSDKNGEILIWDL 142

>Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {ON}
           YDR142C (PEX7) - Member of beta-transducin-related
           (WD-40) protein family [contig 171] FULL
          Length = 367

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 61/276 (22%), Positives = 115/276 (41%), Gaps = 41/276 (14%)

Query: 136 GVGKVFLFDRSKDKNEALVSEHA--FHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMG 193
           G GK+F+ D +   N+ +++E      +D  + +++N   + ++L    DG++ L++   
Sbjct: 36  GNGKLFIVDIN---NQGIMTEAKSFLTQDGLFDVAWNELHENQVLVAQGDGSLRLFDTQL 92

Query: 194 TNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLT------- 246
           T+  P      HE  V  C W+  N+ LF S S D T+++       ++  LT       
Sbjct: 93  TDY-PIAIFHEHEKEVFSCNWNLINKQLFVSSSWDGTVKVWSPTRPKSLATLTPKPMAAQ 151

Query: 247 -------------------LSSPFNTL---DFSKHSQNLFAAAGTDSLVYLYDLRNTADA 284
                              LS   N +    FS H  N+  +   +S V ++DLR    A
Sbjct: 152 NPLMPSKDIPMSNQQNHTSLSKNKNCIYQSQFSPHDPNVIMSCAGNSYVTMFDLRQPPGA 211

Query: 285 -LHTMSGHEDSVT-SLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELM 342
             ++   H    T + +F+ ++  I+ + G D  + +WDL  +    +       V E+ 
Sbjct: 212 NQYSFLAHNGMETLTCDFNKYRSHIVATGGVDNMIKVWDLRMVRKAASNSRQPMSVNEI- 270

Query: 343 MMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWK 378
               GH  A+   S++ +   ++ S   D    VW+
Sbjct: 271 ---CGHDLAIRKVSWSPHHSNMLLSTSYDMTCRVWQ 303

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 64/298 (21%), Positives = 121/298 (40%), Gaps = 48/298 (16%)

Query: 129 NFIATINGVGKVFLFD-RSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIA 187
           N +    G G + LFD +  D   A+  EH   +   +  ++N   K   +S S DGT+ 
Sbjct: 74  NQVLVAQGDGSLRLFDTQLTDYPIAIFHEH---EKEVFSCNWNLINKQLFVSSSWDGTVK 130

Query: 188 LWN-----VMGTNTS----------PSK-----------AVTTHEDIVNDCTWHEFNENL 221
           +W+      + T T           PSK           +++ +++ +    +   + N+
Sbjct: 131 VWSPTRPKSLATLTPKPMAAQNPLMPSKDIPMSNQQNHTSLSKNKNCIYQSQFSPHDPNV 190

Query: 222 FGSVSEDKTLQIHDKRTNSTVHRLTLSSPFN----TLDFSKHSQNLFAAAGTDSLVYLYD 277
             S + +  + + D R     ++ +  +       T DF+K+  ++ A  G D+++ ++D
Sbjct: 191 IMSCAGNSYVTMFDLRQPPGANQYSFLAHNGMETLTCDFNKYRSHIVATGGVDNMIKVWD 250

Query: 278 LRNTADA---------LHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLW-DLMQIGS 327
           LR    A         ++ + GH+ ++  + +SPH   +L S+  D    +W DL   G 
Sbjct: 251 LRMVRKAASNSRQPMSVNEICGHDLAIRKVSWSPHHSNMLLSTSYDMTCRVWQDLSDDGR 310

Query: 328 E-QAQEDAADGVPELMMMHAGHKSAV--NDFSFNWNIPWLMASVEEDNIVHVWKVSKK 382
               + ++ D       +   H   V   D+S  W  P  +AS   D  V VW    K
Sbjct: 311 RPTGKTNSVDPARGCRFVFPHHTEFVFGADWSL-WGKPGYIASTSWDGDVCVWYAFTK 367

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/125 (20%), Positives = 51/125 (40%), Gaps = 14/125 (11%)

Query: 120 RARFMPQDPNFIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNG---YGLSFNPRTKGE 176
           +++F P DPN I +  G   V +FD  +       ++++F   NG       FN      
Sbjct: 180 QSQFSPHDPNVIMSCAGNSYVTMFDLRQPPG---ANQYSFLAHNGMETLTCDFNKYRSHI 236

Query: 177 LLSCSDDGTIALWNVMGTNTSPSKA--------VTTHEDIVNDCTWHEFNENLFGSVSED 228
           + +   D  I +W++     + S +        +  H+  +   +W   + N+  S S D
Sbjct: 237 VATGGVDNMIKVWDLRMVRKAASNSRQPMSVNEICGHDLAIRKVSWSPHHSNMLLSTSYD 296

Query: 229 KTLQI 233
            T ++
Sbjct: 297 MTCRV 301

>KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 essential nuclear protein involved in early
           steps of ribosome biogenesis
          Length = 523

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 61/242 (25%), Positives = 105/242 (43%), Gaps = 37/242 (15%)

Query: 164 GYGLSFNPRTK-GELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDI-------VNDCTWH 215
           GY   ++P  K G +LS    G + L     T    SK +T  +         + D  W 
Sbjct: 288 GYANDWSPIIKTGAMLSGDCSGQVFL-----TQRHTSKWITDKQAFTVANNKSIEDLQWS 342

Query: 216 EFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLS-----SPFNTLDFSKHSQNLFAAAGTD 270
                +F S   D  ++I D R  S  H+  +S     +  N + +S+    L A+   D
Sbjct: 343 RTESTVFASCGIDGYIRIWDTR--SKKHKPAISVKASNTDVNVISWSEKIGYLLASGDDD 400

Query: 271 SLVYLYDLR-------NTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL- 322
               ++DLR       +TA  +     H+ ++TS+ F+P  + I+  +  D  V LWDL 
Sbjct: 401 GTWGVWDLRQFTPQNASTASPVAQYQFHKGAITSISFNPLDESIIAVASEDNTVTLWDLS 460

Query: 323 MQIGSEQAQEDAADG------VPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHV 376
           ++   E+ ++ AA+        P+L+ +H   +  V D  ++  IP  + S   D + +V
Sbjct: 461 VEADDEEIKQQAAETKELQQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NV 517

Query: 377 WK 378
           WK
Sbjct: 518 WK 519

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 62/130 (47%), Gaps = 11/130 (8%)

Query: 254 LDFSKHSQNLFAAAGTDSLVYLYDLRNTA--DALHTMSGHEDSVTSLEFSPHKDGILCSS 311
           L +S+    +FA+ G D  + ++D R+     A+   + + D V  + +S  K G L +S
Sbjct: 339 LQWSRTESTVFASCGIDGYIRIWDTRSKKHKPAISVKASNTD-VNVISWS-EKIGYLLAS 396

Query: 312 GSDRRVL-LWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEE 370
           G D     +WDL Q       ++A+   P  +  +  HK A+   SFN     ++A   E
Sbjct: 397 GDDDGTWGVWDLRQF----TPQNASTASP--VAQYQFHKGAITSISFNPLDESIIAVASE 450

Query: 371 DNIVHVWKVS 380
           DN V +W +S
Sbjct: 451 DNTVTLWDLS 460

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 28/56 (50%)

Query: 136 GVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNV 191
           GV  +  F        + V+++ FHK     +SFNP  +  +   S+D T+ LW++
Sbjct: 404 GVWDLRQFTPQNASTASPVAQYQFHKGAITSISFNPLDESIIAVASEDNTVTLWDL 459

>NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {ON}
           Anc_6.276 YPL247C
          Length = 524

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 75/170 (44%), Gaps = 19/170 (11%)

Query: 169 FNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSED 228
           +NP     L+S S D T  +W++  +N   ++ +  H+  V D  +   +  LF S   D
Sbjct: 256 WNPIDTNLLISSSIDTTCIIWDLESSNYVKTQLIA-HDSEVFDVRFLTQSTQLFASCGGD 314

Query: 229 KTLQIHDKRTNSTVHRLTLSSPFNTLDF---------------SKHSQNLFAAAGTDS-L 272
            ++++ D R  S  H   +  P   +D                S H  N+ A    DS  
Sbjct: 315 GSVRVFDLR--SLAHSTIIYEPPAQMDPSSSAAASNALLRLEPSPHDPNIVATFAADSNK 372

Query: 273 VYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
           + + D+RN    + T+ GH  S+  +++ P +  IL S   D +VL WDL
Sbjct: 373 IIILDMRNPETPVLTLQGHSSSLNQIKWHPTERNILLSCADDCQVLYWDL 422

 Score = 37.0 bits (84), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 78/185 (42%), Gaps = 29/185 (15%)

Query: 214 WHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLD--FSKHSQNLFAAAGTDS 271
           W+  + NL  S S D T  I D  +++ V    ++      D  F   S  LFA+ G D 
Sbjct: 256 WNPIDTNLLISSSIDTTCIIWDLESSNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGGDG 315

Query: 272 LVYLYDLRNTADA--LHTMSGHED---------SVTSLEFSPHKDGILCSSGSD-RRVLL 319
            V ++DLR+ A +  ++      D         ++  LE SPH   I+ +  +D  ++++
Sbjct: 316 SVRVFDLRSLAHSTIIYEPPAQMDPSSSAAASNALLRLEPSPHDPNIVATFAADSNKIII 375

Query: 320 WDLMQIGSEQAQEDAADGVPEL-MMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWK 378
            D+                PE  ++   GH S++N   ++     ++ S  +D  V  W 
Sbjct: 376 LDMRN--------------PETPVLTLQGHSSSLNQIKWHPTERNILLSCADDCQVLYWD 421

Query: 379 VSKKL 383
           ++  L
Sbjct: 422 LNSSL 426

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 33/73 (45%), Gaps = 3/73 (4%)

Query: 120 RARFMPQDPNFIATING-VGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELL 178
           R    P DPN +AT      K+ + D    +   L  +   H  +   + ++P  +  LL
Sbjct: 352 RLEPSPHDPNIVATFAADSNKIIILDMRNPETPVLTLQG--HSSSLNQIKWHPTERNILL 409

Query: 179 SCSDDGTIALWNV 191
           SC+DD  +  W++
Sbjct: 410 SCADDCQVLYWDL 422

>Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011W
           (SOF1) - 56 kDa nucleolar snRNP protein that shows
           homology to beta subunits of G-proteins and the splicing
           factor Prp4 [contig 94] FULL
          Length = 473

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 65/137 (47%), Gaps = 3/137 (2%)

Query: 186 IALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRL 245
           I LW+   T + P   ++   D V+   +++   ++F S   D ++ ++D RTNS   + 
Sbjct: 196 INLWD--STRSRPITNLSWGADNVSTVKFNQNETDIFASAGSDNSVVLYDLRTNSPTQKF 253

Query: 246 TLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKD 305
                 N L ++      F  A  D   Y YD+RN + ALH    H  +V  ++FSP  D
Sbjct: 254 VQKMRTNALCWNPMEAYNFVVANEDHNAYYYDMRNLSRALHVFKDHVSAVMDVDFSPTGD 313

Query: 306 GILCSSGSDRRVLLWDL 322
            I+  S  D+ + ++ +
Sbjct: 314 EIVTGS-YDKTIRIYQV 329

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 76/184 (41%), Gaps = 26/184 (14%)

Query: 160 HKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEF-- 217
           H+D  Y ++ N     +L + S DG +  WN M T          +  I   C   +   
Sbjct: 66  HRDGVYTIAKNYHVLNKLATASADGVVKYWN-MSTREEVCSFKAHYGLIHGLCVTPQHLS 124

Query: 218 ---NENLFGSVSEDKTLQIHD----------------KRTNSTVHRLTLSSPFNTLDFSK 258
              NEN   S  +D+T+++                  K  N  +        F  +D  +
Sbjct: 125 QNKNENYMLSCGDDRTVKLWSVNTDDFSSERGDEEVIKSGNGLIKTFHGEHAFLGIDHHR 184

Query: 259 HSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVL 318
            + N F   G +  + L+D    +  +  +S   D+V++++F+ ++  I  S+GSD  V+
Sbjct: 185 SNSN-FVTGGAE--INLWD-STRSRPITNLSWGADNVSTVKFNQNETDIFASAGSDNSVV 240

Query: 319 LWDL 322
           L+DL
Sbjct: 241 LYDL 244

>AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL011W
           (SOF1)
          Length = 479

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 78/172 (45%), Gaps = 11/172 (6%)

Query: 151 EALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVN 210
           +    EHAF   + +  + N  T G          I LW+V      P   ++   D V+
Sbjct: 171 KTFYGEHAFQSIDHHRRNPNFVTGG--------AQIQLWDV--NRKKPLSNLSWGVDNVS 220

Query: 211 DCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTD 270
              +++  E++  S   D ++ ++D RTNS   ++      N L ++      FA A  D
Sbjct: 221 FVRFNQNEEDILASTGSDNSIVLYDLRTNSPTQKVVQRMRTNALCWNPMEPFNFAIANED 280

Query: 271 SLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
              Y YD+RN + ALH    H  +V  ++FSP  + I+  S  D+ + +++L
Sbjct: 281 HNAYYYDMRNMSRALHVFKDHVSAVMDVDFSPTGEEIVTGS-YDKTIRIFNL 331

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 53/218 (24%), Positives = 94/218 (43%), Gaps = 44/218 (20%)

Query: 143 FDRSKDKNEALVS---EHAF-----------HKDNGYGLSFNPRTKGELLSCSDDGTIAL 188
           F+R+++  +AL +   E  F           H+D  Y L+ N     +L S S DG +  
Sbjct: 35  FERAREYTKALTATKLERMFAKPFVGQLGYGHRDGCYVLAKNYNVLNKLASGSADGVVKY 94

Query: 189 WN---------------------VMGTNTSPSKAVTTHEDIVNDCT---WHEFNENLFGS 224
           WN                     V  T+ SP+K  +      +D T   W   N + F S
Sbjct: 95  WNMATREELCSFRAHYGLVTGLCVTPTHLSPTKKDSFMLSCGDDKTIKLW-SVNSDDFNS 153

Query: 225 VSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADA 284
           + +D  + + D    + +        F ++D  + + N F   G  + + L+D+ N    
Sbjct: 154 IKDDTKI-VSDTGDGALLKTFYGEHAFQSIDHHRRNPN-FVTGG--AQIQLWDV-NRKKP 208

Query: 285 LHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
           L  +S   D+V+ + F+ +++ IL S+GSD  ++L+DL
Sbjct: 209 LSNLSWGVDNVSFVRFNQNEEDILASTGSDNSIVLYDL 246

>KAFR0B05700 Chr2 complement(1176020..1177138) [1119 bp, 372 aa]
           {ON} Anc_8.316 YDR142C
          Length = 372

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 61/277 (22%), Positives = 113/277 (40%), Gaps = 38/277 (13%)

Query: 136 GVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTN 195
           G GKV+L +    K +   +     +D  + +++N   + ++L    DG++ L++     
Sbjct: 36  GNGKVYLLE-IDSKGQIHETNSFLTQDCLFDVAWNELHENQVLVAQGDGSLRLFDTT-LK 93

Query: 196 TSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTV-----HRLTLSSP 250
             P +    HE  V  C+W+   +N F S S D T++I      +++     H L +   
Sbjct: 94  DYPIEIFNEHEREVFSCSWNLITKNTFTSSSWDGTVKIWSPLRKASLLTLVPHPLKVMKN 153

Query: 251 FNTLD-----------------------FSKHSQNLFAAAGTDSLVYLYDLR-----NTA 282
           F+ +D                       FS H  NL      +S   L+DLR     N  
Sbjct: 154 FDQVDIPISNQKAHTAISKNKNCIYQAQFSPHDPNLVICCAGNSYTTLFDLRQPSTSNNQ 213

Query: 283 DALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSE-QAQEDAADGVPEL 341
               + SG E    + +F+ ++  I+ + G D  + +WDL  +  + QA     + +  +
Sbjct: 214 QNFFSHSGLE--ALTCDFNKYRPNIVATGGVDNTIRIWDLRMLSKQFQAGTQRDNSIMCV 271

Query: 342 MMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWK 378
             +  GH+ AV   S++ +    + S   D    VW+
Sbjct: 272 NEIKKGHELAVRKVSWSPHSSTTLLSTSYDMTCCVWQ 308

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 68/305 (22%), Positives = 117/305 (38%), Gaps = 57/305 (18%)

Query: 129 NFIATINGVGKVFLFDRS-KDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIA 187
           N +    G G + LFD + KD    + +EH   +   +  S+N  TK    S S DGT+ 
Sbjct: 74  NQVLVAQGDGSLRLFDTTLKDYPIEIFNEH---EREVFSCSWNLITKNTFTSSSWDGTVK 130

Query: 188 LWNVMG-------------------------TNTSPSKAVTTHEDIVNDCTWHEFNENLF 222
           +W+ +                          +N     A++ +++ +    +   + NL 
Sbjct: 131 IWSPLRKASLLTLVPHPLKVMKNFDQVDIPISNQKAHTAISKNKNCIYQAQFSPHDPNLV 190

Query: 223 GSVSEDKTLQIHDKRTNSTVHRLTLSSPFN-------TLDFSKHSQNLFAAAGTDSLVYL 275
              + +    + D R  ST +     + F+       T DF+K+  N+ A  G D+ + +
Sbjct: 191 ICCAGNSYTTLFDLRQPSTSNNQ--QNFFSHSGLEALTCDFNKYRPNIVATGGVDNTIRI 248

Query: 276 YDLRNTADALHTMS--------------GHEDSVTSLEFSPHKDGILCSSGSDRRVLLW- 320
           +DLR  +      +              GHE +V  + +SPH    L S+  D    +W 
Sbjct: 249 WDLRMLSKQFQAGTQRDNSIMCVNEIKKGHELAVRKVSWSPHSSTTLLSTSYDMTCCVWQ 308

Query: 321 DLMQIG-SEQAQEDAADGVPELMMMHAGHKSAV--NDFSFNWNIPWLMASVEEDNIVHVW 377
           DL   G +   + ++ D     +     H   V   D+S  W  P  +AS   D  V VW
Sbjct: 309 DLSSNGKAPTGKTNSTDFRRGCITRFNQHSEFVFGADWSL-WGQPGFIASTAWDGNVFVW 367

Query: 378 KVSKK 382
              +K
Sbjct: 368 NAFRK 372

>SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|Q750X9 Ashbya gossypii AGL190W
           AGL190Wp and similar to YDR142C uniprot|P39108
           Saccharomyces cerevisiae YDR142C PEX7 May serve as
           intraperoxisomal receptor for type 2 peroxisomal
           proteins (such as thiolase) Member of
           beta-transducin-related (WD- 40) protein family
          Length = 368

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 61/298 (20%), Positives = 115/298 (38%), Gaps = 47/298 (15%)

Query: 129 NFIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIAL 188
           N +    G G + LFD +  +    + +   H+   +  ++N   K   +S S DGT+ +
Sbjct: 74  NQVLAAQGDGSLRLFDINLPQYPISIFQE--HQKEVFSCNWNLVNKQTFVSSSWDGTVKI 131

Query: 189 WNVMG---------------------------TNTSPSKAVTTHEDIVNDCTWHEFNENL 221
           W+ M                            +N      ++ ++D +    +   + NL
Sbjct: 132 WSPMRQESLTTLVPIPMERSPLVEAKAGGIPLSNQQNHSIISKNKDCIYQAQFSPHDPNL 191

Query: 222 FGSVSEDKTLQIHDKR--TNSTVHRLTLSSPFNTL--DFSKHSQNLFAAAGTDSLVYLYD 277
               + +  + + D R  TN+            TL  DF+K+  ++ A  G D LV ++D
Sbjct: 192 IMCCAGNSYVTLFDLRQPTNTNQQNFMSHGGLETLTCDFNKYRPHIVATGGVDKLVKIWD 251

Query: 278 LRNTAD---------ALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLM--QIG 326
           LR             +++ + GHE ++  + +SPH   ++ S+  D    +WD +    G
Sbjct: 252 LRMVRKFSNPLQQPMSINEIPGHELAIRKVSWSPHHSNLVLSTSYDMTCRVWDDLSDSNG 311

Query: 327 SEQAQEDAADGVPELMMMHAGHKSAV--NDFSFNWNIPWLMASVEEDNIVHVWKVSKK 382
               + ++ D       +   H   V   D+S  W  P  +AS   D  V +W  S +
Sbjct: 312 RPTGKTNSIDPTKGCRFIFPHHTEFVFGADWSL-WGQPGYVASTAWDGNVCIWHTSAR 368

 Score = 33.5 bits (75), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 51/137 (37%), Gaps = 24/137 (17%)

Query: 120 RARFMPQDPNFIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNG---YGLSFNPRTKGE 176
           +A+F P DPN I    G   V LFD  +  N    ++  F    G       FN      
Sbjct: 181 QAQFSPHDPNLIMCCAGNSYVTLFDLRQPTN---TNQQNFMSHGGLETLTCDFNKYRPHI 237

Query: 177 LLSCSDDGTIALWNV-------------MGTNTSPSKAVTTHEDIVNDCTWHEFNENLFG 223
           + +   D  + +W++             M  N  P      HE  +   +W   + NL  
Sbjct: 238 VATGGVDKLVKIWDLRMVRKFSNPLQQPMSINEIPG-----HELAIRKVSWSPHHSNLVL 292

Query: 224 SVSEDKTLQIHDKRTNS 240
           S S D T ++ D  ++S
Sbjct: 293 STSYDMTCRVWDDLSDS 309

>Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 61/206 (29%), Positives = 95/206 (46%), Gaps = 23/206 (11%)

Query: 152 ALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIAL--WNVMGTNTSPSKAVTTHEDIV 209
           +LV  ++F  +N + L   P  K  LL+   +G I L  WN  G +    KA  T    +
Sbjct: 5   SLVESNSFGSEN-WCLKLQPSYKYGLLTGLSNGEIRLLDWN-SGQSLQKIKASETS---I 59

Query: 210 NDCTW--HEFNENLFGSVSEDKTLQIHDKRTNSTVHRL--TLSSPFNTLDFSKHSQNLFA 265
           ND      +F      S +    +++ D RTN+ V ++    +SPF +LD S+H   L A
Sbjct: 60  NDLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLD-SRH--GLLA 116

Query: 266 AA----GTDSLVYLYDLRNTADALHTM-SGHEDSVTSLEFSPHKDGILCSSGSDRRVLLW 320
                 G D+ VY+YD+R     L ++   H D VT ++F P    +L S  +D    ++
Sbjct: 117 CGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIY 176

Query: 321 DLMQIGSEQAQEDAADGVPELMMMHA 346
           DL Q      +EDA   V     +H+
Sbjct: 177 DLKQ----DEEEDALHQVINYASIHS 198

>Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 91/191 (47%), Gaps = 21/191 (10%)

Query: 152 ALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIAL--WNVMGTNTSPSKAVTTHEDIV 209
           +LV  ++F  +N + L   P  K  LL+   +G I L  WN       P + +   E  +
Sbjct: 5   SLVDLNSFGSEN-WCLKLQPAYKHGLLTGLSNGEICLLDWNT----GKPLQKIRASETAI 59

Query: 210 NDCTWHEFN---ENLFGSVSEDKTLQIHDKRTNSTVHRLT--LSSPFNTLDFSKHSQNLF 264
           ND    + +    NL  S S D ++++ D R+N  V ++    +SPF +LD S+H   L 
Sbjct: 60  NDMKIIDSDFVAGNLISSASID-SVKVFDIRSNDCVAKINNETNSPFLSLD-SRHG--LL 115

Query: 265 AAA----GTDSLVYLYDLRNTADALHTM-SGHEDSVTSLEFSPHKDGILCSSGSDRRVLL 319
           A      G D+ +++YD+R     L ++   H D VT ++F P    +L S  +D    +
Sbjct: 116 ACGTELQGIDAAIHIYDVRKWDAPLRSLVDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNI 175

Query: 320 WDLMQIGSEQA 330
           +DL Q   E A
Sbjct: 176 YDLKQDDEEDA 186

>YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON}
           Putative protein of unknown function with similarity to
           proteins containing WD-40 domains; green fluorescent
           protein (GFP)-fusion protein localizes to the nucleus;
           YNL035C is not an essential gene
          Length = 389

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 59/204 (28%), Positives = 94/204 (46%), Gaps = 19/204 (9%)

Query: 152 ALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVND 211
           +LV  ++F  +N + L   P  K  LL+   +G I L +   T  S  K +   E  +ND
Sbjct: 5   SLVESNSFGSEN-WCLKLQPSYKHGLLTGLSNGEIRLLD-WSTGKSVQK-IKASETAIND 61

Query: 212 --CTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLT--LSSPFNTLDFSKHSQNLFAAA 267
                 +F+     S +    +++ D RTN  + ++    +SPF +LD S+H   L A  
Sbjct: 62  MKVIGSDFSAGHLVSSASIDAVKVFDIRTNDRIAQIQNEANSPFISLD-SRHG--LLACG 118

Query: 268 ----GTDSLVYLYDLRNTADALHTM-SGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
               G D+ VY+YD+R     L ++   H D VT ++F P    IL S  +D    ++DL
Sbjct: 119 TELQGIDAAVYIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDL 178

Query: 323 MQIGSEQAQEDAADGVPELMMMHA 346
            Q      +EDA   V     +H+
Sbjct: 179 KQ----DEEEDALHQVINYASIHS 198

>KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.283
           YNL035C
          Length = 367

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 55/207 (26%), Positives = 101/207 (48%), Gaps = 25/207 (12%)

Query: 152 ALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIAL--WNVMGTNTS---PSKAVTTHE 206
           +LV E +F  DN + L F P     LL+   +G + L  W  +    +      ++ + +
Sbjct: 4   SLVQEQSFGSDN-WCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSMK 62

Query: 207 DIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLT--LSSPFNTLDFSKHSQNLF 264
            I ND      N +LF + + + +++I+D ++N  +  +T    SPF +LD S+H  ++ 
Sbjct: 63  LINNDYN----NASLFATATLN-SVKIYDIKSNDCIATITNDKKSPFLSLD-SRH--DML 114

Query: 265 AAA----GTDSLVYLYDLRNTADALHT-MSGHEDSVTSLEFSPHKDGILCSSGSDRRVLL 319
           A      G D+ +Y+YD+RN +  + + +  H D +T ++F P     L S  +D    +
Sbjct: 115 ACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNV 174

Query: 320 WDLMQIGSEQAQEDAADGVPELMMMHA 346
           +DL Q    Q ++DA   V     +H+
Sbjct: 175 YDLTQ----QEEDDALYQVINYASIHS 197

>KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 426

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 55/194 (28%), Positives = 94/194 (48%), Gaps = 20/194 (10%)

Query: 163 NGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTW---HEFNE 219
           N + L   P     LL+   +G + L +   T+ S  + + TH   VND         N 
Sbjct: 33  NNWCLKLQPIYNSGLLTSLSNGRVELID-WATHKSILQ-IQTHATSVNDMVIINNDRMNG 90

Query: 220 NLFGSVSEDKTLQIHDKRTNSTVHRLT--LSSPFNTLDFSKHSQNLFAA----AGTDSLV 273
           +L  + +ED  ++I+D ++N  V  L    S+PF +LD S+H   L       +G D+ +
Sbjct: 91  SLIATAAED-AVKIYDLKSNDCVATLKNGKSAPFLSLD-SRH--GLLGCGTELSGVDAEL 146

Query: 274 YLYDLRNTADALHTM-SGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQE 332
           ++YD+R+    L ++   H D +TS++F P    +L S  +D  V ++DL Q    Q ++
Sbjct: 147 HVYDIRSWQQPLRSLVDSHHDDITSIKFHPSDPNVLLSGSTDGYVNIYDLTQ----QEED 202

Query: 333 DAADGVPELMMMHA 346
           DA   V     +H+
Sbjct: 203 DALHQVINFASIHS 216

>SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]
           {ON} highly similar to uniprot|Q75AV4 Ashbya gossypii
           ADL184W PSF2 Polyadenylation factor subunit 2 and
           similar to YNL317W uniprot|P42841 Saccharomyces
           cerevisiae YNL317W PFS2 Integral subunit of the pre-mRNA
           cleavage and polyadenylation factor (CPF) complex plays
           an essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 459

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 48/213 (22%), Positives = 84/213 (39%), Gaps = 17/213 (7%)

Query: 173 TKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQ 232
           T  + ++CSDD  + +WN   +N    + ++ H   V  C WH     L  S S+D  ++
Sbjct: 176 TDSKFVTCSDDNILKIWNF--SNGQQERVLSGHHWDVKSCDWHP-TMGLIVSGSKDNLIK 232

Query: 233 IHDKRTNSTVHR-LTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGH 291
           + D R+   +   L          F     NL A    D    ++D+R     L +    
Sbjct: 233 LWDPRSGQCISTILGFKHTIIKTKFQPTKGNLLAVVAKDKSCKIFDIRQNMKELKSFRDE 292

Query: 292 EDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQ-IGSEQAQEDAADGVPELMMMHAGHKS 350
            D + SL + P  + I      D  +  +DL+Q  GS  +  D          +   H  
Sbjct: 293 SDYM-SLTWHPINESIFTVGCYDGSLKHFDLLQDTGSSNSFHD----------IPYAHDK 341

Query: 351 AVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKL 383
            +   S+N  +  ++AS  +D  +  W  S+ +
Sbjct: 342 CITSLSYN-PVGHILASASKDRTIRFWTRSRPM 373

>Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 68/290 (23%), Positives = 120/290 (41%), Gaps = 51/290 (17%)

Query: 130 FIATINGVGKVFLFDR--------------SKDKNEALVSEHAFHKDNGYGLSFNPRTK- 174
             AT++  G V+++D               SK     + +  +     GYGL ++P  K 
Sbjct: 226 LTATMSENGDVYIYDLAPQSKAFSTPGYQISKSAKRPIHTVKSHGNVEGYGLDWSPLIKT 285

Query: 175 GELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDI-------VNDCTWHEFNENLFGSVSE 227
           G LLS    G I       T    S+ VT  +         + D  W      +F +   
Sbjct: 286 GALLSGDCSGQIYF-----TQRHTSRWVTDKQPFTVSNNKSIEDIQWSRTESTVFATAGC 340

Query: 228 DKTLQIHDKRTNSTVHRLTLS-----SPFNTLDFSKHSQNLFAAAGTDSLVYLYDLR--- 279
           D  ++I D R  S  H+  +S     +  N + +S     L A+   +    ++DLR   
Sbjct: 341 DGYIRIWDTR--SKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFT 398

Query: 280 -NTADALHTMSG---HEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL-MQIGSEQAQEDA 334
            + AD +  ++    H+ ++TS+ F+P  + I+     D  V LWDL ++   E+ ++  
Sbjct: 399 PSNADTVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQT 458

Query: 335 ADG------VPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWK 378
           A+        P+L+ +H   +  V D  ++  IP  + S   D + +VWK
Sbjct: 459 AETKELQEIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NVWK 505

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 61/130 (46%), Gaps = 11/130 (8%)

Query: 254 LDFSKHSQNLFAAAGTDSLVYLYDLRNTA--DALHTMSGHEDSVTSLEFSPHKDGILCSS 311
           + +S+    +FA AG D  + ++D R+     A+   + + D V  + +S  K G L +S
Sbjct: 325 IQWSRTESTVFATAGCDGYIRIWDTRSKKHKPAISVKASNTD-VNVISWS-DKIGYLLAS 382

Query: 312 GSDRRVL-LWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEE 370
           G D     +WDL Q     A     D V + +  +  HK A+   +FN     ++A   E
Sbjct: 383 GDDNGTWGVWDLRQFTPSNA-----DTV-QPVAQYDFHKGAITSIAFNPLDESIVAVGSE 436

Query: 371 DNIVHVWKVS 380
           DN V +W +S
Sbjct: 437 DNTVTLWDLS 446

>CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011w SOF1
          Length = 477

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 63/126 (50%), Gaps = 2/126 (1%)

Query: 186 IALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRL 245
           I LW++    + P   ++   D +N   +++ + N+ GS   D ++ ++D RTNS   ++
Sbjct: 198 INLWDI--NRSKPLSDLSWGADNINTVKFNQNDANVLGSAGSDNSIVLYDLRTNSATQKI 255

Query: 246 TLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKD 305
             +   N++ ++      F  A  D   Y YD+RN + AL+    H  +V  ++ SP  +
Sbjct: 256 VQTMRVNSMCWNPMEAFNFVVASEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDISPTGE 315

Query: 306 GILCSS 311
            ++ +S
Sbjct: 316 EVVTAS 321

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 50/217 (23%), Positives = 92/217 (42%), Gaps = 42/217 (19%)

Query: 143 FDRSKDKNEALVS---EHAF-----------HKDNGYGLSFNPRTKGELLSCSDDGTIAL 188
           F+R+++  +AL +   E  F           H+D  Y L+ +     ++ S S DG I  
Sbjct: 35  FERAREYTKALTATKLERMFAKPFVGQMGHGHQDGVYVLAKHYNDLNKIASGSGDGVIKY 94

Query: 189 WNVMGTNTSPSKAVTTHEDIVNDCTWHEF--------NENLFGSVSEDKTLQI----HD- 235
           W+ M +    +     +  I   C   +         N+N   S S+DKT+++    H+ 
Sbjct: 95  WD-MSSREQIASFKAHYGTITGLCITPKVNIDSASSGNQNFVLSSSDDKTVKLWSVNHED 153

Query: 236 ----------KRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADAL 285
                        N  +        F  LD S+ + N F   G    + L+D+ N +  L
Sbjct: 154 FAHVDNDQVINTDNGLIKHYYGEHAFQGLDHSRMTSN-FVTGG--PRINLWDI-NRSKPL 209

Query: 286 HTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
             +S   D++ +++F+ +   +L S+GSD  ++L+DL
Sbjct: 210 SDLSWGADNINTVKFNQNDANVLGSAGSDNSIVLYDL 246

>AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,
           334 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YMR116C (ASC1); 1-intron
          Length = 334

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 88/190 (46%), Gaps = 16/190 (8%)

Query: 150 NEALVSEHAFHKDNGY--GLSFNPRTKGELLSCSDDGTIALWNVMGTNTS---PSKAVTT 204
           +E LV        NG+   LS +P     LLS S D T+  W + G +     P ++   
Sbjct: 20  DEILVLRGTLEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKG 79

Query: 205 HEDIVNDCTW-HEFNENLFGSVSEDKTLQIHDKRTNSTVHRLT-LSSPFNTLDFSKHSQN 262
           H  IV DCT  H+    L  S S DKTL++ D ++   + R     S   ++     +  
Sbjct: 80  HSHIVQDCTVTHDGKYAL--SASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQ 137

Query: 263 LFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHK---DGI-LCSSGSDRRVL 318
           + +A+  D  V +++     D + T+ GH D V+++  +P +   D + + S+G D+ V 
Sbjct: 138 IVSAS-RDKTVKVWN--TVGDCVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDKVVK 194

Query: 319 LWDLMQIGSE 328
           +WDL     E
Sbjct: 195 VWDLQSFTIE 204

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 30/68 (44%), Gaps = 9/68 (13%)

Query: 287 TMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHA 346
           T+ GH   VTSL  SP +  +L S   D+ ++ W L         ED   GVP  +    
Sbjct: 28  TLEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKL-------TGEDQQYGVP--VRSFK 78

Query: 347 GHKSAVND 354
           GH   V D
Sbjct: 79  GHSHIVQD 86

>Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 106/242 (43%), Gaps = 37/242 (15%)

Query: 164 GYGLSFNPRTK-GELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDI-------VNDCTWH 215
           GYGL ++P  K G LLS    G +       T    S+ VT  +         + D  W 
Sbjct: 274 GYGLDWSPLIKTGSLLSGDCSGQVYF-----TQRHTSRWVTDKQPFTVSNNKSIEDIQWS 328

Query: 216 EFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLS-----SPFNTLDFSKHSQNLFAAAGTD 270
                +F +   D  ++I D R  S  H+  +S     +  N + +S     L A+   +
Sbjct: 329 RSESTVFATAGCDGYIRIWDTR--SKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDN 386

Query: 271 SLVYLYDLR----NTADALHTMSG---HEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL- 322
               ++DLR    + AD++  ++    H+ ++TS+ F+P  + I+     D  V LWDL 
Sbjct: 387 GTWGVWDLRQFTPSNADSVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLS 446

Query: 323 MQIGSEQAQEDAADG------VPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHV 376
           ++   E+ ++  A+        P+L+ +H   +  V D  ++  IP  + S   D + +V
Sbjct: 447 VEADDEEIKQQTAETKELQEIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NV 503

Query: 377 WK 378
           WK
Sbjct: 504 WK 505

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 61/130 (46%), Gaps = 11/130 (8%)

Query: 254 LDFSKHSQNLFAAAGTDSLVYLYDLRNTA--DALHTMSGHEDSVTSLEFSPHKDGILCSS 311
           + +S+    +FA AG D  + ++D R+     A+   + + D V  + +S  K G L +S
Sbjct: 325 IQWSRSESTVFATAGCDGYIRIWDTRSKKHKPAISVKASNTD-VNVISWS-DKIGYLLAS 382

Query: 312 GSDRRVL-LWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEE 370
           G D     +WDL Q     A     D V + +  +  HK A+   +FN     ++A   E
Sbjct: 383 GDDNGTWGVWDLRQFTPSNA-----DSV-QPVAQYDFHKGAITSIAFNPLDESIVAVGSE 436

Query: 371 DNIVHVWKVS 380
           DN V +W +S
Sbjct: 437 DNTVTLWDLS 446

 Score = 30.4 bits (67), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 29/56 (51%)

Query: 136 GVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNV 191
           GV  +  F  S   +   V+++ FHK     ++FNP  +  +   S+D T+ LW++
Sbjct: 390 GVWDLRQFTPSNADSVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDL 445

>KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} similar
           to uniprot|P39108 Saccharomyces cerevisiae YDR142C PEX7
           May serve as intraperoxisomal receptor for type 2
           peroxisomal proteins (such as thiolase) Member of
           beta-transducin-related (WD-40) protein family
          Length = 372

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 70/293 (23%), Positives = 117/293 (39%), Gaps = 56/293 (19%)

Query: 136 GVGKVFLFD-RSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVM-- 192
           G G + LFD + KD   A+  EH   +   +  ++N   K   +S S DG + LW++M  
Sbjct: 81  GDGSLRLFDIKLKDYPIAIYKEH---QREVFSCNWNMIQKQMFVSSSWDGKVKLWSLMRP 137

Query: 193 ---------GTNTSPSKAVTT----------------HEDIVNDC----TWHEFNENLFG 223
                     TN + + + T+                H D   +C    T+   + NL  
Sbjct: 138 QSLMTMSPNDTNAASTLSRTSAVAPVRVPMSNQKEHQHADGNKECIYQATFSPHDPNLVL 197

Query: 224 SVSEDKTLQIHDKRTNST---VHRLTLSSPFN--TLDFSKHSQNLFAAAGTDSLVYLYDL 278
             S +  + ++D R  +     H+      F   T DF+K+  ++ A  G D ++ ++DL
Sbjct: 198 CSSGNSFISLYDLRVPNNGLPQHQFLGHGGFEALTCDFNKYRPHIIATGGVDKMIKVWDL 257

Query: 279 RNTADAL---------HTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLW-----DLMQ 324
           R     L         + + GHE +V  + +SPH   +L S+  D    +W     D   
Sbjct: 258 RMCRKMLSQGHQPININEIQGHELAVRKVTWSPHHSNMLLSTSYDMTCRVWTDLSDDGHG 317

Query: 325 IGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVW 377
           +  +    D A G   + M H+       D+S  W  P  +AS   D  V +W
Sbjct: 318 LTGKTNSIDPAHGCRFIFMEHSEFVFGA-DWSL-WGTPGFVASTGWDGQVCIW 368

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 66/166 (39%), Gaps = 24/166 (14%)

Query: 120 RARFMPQDPNFIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGY---GLSFNPRTKGE 176
           +A F P DPN +   +G   + L+D     N   + +H F    G+      FN      
Sbjct: 185 QATFSPHDPNLVLCSSGNSFISLYDLRVPNNG--LPQHQFLGHGGFEALTCDFNKYRPHI 242

Query: 177 LLSCSDDGTIALWNVMGTNTSPSKA--------VTTHEDIVNDCTWHEFNENLFGSVSED 228
           + +   D  I +W++       S+         +  HE  V   TW   + N+  S S D
Sbjct: 243 IATGGVDKMIKVWDLRMCRKMLSQGHQPININEIQGHELAVRKVTWSPHHSNMLLSTSYD 302

Query: 229 KTLQIHDKRTNSTVHRLTLSSPFNTLD--------FSKHSQNLFAA 266
            T ++    ++   H LT  +  N++D        F +HS+ +F A
Sbjct: 303 MTCRVWTDLSDDG-HGLTGKT--NSIDPAHGCRFIFMEHSEFVFGA 345

>Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar to
           Ashbya gossypii ADR242C
          Length = 522

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 62/242 (25%), Positives = 108/242 (44%), Gaps = 37/242 (15%)

Query: 164 GYGLSFNPRTK-GELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDI-------VNDCTWH 215
           GYGL ++P  K G +L+    G + L     T  + S+ VT  +         + D  W 
Sbjct: 287 GYGLDWSPLIKTGSILTGDCSGRVYL-----TQRTASRWVTDKQPFTVGNNKSIEDIQWS 341

Query: 216 EFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQN----LFAAAGTDS 271
                +F +   D  ++I D R  S  H+  LS   +  D +  S N       A+G DS
Sbjct: 342 RAEMTVFATCGVDGHIRIWDTR--SKKHKPALSVMVSDTDVNVMSWNEKIGYLLASGDDS 399

Query: 272 LVY-LYDLR-----NTADA--LHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL- 322
             + ++DLR     NT     +   + H+ ++TS+ F+P  + I+  +  D  V LWDL 
Sbjct: 400 GTWGVWDLRQFSAQNTEKTTPVAQYNFHKAAITSISFNPLDESIIAVASEDNTVTLWDLS 459

Query: 323 MQIGSEQAQEDAADGV------PELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHV 376
           ++   E+ ++  A+        P+L+ +H   +  V D  ++  IP  + S   D + ++
Sbjct: 460 VEADDEEIKQQTAETAELQQIPPQLLFVH--WQRDVKDVKWHRQIPGCLVSTGTDGL-NI 516

Query: 377 WK 378
           WK
Sbjct: 517 WK 518

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 60/130 (46%), Gaps = 11/130 (8%)

Query: 254 LDFSKHSQNLFAAAGTDSLVYLYDLRNTA--DALHTMSGHEDSVTSLEFSPHKDGILCSS 311
           + +S+    +FA  G D  + ++D R+     AL  M    D V  + ++  K G L +S
Sbjct: 338 IQWSRAEMTVFATCGVDGHIRIWDTRSKKHKPALSVMVSDTD-VNVMSWN-EKIGYLLAS 395

Query: 312 GSDRRVL-LWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEE 370
           G D     +WDL Q  ++  ++         +  +  HK+A+   SFN     ++A   E
Sbjct: 396 GDDSGTWGVWDLRQFSAQNTEKTTP------VAQYNFHKAAITSISFNPLDESIIAVASE 449

Query: 371 DNIVHVWKVS 380
           DN V +W +S
Sbjct: 450 DNTVTLWDLS 459

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 28/56 (50%)

Query: 136 GVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNV 191
           GV  +  F     +    V+++ FHK     +SFNP  +  +   S+D T+ LW++
Sbjct: 403 GVWDLRQFSAQNTEKTTPVAQYNFHKAAITSISFNPLDESIIAVASEDNTVTLWDL 458

>KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {ON}
           highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131C RRB1 RiboSome Assembly 2
          Length = 522

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 89/403 (22%), Positives = 159/403 (39%), Gaps = 58/403 (14%)

Query: 24  PLMYDFVSETKLTWPSLTIQWLPGNSSSTK----QEMILGTHT--SGEDDNYLKIASIEL 77
           P +Y+ +    L WP L++  +P    S +    Q ++L T T  S + DN L +  +  
Sbjct: 126 PTVYEMLHNVNLPWPCLSLDIVPDKLGSERRNYPQSLLLTTATQASKKKDNELLLLKMSQ 185

Query: 78  PEDILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMPQDP-NFIATING 136
               L               + ++                   + F  + P    AT++ 
Sbjct: 186 LAKTLVKDDNNEEEDDDDEDEDQDPIVENENIPLKDTTNRLKVSPFASESPEKLTATMSE 245

Query: 137 VGKVFLFDRSKDKNEALVSEHAFHKD--------------NGYGLSFNPRTK-GELLSCS 181
            G+V++FD         +  +   K                GY L ++P  K G LL+  
Sbjct: 246 NGEVYIFDLGPQVKAFEIPGYQLPKTAKKPIHTVRSHGNVEGYALDWSPLNKSGSLLTGD 305

Query: 182 DDGTIALWNVMGTNTSPSKAVTT-------HEDIVNDCTWHEFNENLFGSVSEDKTLQIH 234
             G + L     T    SK +T        +   + D  +      +F S   D  ++I 
Sbjct: 306 CSGRVYL-----TQRHTSKWITDKTAFSAGNNQSIEDIQFSRTEATVFASCGCDGYIRIW 360

Query: 235 DKRTNSTVHRLTLSSPFNTLDFSKHSQN----LFAAAGTDSLVY-LYDLR----NTADAL 285
           D R  S  H+  +S   +  D +  S N       A+G D+  + ++DLR    NTA + 
Sbjct: 361 DTR--SKKHKPAISVKASATDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFSPNTAAST 418

Query: 286 HTMSG---HEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL-MQIGSEQAQEDAADG---- 337
             ++    H+ ++TS+ F+P  D I+  +  D  V LWDL ++   E+ ++ AA+     
Sbjct: 419 SPVAQYNFHKGAITSISFNPLDDSIIAVASEDNTVSLWDLSVEADDEEIKQQAAETRELQ 478

Query: 338 --VPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWK 378
              P+L+ +H   +  V D  ++  IP  + S   D + ++WK
Sbjct: 479 EIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NIWK 518

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 58/130 (44%), Gaps = 11/130 (8%)

Query: 254 LDFSKHSQNLFAAAGTDSLVYLYDLRNTA--DALHTMSGHEDSVTSLEFSPHKDGILCSS 311
           + FS+    +FA+ G D  + ++D R+     A+   +   D V  + ++  K G L +S
Sbjct: 338 IQFSRTEATVFASCGCDGYIRIWDTRSKKHKPAISVKASATD-VNVISWN-EKIGYLLAS 395

Query: 312 GSDRRVL-LWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEE 370
           G D     +WDL Q     A   +       +  +  HK A+   SFN     ++A   E
Sbjct: 396 GDDNGSWGVWDLRQFSPNTAASTSP------VAQYNFHKGAITSISFNPLDDSIIAVASE 449

Query: 371 DNIVHVWKVS 380
           DN V +W +S
Sbjct: 450 DNTVSLWDLS 459

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 36/165 (21%), Positives = 63/165 (38%), Gaps = 32/165 (19%)

Query: 241 TVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDL---------------RNTADAL 285
           T +RL +S PF     S+  + L A    +  VY++DL               +     +
Sbjct: 222 TTNRLKVS-PF----ASESPEKLTATMSENGEVYIFDLGPQVKAFEIPGYQLPKTAKKPI 276

Query: 286 HTMSGHED-SVTSLEFSP-HKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMM 343
           HT+  H +    +L++SP +K G L +     RV L           Q   +  + +   
Sbjct: 277 HTVRSHGNVEGYALDWSPLNKSGSLLTGDCSGRVYL----------TQRHTSKWITDKTA 326

Query: 344 MHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKLTSPGL 388
             AG+  ++ D  F+     + AS   D  + +W    K   P +
Sbjct: 327 FSAGNNQSIEDIQFSRTEATVFASCGCDGYIRIWDTRSKKHKPAI 371

>Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {ON}
           YMR131C (RRB1) - RiboSome Assembly 2 [contig 204] FULL
          Length = 523

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 86/403 (21%), Positives = 159/403 (39%), Gaps = 58/403 (14%)

Query: 24  PLMYDFVSETKLTWPSLTIQWLPGNSSSTK----QEMILGTHT--SGEDDNYLKIASIEL 77
           P +Y+ +    L WP L++  +P    S +    Q ++L T T  S + DN L +  +  
Sbjct: 127 PTVYEMLHNVNLPWPCLSLDIVPDRLGSERRNYPQSLLLTTATQASKKKDNELLLLKMSQ 186

Query: 78  PEDILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMPQDP-NFIATING 136
               L               + ++                   + F  + P    A+++ 
Sbjct: 187 LTKTLVKEDEDDDEEDDDEDEDQDPIVENENIPLRDTTNRLKVSPFASESPEKLTASMSE 246

Query: 137 VGKVFLFDRS--------------KDKNEALVSEHAFHKDNGYGLSFNPRTK-GELLSCS 181
            G+V++FD                K   + + +  A     GY L ++P  K G LL+  
Sbjct: 247 NGEVYIFDLGPQVKGFETPGYQIPKTAKKPIHTVKAHGNVEGYALDWSPLNKSGSLLTGD 306

Query: 182 DDGTIALWNVMGTNTSPSKAVTT-------HEDIVNDCTWHEFNENLFGSVSEDKTLQIH 234
             G + L     T    SK +T        +   + D  +      +F +   D  ++I 
Sbjct: 307 CSGRVYL-----TQRHTSKWITDKTAFSAGNNQSIEDIQFSRTEATVFATCGCDGYIRIW 361

Query: 235 DKRTNSTVHRLTLSSPFNTLDFSKHSQN----LFAAAGTDSLVY-LYDLRN-------TA 282
           D R  S  H+  +S   ++ D +  S N       A+G D+  + ++DLR        + 
Sbjct: 362 DTR--SKKHKPAISVKASSTDVNVISWNEKIGYLLASGDDNGTWGVWDLRQFSPNNAASV 419

Query: 283 DALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL-MQIGSEQAQEDAADG---- 337
             +   S H+ ++TS+ F+P  D I+  +  D  V LWDL ++   E+ ++ AA+     
Sbjct: 420 SPVAQYSFHKGAITSIAFNPLDDSIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQ 479

Query: 338 --VPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWK 378
              P+L+ +H   +  V D  ++  IP  + S   D + ++WK
Sbjct: 480 QIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NIWK 519

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 61/130 (46%), Gaps = 11/130 (8%)

Query: 254 LDFSKHSQNLFAAAGTDSLVYLYDLRNTA--DALHTMSGHEDSVTSLEFSPHKDGILCSS 311
           + FS+    +FA  G D  + ++D R+     A+   +   D V  + ++  K G L +S
Sbjct: 339 IQFSRTEATVFATCGCDGYIRIWDTRSKKHKPAISVKASSTD-VNVISWN-EKIGYLLAS 396

Query: 312 GSDRRVL-LWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEE 370
           G D     +WDL Q     +  +AA   P  +  ++ HK A+   +FN     ++A   E
Sbjct: 397 GDDNGTWGVWDLRQF----SPNNAASVSP--VAQYSFHKGAITSIAFNPLDDSIIAVASE 450

Query: 371 DNIVHVWKVS 380
           DN V +W +S
Sbjct: 451 DNTVTLWDLS 460

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 35/165 (21%), Positives = 64/165 (38%), Gaps = 32/165 (19%)

Query: 241 TVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDL---------------RNTADAL 285
           T +RL +S PF     S+  + L A+   +  VY++DL               +     +
Sbjct: 223 TTNRLKVS-PF----ASESPEKLTASMSENGEVYIFDLGPQVKGFETPGYQIPKTAKKPI 277

Query: 286 HTMSGHED-SVTSLEFSP-HKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMM 343
           HT+  H +    +L++SP +K G L +     RV L           Q   +  + +   
Sbjct: 278 HTVKAHGNVEGYALDWSPLNKSGSLLTGDCSGRVYL----------TQRHTSKWITDKTA 327

Query: 344 MHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKLTSPGL 388
             AG+  ++ D  F+     + A+   D  + +W    K   P +
Sbjct: 328 FSAGNNQSIEDIQFSRTEATVFATCGCDGYIRIWDTRSKKHKPAI 372

>TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON}
           Anc_6.276 YPL247C Two N bases added to fix a frameshift
           that can't be corrected using the reads.
          Length = 447

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 53/220 (24%), Positives = 93/220 (42%), Gaps = 23/220 (10%)

Query: 169 FNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSED 228
           +NP     L+S S D T  +W++   N   ++ +  H+  V D  +   +  LF S   D
Sbjct: 218 WNPTDPNLLISSSIDTTCIVWDLQSANYIKTQLI-AHDSEVFDVRFLTQSTQLFASCGGD 276

Query: 229 KTLQIHDKRT---NSTVHRLT-------LSSP-----FNTLDFSKHSQNLFAAAGTD-SL 272
            ++++ D R    ++ ++  T       L SP        L+ S    N+ A    D S 
Sbjct: 277 GSVRVFDLRCLAHSTIIYEPTIPDGAPDLPSPTVPPALLRLEPSPFDPNVIATFAIDSSK 336

Query: 273 VYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL-MQIGSEQAQ 331
           V + D+R+    L T+  H   +  +++ P +  +L S+  D +VL WDL   + SE  +
Sbjct: 337 VLILDMRSPGSPLLTLEAHTAPINQIKWHPTRRNVLLSASDDCQVLYWDLNTHLDSESTK 396

Query: 332 EDAADGVPE-----LMMMHAGHKSAVNDFSFNWNIPWLMA 366
           +   D  P+       M +A     VN+  +     W  A
Sbjct: 397 DTTPDSQPDSTVQKPAMFYASGGQEVNNIVWRPQGDWFGA 436

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 59/161 (36%), Gaps = 15/161 (9%)

Query: 121 ARFMPQDPNFIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELL-- 178
            RF+ Q     A+  G G V +FD     +  ++ E     D    L  +P     LL  
Sbjct: 260 VRFLTQSTQLFASCGGDGSVRVFDLRCLAHSTIIYEPTI-PDGAPDLP-SPTVPPALLRL 317

Query: 179 --SCSDDGTIALWNV---------MGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSE 227
             S  D   IA + +         M +  SP   +  H   +N   WH    N+  S S+
Sbjct: 318 EPSPFDPNVIATFAIDSSKVLILDMRSPGSPLLTLEAHTAPINQIKWHPTRRNVLLSASD 377

Query: 228 DKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAG 268
           D  +   D  T+        ++P +  D +     +F A+G
Sbjct: 378 DCQVLYWDLNTHLDSESTKDTTPDSQPDSTVQKPAMFYASG 418

>KLLA0F05159g Chr6 (506007..509702) [3696 bp, 1231 aa] {ON} similar
           to uniprot|P38968 Saccharomyces cerevisiae YDL195W SEC31
           involved in protein transport from endoplasmic reticulum
           to Golgi Component (p150) of COPII coat of secretory
           pathway vesicles
          Length = 1231

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/202 (28%), Positives = 88/202 (43%), Gaps = 23/202 (11%)

Query: 138 GKVFLFDRSKDKNEALVSEHAFHKDNG--YGLSFNPRTKGELLSCSDDGTIALWN---VM 192
           G V  FD      +AL S    HK  G    L FN +    L+S    G I +W+   + 
Sbjct: 84  GVVEFFDP-----KALKSVAKIHKHQGPVKTLKFNAKQNNVLVSGGTQGEIFVWDSNKIG 138

Query: 193 GTNTSPSKAVTTHEDI--VNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSS- 249
            ++ SP  A  ++  I  V+  +W++   ++F S S      + D +    V  L  SS 
Sbjct: 139 SSDYSPFSAGISNTPIDEVSSLSWNQSLAHVFASASSSGYASVWDLKAKKQVLHLNHSSS 198

Query: 250 ------PFNTLDFSKHSQNLFAAAG---TDSLVYLYDLRNTADALHTMS-GHEDSVTSLE 299
                 P   +D+   S  + A A    T+ LV  +DLRN    L  +S GH   V SL+
Sbjct: 199 TTGIKVPLTVVDWHPTSSTIIATASSSDTEPLVLTWDLRNAHVPLKVLSQGHSKGVLSLD 258

Query: 300 FSPHKDGILCSSGSDRRVLLWD 321
           +    + +L SSG D   +LW+
Sbjct: 259 WCKQDENLLLSSGRDNTSVLWN 280

 Score = 38.1 bits (87), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 42/77 (54%), Gaps = 2/77 (2%)

Query: 251 FNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCS 310
           FN LD+S   + + A A  + +V  +D +    ++  +  H+  V +L+F+  ++ +L S
Sbjct: 65  FNDLDWSGDDK-IIAGALENGVVEFFDPK-ALKSVAKIHKHQGPVKTLKFNAKQNNVLVS 122

Query: 311 SGSDRRVLLWDLMQIGS 327
            G+   + +WD  +IGS
Sbjct: 123 GGTQGEIFVWDSNKIGS 139

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 27/142 (19%), Positives = 59/142 (41%), Gaps = 16/142 (11%)

Query: 181 SDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNS 240
           S   T+ LW+++  + S        +   ND  W   ++ + G++ E+  ++  D +   
Sbjct: 37  SSTSTLELWSLLSFDGSKPSGSVVADGKFNDLDWSGDDKIIAGAL-ENGVVEFFDPKALK 95

Query: 241 TVHRL-TLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLE 299
           +V ++     P  TL F+    N+  + GT   ++++D               + + S +
Sbjct: 96  SVAKIHKHQGPVKTLKFNAKQNNVLVSGGTQGEIFVWD--------------SNKIGSSD 141

Query: 300 FSPHKDGILCSSGSDRRVLLWD 321
           +SP   GI  +   +   L W+
Sbjct: 142 YSPFSAGISNTPIDEVSSLSWN 163

>KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa]
           {ON} Anc_7.310 YDL195W
          Length = 1240

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 93/209 (44%), Gaps = 22/209 (10%)

Query: 133 TINGV---GKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALW 189
           TI G    G + LF  S D+  + V++   H  +   L FN + +  L+S S+ G I +W
Sbjct: 76  TIAGALDNGIIELFYLSNDQLTS-VAKLTTHTSSVKTLKFNSKQENVLVSGSNKGEIFVW 134

Query: 190 NVMGTNTS------PSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVH 243
           +      +      P  A+T  E+I +  +W++   ++F S        I D +    V 
Sbjct: 135 DTNKAKQTDYVPMTPGTAMTPLEEITS-LSWNQSLAHVFASAGATVYASIWDLKAKKEVI 193

Query: 244 RLTLSSPFNTLD--------FSKHSQNLFAAAGTDS--LVYLYDLRNTADALHTM-SGHE 292
            L+ +SP   L            +S  +  A G D+   + ++DLRN    L  +  GH 
Sbjct: 194 HLSYTSPATGLKSQLSVVEWHPNNSTRVATATGNDNDPSILVWDLRNANTPLQVLDQGHS 253

Query: 293 DSVTSLEFSPHKDGILCSSGSDRRVLLWD 321
             + SL++    + ++ SSG D  VLLW+
Sbjct: 254 KGIISLDWCHEDESLMLSSGRDNTVLLWN 282

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 30/150 (20%), Positives = 63/150 (42%), Gaps = 8/150 (5%)

Query: 181 SDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSED--KTLQIHDKRT 238
           S D  + LW+++ T+T    A  + +   ND  W   N+ + G++     +   + + + 
Sbjct: 37  SSDSVLELWSLLSTDTVKPVASISTDTKFNDLDWSYDNKTIAGALDNGIIELFYLSNDQL 96

Query: 239 NSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNT--ADALHTMSGHE---- 292
            S     T +S   TL F+   +N+  +      ++++D       D +    G      
Sbjct: 97  TSVAKLTTHTSSVKTLKFNSKQENVLVSGSNKGEIFVWDTNKAKQTDYVPMTPGTAMTPL 156

Query: 293 DSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
           + +TSL ++     +  S+G+     +WDL
Sbjct: 157 EEITSLSWNQSLAHVFASAGATVYASIWDL 186

>Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {ON}
           complement(61507..62967) [1461 nt, 487 aa]
          Length = 486

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 78/172 (45%), Gaps = 19/172 (11%)

Query: 169 FNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSED 228
           +NP     L+S S D T  +W++  +N   ++ +  H+  V D  +   +  LF S   D
Sbjct: 230 WNPIDTNLLISSSIDTTCIVWDLQSSNYVRTQLIA-HDSEVFDVKFLAHSTQLFASCGGD 288

Query: 229 KTLQIHDKRT--NSTVHRLTLS---------------SPFNTLDFSKHSQNLFAAAGTDS 271
            ++++ D R+  +ST+   + S               S    L  S    N+ A    DS
Sbjct: 289 GSVRVFDLRSLAHSTIIYESNSDQNGSDTLTDNEKSPSALLRLQPSPSDPNVMATFALDS 348

Query: 272 L-VYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
             + + D+RN    + T+ GH  +V  +++ P K  +L S G D +VL WDL
Sbjct: 349 KSILILDMRNPGSPVLTLEGHSAAVNQIKWHPKKSNVLLSCGDDCQVLYWDL 400

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 87/204 (42%), Gaps = 9/204 (4%)

Query: 192 MGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPF 251
           +  NT+ S  +      V    W+  + NL  S S D T  + D ++++ V    ++   
Sbjct: 208 LSKNTTSSSDILGQFPPVTSFHWNPIDTNLLISSSIDTTCIVWDLQSSNYVRTQLIAHDS 267

Query: 252 NTLD--FSKHSQNLFAAAGTDSLVYLYDLRNTADAL-----HTMSGHEDSVTSLEFSPHK 304
              D  F  HS  LFA+ G D  V ++DLR+ A +      ++     D++T  E SP  
Sbjct: 268 EVFDVKFLAHSTQLFASCGGDGSVRVFDLRSLAHSTIIYESNSDQNGSDTLTDNEKSPSA 327

Query: 305 DGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWL 364
              L  S SD  V+    +   S    +    G P L +   GH +AVN   ++     +
Sbjct: 328 LLRLQPSPSDPNVMATFALDSKSILILDMRNPGSPVLTL--EGHSAAVNQIKWHPKKSNV 385

Query: 365 MASVEEDNIVHVWKVSKKLTSPGL 388
           + S  +D  V  W +++ L+   L
Sbjct: 386 LLSCGDDCQVLYWDLNEWLSPTSL 409

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 32/73 (43%), Gaps = 3/73 (4%)

Query: 120 RARFMPQDPNFIATINGVGK-VFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELL 178
           R +  P DPN +AT     K + + D     +  L  E   H      + ++P+    LL
Sbjct: 330 RLQPSPSDPNVMATFALDSKSILILDMRNPGSPVLTLEG--HSAAVNQIKWHPKKSNVLL 387

Query: 179 SCSDDGTIALWNV 191
           SC DD  +  W++
Sbjct: 388 SCGDDCQVLYWDL 400

>YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}
           SOF1Essential protein required for biogenesis of 40S
           (small) ribosomal subunit; has similarity to the beta
           subunit of trimeric G-proteins and the splicing factor
           Prp4p
          Length = 489

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 76/189 (40%), Gaps = 54/189 (28%)

Query: 177 LLSCSDDGTIALWNV-----MGTNTSPSKAVTTHEDI----------------------- 208
           +LSCSDD T+ LW++        N+S + +VT  E +                       
Sbjct: 136 MLSCSDDKTVKLWSINVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFA 195

Query: 209 ----------------VNDCTWH-------EFNEN---LFGSVSEDKTLQIHDKRTNSTV 242
                           V+D +W        +FN+N   +  S   D ++ ++D RTNS  
Sbjct: 196 TGGAKIHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLRTNSPT 255

Query: 243 HRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSP 302
            ++  +   N + ++      F  A  D   Y YD+RN + +L+    H  +V  ++FSP
Sbjct: 256 QKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVDFSP 315

Query: 303 HKDGILCSS 311
             D I+  S
Sbjct: 316 TGDEIVTGS 324

>YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and nucleus; similar to the petunia WD repeat protein
           an11; overexpression causes a cell cycle delay or arrest
          Length = 523

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/238 (23%), Positives = 104/238 (43%), Gaps = 34/238 (14%)

Query: 177 LLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDK 236
           ++S S D T  +W++  ++   ++ +  H+  V D  +   +  LF S   D ++++ D 
Sbjct: 259 IISSSIDTTCIVWDLQSSHYVKTQLIA-HDSEVFDVRFLTKSTQLFASCGGDGSVRVFDL 317

Query: 237 RT----------------NSTVHRLTLSSPFN----TLDFSKHSQNLFAAAGTDS-LVYL 275
           R+                 +T   +T SS  +     L+ S +  N+ A    DS  + +
Sbjct: 318 RSLAHSTIIYEPPSSSVSGATAGTITPSSKGSDALLRLEPSPYDPNVLATFAADSNKIII 377

Query: 276 YDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL----MQIGSEQAQ 331
            D+RN    +  + GH  SV  +++ P K  +L S G D +VL WDL    M+I +  ++
Sbjct: 378 LDMRNPESPILNLQGHGSSVNGIKWHPTKRNVLLSCGDDCQVLYWDLNSSFMEINAAGSK 437

Query: 332 EDAADGVP------ELMMMHAGHKSAVND--FSFNWNIPWLMASVEEDNIVHVWKVSK 381
             +  G        +  M   G  S +N+   S N N   +  ++E  N+++  K  +
Sbjct: 438 SPSIHGTSLEDPDGDTEMTDGGAGSGLNEDPLSLNNNSKQVCKTLETPNMMYANKTQE 495

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 44/97 (45%), Gaps = 7/97 (7%)

Query: 120 RARFMPQDPNFIATING-VGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELL 178
           R    P DPN +AT      K+ + D    ++  L  +   H  +  G+ ++P  +  LL
Sbjct: 354 RLEPSPYDPNVLATFAADSNKIIILDMRNPESPILNLQG--HGSSVNGIKWHPTKRNVLL 411

Query: 179 SCSDDGTIALWNV----MGTNTSPSKAVTTHEDIVND 211
           SC DD  +  W++    M  N + SK+ + H   + D
Sbjct: 412 SCGDDCQVLYWDLNSSFMEINAAGSKSPSIHGTSLED 448

>ZYRO0A03234g Chr1 (258942..260183) [1242 bp, 413 aa] {ON} similar
           to uniprot|Q12021 Saccharomyces cerevisiae YDR030C RAD28
           Protein involved in transcription-coupled repair
           nucleotide excision repair of UV-induced DNA lesions
           homolog of human CSA protein
          Length = 413

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 59/269 (21%), Positives = 98/269 (36%), Gaps = 70/269 (26%)

Query: 167 LSFNPRTKGELLSCSDDGTIALWNV-------------------MGTNTSP--------- 198
           L  +P T   LL+C +DG++ +W++                    G+N  P         
Sbjct: 52  LQIDPNTGKFLLACGNDGSLGIWSLDDRCQDDELYCKRIKFSARTGSNDEPIAIPTNKNA 111

Query: 199 ---------------------------SKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTL 231
                                      S++   H   +  C W + +  +F + S D ++
Sbjct: 112 QMVHSFETRKNRFRLYRQSSSPLAPAQSQSRPGHRYGIRSCQWFKLDNGMFFTGSNDLSV 171

Query: 232 QIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSG- 290
           Q+ D  +   VH + +    N +D + H       A  D    L DLRN     H  SG 
Sbjct: 172 QLWDTNSLEAVHSVDVGHRVNQIDTTDH---CIVVATEDGYPRLIDLRNPTGITHLGSGT 228

Query: 291 --HEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGH 348
             HE  + ++  +P K  I+ +  S+  + LWDL +    Q   +     P        H
Sbjct: 229 MPHE--MLTVHCNPQKTHIVATGDSNGSIKLWDLRK--RNQLLMEVYHDTPR----KRAH 280

Query: 349 KSAVNDFSFNWNIPWLMASVEEDNIVHVW 377
            S   D ++N N   L ASV  D  +++W
Sbjct: 281 LSYCQDLAWNSNGSQL-ASVGADGRIYIW 308

>ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 808

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 71/149 (47%), Gaps = 18/149 (12%)

Query: 226 SEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADAL 285
           S+ + L+I D R    V  + +SSP   +D S  +  L A  GTD  + + D+ N     
Sbjct: 79  SQAQLLKIFDLREGKIVRSMKISSPSYVVD-SDSTSTLLAIGGTDGSITVVDVEN-GYVT 136

Query: 286 HTMSGHEDSVTSLEFSPHKDG---ILCSSGSDRRVLLWDLMQ---IGSEQAQEDAADGV- 338
           H++ GH  +++S++F   ++G   +L S  ++  V +WDL++   I + Q    A  G+ 
Sbjct: 137 HSLKGHGGTISSVKFYGEQNGEVWLLASGDTNGMVKIWDLVKRKCIHTVQEHTAAVRGID 196

Query: 339 ---------PELMMMHAGHKSAVNDFSFN 358
                     EL ++  G    +N + FN
Sbjct: 197 FHESKNNDESELFLISGGRDDVINYWQFN 225

>YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}
           SEC31Component of the Sec13p-Sec31p complex of the COPII
           vesicle coat, required for vesicle formation in ER to
           Golgi transport; mutant has increased aneuploidy
           tolerance
          Length = 1273

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 98/205 (47%), Gaps = 23/205 (11%)

Query: 138 GKVFLFDRSKDKNEALVSEHAF--HKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTN 195
           G + L+  + + N A+ S   F  H  +   + FN +    L S  ++G I +W++    
Sbjct: 84  GSLELYS-TNEANNAINSMARFSNHSSSVKTVKFNAKQDNVLASGGNNGEIFIWDMNKCT 142

Query: 196 TSPS--------KAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTL 247
            SPS        +++++ +++++   W++   ++F S        I D +    V  L+ 
Sbjct: 143 ESPSNYTPLTPGQSMSSVDEVIS-LAWNQSLAHVFASAGSSNFASIWDLKAKKEVIHLSY 201

Query: 248 SSPFNTLD--------FSKHSQNLFAAAGTDS--LVYLYDLRNTADALHTMS-GHEDSVT 296
           +SP + +           K+S  +  A G+D+   + ++DLRN    L T++ GH+  + 
Sbjct: 202 TSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILIWDLRNANTPLQTLNQGHQKGIL 261

Query: 297 SLEFSPHKDGILCSSGSDRRVLLWD 321
           SL++    + +L SSG D  VLLW+
Sbjct: 262 SLDWCHQDEHLLLSSGRDNTVLLWN 286

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 66/144 (45%), Gaps = 9/144 (6%)

Query: 242 VHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTM---SGHEDSVTSL 298
           +  L + S FN LD+S H+  + A A  +  + LY      +A+++M   S H  SV ++
Sbjct: 56  IASLQVDSKFNDLDWS-HNNKIIAGALDNGSLELYSTNEANNAINSMARFSNHSSSVKTV 114

Query: 299 EFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFN 358
           +F+  +D +L S G++  + +WD+      +  E  ++  P            V   ++N
Sbjct: 115 KFNAKQDNVLASGGNNGEIFIWDM-----NKCTESPSNYTPLTPGQSMSSVDEVISLAWN 169

Query: 359 WNIPWLMASVEEDNIVHVWKVSKK 382
            ++  + AS    N   +W +  K
Sbjct: 170 QSLAHVFASAGSSNFASIWDLKAK 193

>KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011W
          Length = 478

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 76/164 (46%), Gaps = 5/164 (3%)

Query: 159 FHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFN 218
           FH ++ +    + R K   ++      I LW+     + P   ++   D +N   +++  
Sbjct: 169 FHGEHAFQSLDHHRQKSNFVTGG--AQIELWDT--NRSKPISNLSWGADNINHVRFNQNE 224

Query: 219 ENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDL 278
            ++  S   D ++ ++D RTNS   ++  +   N++ ++      F  A  D   Y YD+
Sbjct: 225 VDILASTGSDNSVVLYDLRTNSPTQKIVQTMRTNSICWNPVEAFNFVIANEDHNAYYYDM 284

Query: 279 RNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
           RN + ALH    H  +V  ++FSP  D ++  S  D+ + ++ +
Sbjct: 285 RNMSKALHVFKDHVSAVMDVDFSPTGDEVVTGS-YDKTIRIYQV 327

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 77/182 (42%), Gaps = 24/182 (13%)

Query: 160 HKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEF-- 217
           H+D  Y ++ N     +L + S DG I  WN M T    S     +  +   C    +  
Sbjct: 66  HRDGVYTIAKNYNVLNKLATASGDGVIKYWN-MSTREELSSFKAHYGMVTGLCVTPSYLS 124

Query: 218 --NENLFGSVSEDKTLQI------------HDKRTNS---TVHRLTLSSPFNTLDFSKHS 260
              EN   S  +DKT+++             D R N+    +        F +LD  +  
Sbjct: 125 PQRENFMLSCGDDKTVKLWSVNSDDFSNVKDDTRLNTDEGIIKTFHGEHAFQSLDHHRQK 184

Query: 261 QNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLW 320
            N F   G  + + L+D  N +  +  +S   D++  + F+ ++  IL S+GSD  V+L+
Sbjct: 185 SN-FVTGG--AQIELWDT-NRSKPISNLSWGADNINHVRFNQNEVDILASTGSDNSVVLY 240

Query: 321 DL 322
           DL
Sbjct: 241 DL 242

>KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {ON}
           Anc_3.259 YDR030C
          Length = 369

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 100/233 (42%), Gaps = 30/233 (12%)

Query: 174 KGELLSCSDDGTIALWNVMGT-------NTSPSKAVT---THEDIVNDCTWHEFNENLFG 223
           K   L+ +++GT++LWN+  T       N   ++  T   +H   +ND  W+  ++ +F 
Sbjct: 61  KTSFLAGNNNGTVSLWNLDNTLSTSHILNNKLARTSTKPHSHLFGINDMKWYSIDDGMFF 120

Query: 224 SVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLV-YLYDLRNTA 282
           +   DK +++ D      V  L     FN+  F   + N F     D     L DLRN  
Sbjct: 121 TCGNDKFVKLWDTNKFINVQDL----EFNSNLFQMDTANQFILVTLDDYYPRLIDLRNMN 176

Query: 283 DALHTMSGHEDSVT-SLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPEL 341
             +     H +S T   + +P +D ++ SS +D  + +WD+ ++     +E  A      
Sbjct: 177 LGITIFGKHLNSKTLCCKINPVRDNLIASSDNDGMIRIWDV-RMNYRSIEEWKA------ 229

Query: 342 MMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKLTSPGLIQDYDI 394
                 H  ++ND  +N N   L+ S   D  + +W+     T   LI D +I
Sbjct: 230 ------HSRSINDMVWNDNGTKLI-STGVDGKIQIWREPFNETQGQLIGDINI 275

>ADR090W Chr4 (868742..872443) [3702 bp, 1233 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL195W (SEC31)
          Length = 1233

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 53/214 (24%), Positives = 87/214 (40%), Gaps = 26/214 (12%)

Query: 135 NGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWN---V 191
           NGV + F     +      V+  A H      + FN +     +S    G I +W+   +
Sbjct: 82  NGVVEFFCARERRS-----VARVARHTTGVRAVRFNAKQANVAVSGGSQGEIFVWDTNKI 136

Query: 192 MGTNTSP--SKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSS 249
                SP       T  D V    W++   ++F S        I D +    V  L+ +S
Sbjct: 137 SAAGYSPFGPGTAMTPIDEVQSLAWNQSLAHVFASAGSSGFASIWDLKAKKEVIHLSYTS 196

Query: 250 PFNTLD--------FSKHSQNLFAAAGTDS--LVYLYDLRNTADALHTMS-GHEDSVTSL 298
           P + L            +S  +  A G D+  ++ ++DLRN    L  MS GH   + SL
Sbjct: 197 PHSGLKNQLAVVEWHPSNSTRVATATGNDNEPVILVWDLRNANMPLQVMSQGHSKGILSL 256

Query: 299 EFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQE 332
           ++  H + ++ SSG D   +LW+      E+AQ+
Sbjct: 257 DWCKHDEKLMLSSGRDNTCILWN-----PEEAQK 285

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 32/149 (21%), Positives = 61/149 (40%), Gaps = 9/149 (6%)

Query: 181 SDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNS 240
           S   T+  W V    + P  +VT      ND  W      L G++ E+  ++    R   
Sbjct: 37  SSTATLEFWEVGSAESGPQGSVTADAKF-NDLDWSRDGAMLAGAL-ENGVVEFFCARERR 94

Query: 241 TVHRLTL-SSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHE------D 293
           +V R+   ++    + F+    N+  + G+   ++++D    + A ++  G        D
Sbjct: 95  SVARVARHTTGVRAVRFNAKQANVAVSGGSQGEIFVWDTNKISAAGYSPFGPGTAMTPID 154

Query: 294 SVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
            V SL ++     +  S+GS     +WDL
Sbjct: 155 EVQSLAWNQSLAHVFASAGSSGFASIWDL 183

>SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963
           bp, 320 aa] {ON} highly similar to with YMR116C
           uniprot|P38011 Saccharomyces cerevisiae YMR116C ASC1 WD
           repeat protein (G- beta like protein) involved in
           translation regulation required for repression of Gcn4p
           activity in the absence of amino-acid starvation core
           component of the ribosome ortholog of mammalian RACK1
          Length = 320

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 108/243 (44%), Gaps = 30/243 (12%)

Query: 151 EALVSEHAFHKDNGY--GLSFNPRTKGELLSCSDDGTIALWNVMGTNTS---PSKAVTTH 205
           E LV        NG+   L+ +P     LLS S D T+  W + G +     P ++   H
Sbjct: 6   EVLVLRGTLEGHNGWVTSLATSPAQPNLLLSASRDKTLITWKLTGDDQQYGVPVRSFKGH 65

Query: 206 EDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLT-LSSPFNTLDFSKHSQNLF 264
             I+ DCT     E    S S DKT+++ +  T   V R     S   ++   + +  + 
Sbjct: 66  SHIIQDCTVTADGEYAL-SASWDKTIRLWELATGKCVKRFVGHKSDVLSVAIDRRATQIV 124

Query: 265 AAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDG-----ILCSSGSDRRVLL 319
           +A+  D  V +++     + + T+ GH D V+ +  +P++D       + S+G D+ V +
Sbjct: 125 SAS-RDKTVKVWN--TLGECMVTLLGHNDWVSQVRVAPNEDPEDKTVTVISAGMDKVVKV 181

Query: 320 WDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKV 379
           W+L     E      AD +        GH + VN  + + +   L+AS  +D  + +W +
Sbjct: 182 WNLHSFQIE------ADFI--------GHNNYVNTVTASPDGS-LVASAGKDGQIMLWNL 226

Query: 380 SKK 382
           ++K
Sbjct: 227 TEK 229

>KAFR0I00500 Chr9 complement(104685..106268) [1584 bp, 527 aa] {ON}
           Anc_4.309 YLR429W
          Length = 527

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 62/132 (46%), Gaps = 12/132 (9%)

Query: 160 HKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMG-----------TNTSPSKAVTTHEDI 208
           HK N   + F+P    ++ SCS+D +IA+W +                 P+  +T HE  
Sbjct: 78  HKGNVLDIDFDPFDDYKISSCSEDKSIAIWQIPKDYSIRSKRFKFKGIQPTARLTGHEKK 137

Query: 209 VNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAG 268
           V    ++   ++L  S S D+T++I D  T  T+H L       +L FS +  N  A   
Sbjct: 138 VGHVLYNPVIQDLLASSSFDQTVKIWDISTGETLHTLQHDEVVLSLSFS-YDGNYLATLS 196

Query: 269 TDSLVYLYDLRN 280
            + ++ ++D+RN
Sbjct: 197 RNRILRVWDIRN 208

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 52/115 (45%), Gaps = 1/115 (0%)

Query: 283 DALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELM 342
           D +   +GH+ +V  ++F P  D  + S   D+ + +W + +  S +++     G+    
Sbjct: 70  DVMPLFTGHKGNVLDIDFDPFDDYKISSCSEDKSIAIWQIPKDYSIRSKRFKFKGIQPTA 129

Query: 343 MMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKLTSPGLIQDYDIRSL 397
            +  GH+  V    +N  I  L+AS   D  V +W +S   T   L  D  + SL
Sbjct: 130 RL-TGHEKKVGHVLYNPVIQDLLASSSFDQTVKIWDISTGETLHTLQHDEVVLSL 183

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 76/161 (47%), Gaps = 20/161 (12%)

Query: 203 TTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVH--RLTLSSPFNTLDFSKHS 260
           T H+  V D  +  F++    S SEDK++ I     + ++   R        T   + H 
Sbjct: 76  TGHKGNVLDIDFDPFDDYKISSCSEDKSIAIWQIPKDYSIRSKRFKFKGIQPTARLTGHE 135

Query: 261 ------------QNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGIL 308
                       Q+L A++  D  V ++D+ +T + LHT+  H++ V SL FS   DG  
Sbjct: 136 KKVGHVLYNPVIQDLLASSSFDQTVKIWDI-STGETLHTLQ-HDEVVLSLSFS--YDGNY 191

Query: 309 CSSGSDRRVL-LWDLMQIGSEQAQEDAADGVPELMMMHAGH 348
            ++ S  R+L +WD+   G+  +Q +A +GV    ++  G+
Sbjct: 192 LATLSRNRILRVWDIRN-GTVISQGEAHEGVKSQRVIWLGN 231

 Score = 33.9 bits (76), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 9/59 (15%)

Query: 338 VPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKLTSPGLIQDYDIRS 396
            P++M +  GHK  V D  F+    + ++S  ED  + +W++ K         DY IRS
Sbjct: 68  CPDVMPLFTGHKGNVLDIDFDPFDDYKISSCSEDKSIAIWQIPK---------DYSIRS 117

>Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL218C
          Length = 409

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 70/257 (27%), Positives = 110/257 (42%), Gaps = 46/257 (17%)

Query: 158 AFHKDNGYGLSFNPRTKGELLSCSDDGTIAL--WN---------VMGTNTSPSKAVTTHE 206
           +F  DN + L   P     LLS   +G + L  WN         V GT+ S  K +    
Sbjct: 10  SFGSDN-WCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDV 68

Query: 207 DIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRL--TLSSPFNTLDFSKHSQNLF 264
           D          + N F + SED +++I D R N  V  +    +SPF +LD S+H     
Sbjct: 69  D----------SGNTFVTASED-SVKIFDLRLNQCVATVQNAKNSPFISLD-SRHGMLAC 116

Query: 265 AA--AGTDSLVYLYDLRNTADALHTMS-GHEDSVTSLEFSPHKDGILCSSGSDRRVLLWD 321
               +GTD+ ++LYDL+     + +    H D +T ++F      +L S  +D  V ++D
Sbjct: 117 GTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYD 176

Query: 322 LMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIP---WLMASVEEDNIVHVWK 378
           L Q    Q +E+A   V     +H          S  W  P   W ++ +E  +I  +  
Sbjct: 177 LKQ----QEEEEALHQVINFASIH----------SCGWLSPKRIWALSHMETFSIHELND 222

Query: 379 VSKKLTSPGLIQDYDIR 395
            S +L  P  ++  DIR
Sbjct: 223 KSDELVEPKPLEFGDIR 239

>YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integral
           subunit of the pre-mRNA cleavage and polyadenylation
           factor (CPF) complex; plays an essential role in mRNA
           3'-end formation by bridging different processing
           factors and thereby promoting the assembly of the
           processing complex
          Length = 465

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/236 (22%), Positives = 101/236 (42%), Gaps = 19/236 (8%)

Query: 150 NEALVSE-HAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDI 208
           N ++V E  A H ++   ++F+     + ++CSDD  + +WN   +N    + ++ H   
Sbjct: 165 NFSMVKEIDAAHTESIRDMAFS-SNDSKFVTCSDDNILKIWNF--SNGKQERVLSGHHWD 221

Query: 209 VNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHR-LTLSSPFNTLDFSKHSQNLFAAA 267
           V  C WH     L  S S+D  +++ D R+ + +   L          F     NL  A 
Sbjct: 222 VKSCDWHP-EMGLIASASKDNLVKLWDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAI 280

Query: 268 GTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGS 327
             D    ++D+R +   L  +    D +T LE+ P  + +   +  D  +  +DL+Q  +
Sbjct: 281 SKDKSCRVFDIRYSMKELMCVRDETDYMT-LEWHPINESMFTLACYDGSLKHFDLLQNLN 339

Query: 328 EQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKL 383
           E          P L + +A H   +   S+N  +  + A+  +D  +  W  ++ +
Sbjct: 340 E----------PILTIPYA-HDKCITSLSYN-PVGHIFATAAKDRTIRFWTRARPI 383

>Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON}
           similar to Ashbya gossypii ADR090W
          Length = 1228

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 90/212 (42%), Gaps = 26/212 (12%)

Query: 138 GKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNT- 196
           G V  F   + ++ A V +H         L FN +    L+S    G I +W+     T 
Sbjct: 84  GVVEFFKPEELRSVAKVKKHTTAVQT---LRFNAKQSNVLVSGGSQGEIYVWDTNKIATQ 140

Query: 197 -----SPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPF 251
                 P  A+T  E+ V    W++   ++F S        I D +    V  L+ +SP 
Sbjct: 141 GYSPFGPGVAMTPIEE-VQSLAWNQTLAHVFASAGSSGFASIWDLKAKKEVIHLSYTSPT 199

Query: 252 NTLD--------FSKHSQNLFAAAGTDS--LVYLYDLRNTADALHTMS-GHEDSVTSLEF 300
           + L            +S  +  A G D+  ++ ++DLRN+   L  +S GH   + SL++
Sbjct: 200 SGLKNQLSVVEWHPSNSTKVATATGNDNEPVILVWDLRNSNAPLKVLSQGHSKGILSLDW 259

Query: 301 SPHKDGILCSSGSDRRVLLWDLMQIGSEQAQE 332
               D ++ SSG D   +LW+      E+AQ+
Sbjct: 260 CQQDDKLMISSGRDNTCILWN-----PEEAQK 286

 Score = 34.7 bits (78), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 31/150 (20%), Positives = 63/150 (42%), Gaps = 10/150 (6%)

Query: 181 SDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSED--KTLQIHDKRT 238
           S   T+ LW+V+  +    + +   +   ND  W +    L G++     +  +  + R+
Sbjct: 37  SSASTLELWSVLSRDARTPQGMIVADAKFNDLEWSKDGSILAGALDNGVVEFFKPEELRS 96

Query: 239 NSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHE------ 292
            + V + T +    TL F+    N+  + G+   +Y++D    A   ++  G        
Sbjct: 97  VAKVKKHTTA--VQTLRFNAKQSNVLVSGGSQGEIYVWDTNKIATQGYSPFGPGVAMTPI 154

Query: 293 DSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
           + V SL ++     +  S+GS     +WDL
Sbjct: 155 EEVQSLAWNQTLAHVFASAGSSGFASIWDL 184

>Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to
           Ashbya gossypii ADL184W
          Length = 451

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 84/209 (40%), Gaps = 14/209 (6%)

Query: 176 ELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHD 235
           + ++CSDD  + +WN   +N    + ++ H   V  C WH     L  S S+D  ++  D
Sbjct: 177 KFVTCSDDNVLKIWNF--SNGQQERVLSGHHWDVKSCDWHP-RFGLIVSGSKDNLIKFWD 233

Query: 236 KRTNSTVHR-LTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDS 294
            RT   V   L L        F     NL A    D    +YD+R     L T+    D 
Sbjct: 234 PRTGRNVSTILGLKHTIIKTKFQPTQGNLLAVVAKDKSTKIYDIRQNMRELQTIRDDVDY 293

Query: 295 VTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVND 354
           + SL + P  + +      +  +  +DL+         D    VP    +   H+ +V  
Sbjct: 294 M-SLVWHPINETMFSVGCYNGAIKHFDLLH--------DNNSPVPSSHTITYAHEKSVTS 344

Query: 355 FSFNWNIPWLMASVEEDNIVHVWKVSKKL 383
            +++  +  ++AS  +D  +  W  S+ +
Sbjct: 345 LAYS-PVGHILASAAKDRTIRFWARSRPV 372

>AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR084C (TUP1)
          Length = 629

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 103/243 (42%), Gaps = 41/243 (16%)

Query: 160 HKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNE 219
           H+ + Y L + P    +L+S S D T+ +W++     S + ++   ED V        + 
Sbjct: 393 HEQDIYSLDYFP-AGDKLVSGSGDRTVRIWDLRTGQCSLTLSI---EDGVTTVAVSPGDG 448

Query: 220 NLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNT--------LDFSKHSQNLFAAAGTDS 271
               + S D+T+++ D  T   V RL   +  +T        + F++  Q + + +  D 
Sbjct: 449 KYIAAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGS-LDR 507

Query: 272 LVYLYDLRNT------ADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQI 325
            V L+DLR        A    T +GH+D V S+  +   D  + S   DR VL W     
Sbjct: 508 SVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVATT-QDDEYILSGSKDRGVLFW----- 561

Query: 326 GSEQAQEDAADGVPELMMMHAGHK------SAVNDFSFNWNIPWLMASVEEDNIVHVWKV 379
                  D A G P LM+   GH+      + VN F    ++  + A+   D    +WK 
Sbjct: 562 -------DTASGNPLLMLQ--GHRNSVISVAVVNGFPLGPDV-GVFATGSGDCKARIWKY 611

Query: 380 SKK 382
           +KK
Sbjct: 612 TKK 614

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 51/98 (52%), Gaps = 6/98 (6%)

Query: 226 SEDKTLQIHDKRTNSTVHRLTL-SSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADA 284
           +EDK ++I D  T   +  L        +LD+      L + +G D  V ++DLR    +
Sbjct: 371 AEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSG-DRTVRIWDLRTGQCS 429

Query: 285 LHTMSGHEDSVTSLEFSPHKDGILCSSGS-DRRVLLWD 321
           L T+S  ED VT++  SP  DG   ++GS DR V +WD
Sbjct: 430 L-TLS-IEDGVTTVAVSP-GDGKYIAAGSLDRTVRVWD 464

>CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035c
          Length = 376

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 87/188 (46%), Gaps = 13/188 (6%)

Query: 163 NGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLF 222
           N + L   P   G L S S  G + L   +G + S   +    E  +N  +  +  ENLF
Sbjct: 13  NNWCLKLQPVHNGILTSVSS-GEVHL---LGLDLSKQDSFKVGETSINALSRVDGQENLF 68

Query: 223 GSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDF-SKHSQNLFAA--AGTDSLVYLYDLR 279
            + + +K +++ D R N  V  L   +  N L   S H    + +   G D+ ++L+D+R
Sbjct: 69  AASNGNK-VKVFDLRENKEVATLEQENGANVLSLGSGHGMLAYGSEQQGVDAHLHLFDIR 127

Query: 280 NTADALHT-MSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGV 338
           N +  + + +  H+D +TS+ F P    +L S  +D    ++DL+    E  +EDA   V
Sbjct: 128 NWSKPVRSFVDSHQDDITSIAFHPADANVLLSGSTDGYTNVYDLL----EPEEEDALHQV 183

Query: 339 PELMMMHA 346
                +H+
Sbjct: 184 INYASIHS 191

>NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201
          Length = 475

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 77/204 (37%), Gaps = 58/204 (28%)

Query: 166 GLSFNP----RTKGE--LLSCSDDGTIALW-----------NVMGTNTSPSKAVTTHEDI 208
           GL   P    + K E  +LSCSDD T+ LW           N    NT+     T + D 
Sbjct: 115 GLCVTPEHLSKQKNENFMLSCSDDKTVKLWSVNSEDYANLKNAEDINTASGLLKTYYSDF 174

Query: 209 -------------------------------VNDCTWH-------EFNEN---LFGSVSE 227
                                          + D +W        +FN+N   +  S   
Sbjct: 175 AFQGIDHHRSKSNFVTGGAKIQLWDSNRSKPLTDLSWGADNISTVKFNQNETDILASAGS 234

Query: 228 DKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHT 287
           D +L ++D RTNS   ++  +   N + ++      F  A  D   Y YD+RN + AL+ 
Sbjct: 235 DNSLVLYDLRTNSPTQKIVQTMRTNAICWNPMEAFNFVVANEDHNAYYYDMRNMSRALNV 294

Query: 288 MSGHEDSVTSLEFSPHKDGILCSS 311
              H  +V  ++FSP  D I+  S
Sbjct: 295 FKDHVSAVMDVDFSPTGDEIVTGS 318

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 82/183 (44%), Gaps = 25/183 (13%)

Query: 160 HKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEF-- 217
           H+D  Y ++ N +   +L + S DG +  WN M T          +  I   C   E   
Sbjct: 66  HRDGVYVIAKNYKNLNKLATGSADGVVKYWN-MSTREELCSFKAHYGLITGLCVTPEHLS 124

Query: 218 ---NENLFGSVSEDKTLQI--------------HDKRTNSTVHRLTLSS-PFNTLDFSKH 259
              NEN   S S+DKT+++               D  T S + +   S   F  +D  + 
Sbjct: 125 KQKNENFMLSCSDDKTVKLWSVNSEDYANLKNAEDINTASGLLKTYYSDFAFQGIDHHRS 184

Query: 260 SQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLL 319
             N F   G  + + L+D  N +  L  +S   D++++++F+ ++  IL S+GSD  ++L
Sbjct: 185 KSN-FVTGG--AKIQLWD-SNRSKPLTDLSWGADNISTVKFNQNETDILASAGSDNSLVL 240

Query: 320 WDL 322
           +DL
Sbjct: 241 YDL 243

>SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 398

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 74/136 (54%), Gaps = 15/136 (11%)

Query: 218 NENLFGSVSEDKTLQIHDKRTNSTVHRL--TLSSPFNTLDFSKHSQNLFAA----AGTDS 271
           N +LF S S+D +++I D RT+S V  L    S+PF +LD S+H  ++ A     +G D+
Sbjct: 70  NSDLFASASKD-SVKIFDVRTSSCVATLHNDKSAPFLSLD-SRH--DMLACGTELSGVDA 125

Query: 272 LVYLYDLRNTADALHT-MSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQA 330
            +++YD++  +  L + +  H D +T  +F P   G+L S  +D  V ++DL    +   
Sbjct: 126 ELHIYDIKKLSKPLRSFVDSHHDDITDTKFHPGDPGVLMSGSTDGYVNIYDL----TNSD 181

Query: 331 QEDAADGVPELMMMHA 346
           +EDA   V     +H+
Sbjct: 182 EEDALHQVINFASVHS 197

>Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON}
           (237070..238533) [1464 nt, 488 aa]
          Length = 487

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 67/138 (48%), Gaps = 5/138 (3%)

Query: 186 IALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRL 245
           I LW+   + + P   +T   D V +  +++   ++  S   D ++ ++D RTNS   ++
Sbjct: 195 IQLWD--SSRSKPISNLTWGADNVTNVKFNQTETDILASTGSDNSIVLYDLRTNSPTQKI 252

Query: 246 TLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKD 305
             S   N + ++      F  A  D   Y YD+RN + AL+    H  +V  ++FSP   
Sbjct: 253 VQSMRSNAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSP--T 310

Query: 306 GILCSSGS-DRRVLLWDL 322
           G    +GS D+ + ++D+
Sbjct: 311 GTELVTGSYDKTIRIYDI 328

 Score = 37.4 bits (85), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 81/187 (43%), Gaps = 33/187 (17%)

Query: 160 HKDNGYGLSFNPRTKGELLSCSDDGTIALWN----------------VMGTNTSPSKAVT 203
           ++D  Y ++ N  +  +L + S DG +  WN                V G   SP K  +
Sbjct: 66  YRDGVYCIAKNYNSLNKLAAASADGVVKYWNMSTREELCSFKAHYGLVTGLCVSPEKYSS 125

Query: 204 -THEDIVNDC-------TWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLD 255
             +E  +  C        W   N   F +V +D+++   D      +        F  LD
Sbjct: 126 DKNEHFMISCGDDKTIKLW-SVNSEDFANVKDDESVNTKD----GLIKTFYGEHAFQGLD 180

Query: 256 FSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDR 315
             +++ + F   G  + + L+D  + +  +  ++   D+VT+++F+  +  IL S+GSD 
Sbjct: 181 HHRNN-STFVTGG--AQIQLWD-SSRSKPISNLTWGADNVTNVKFNQTETDILASTGSDN 236

Query: 316 RVLLWDL 322
            ++L+DL
Sbjct: 237 SIVLYDL 243

>SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]
           {ON} highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 476

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 77/167 (46%), Gaps = 11/167 (6%)

Query: 159 FHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFN 218
           FH +  +    + RTK   ++      I LW+     T  SK V+      ++ T  +FN
Sbjct: 170 FHGEYAFQSIDHHRTKSTFVTGG--AQIELWD-----TGRSKPVSNLSWGADNVTSVKFN 222

Query: 219 EN---LFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYL 275
           +N   +  S   D ++ ++D RTNS   ++  +   N + ++      F  A  D   Y 
Sbjct: 223 QNETDILASTGSDNSVVLYDLRTNSPTQKIVQTMRTNAICWNPMEAFNFVIANEDHNAYY 282

Query: 276 YDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
           YD+RN + AL+    H  +V  ++FSP  D I+  S  D+ V ++ +
Sbjct: 283 YDMRNMSRALNVFKDHVSAVMDVDFSPTGDEIVTGS-YDKTVRIYQV 328

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 82/183 (44%), Gaps = 25/183 (13%)

Query: 160 HKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEF-- 217
           H+D  Y ++ N     +L + S DG +  WN M T          +  +   C   +   
Sbjct: 66  HRDGVYVVAKNYHALNKLATASGDGVVKYWN-MSTREELCSFKAHYGLVTGLCVTPQHLS 124

Query: 218 ---NENLFGSVSEDKTLQ---IHDKRTNSTVHRLTLSS------------PFNTLDFSKH 259
              NEN   S  +DK ++   ++    +ST     L++             F ++D  + 
Sbjct: 125 KNKNENYMLSCGDDKMIKLWSVNSDDFSSTRDNDELNTGDGLLKTFHGEYAFQSIDHHR- 183

Query: 260 SQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLL 319
           +++ F   G  + + L+D    +  +  +S   D+VTS++F+ ++  IL S+GSD  V+L
Sbjct: 184 TKSTFVTGG--AQIELWDT-GRSKPVSNLSWGADNVTSVKFNQNETDILASTGSDNSVVL 240

Query: 320 WDL 322
           +DL
Sbjct: 241 YDL 243

>Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W
           (REAL)
          Length = 469

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 55/244 (22%), Positives = 103/244 (42%), Gaps = 20/244 (8%)

Query: 150 NEALVSE-HAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDI 208
           N ++V E  A H ++   ++F+     + ++CSDD  + +WN   +N    + ++ H   
Sbjct: 167 NFSMVKEIDAAHTESIRDMAFS-SNDSKFVTCSDDNILKIWNF--SNGKQERVLSGHHWD 223

Query: 209 VNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHR-LTLSSPFNTLDFSKHSQNLFAAA 267
           V  C WH     L  S S+D  +++ D R+ + +   L          F     NL  A 
Sbjct: 224 VKSCDWHP-EMGLIASASKDNLVKLWDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAI 282

Query: 268 GTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGS 327
             D    ++D+R +   L  +    D +T LE+ P  + +   +  D  +  +DL+Q  +
Sbjct: 283 SKDKSCRVFDIRYSMKELMCVRDETDYMT-LEWHPINESMFTLACYDGSLKHFDLLQDLN 341

Query: 328 EQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKLTSPG 387
           E          P L + +A H   +   S+N  +  + A+  +D  +  W  ++  T P 
Sbjct: 342 E----------PILTIPYA-HDKCITSLSYN-PVGHIFATAAKDRTIRFWTRARP-TDPN 388

Query: 388 LIQD 391
              D
Sbjct: 389 AYDD 392

>Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {ON}
           similar to Ashbya gossypii AGL234W
          Length = 646

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 64/246 (26%), Positives = 107/246 (43%), Gaps = 41/246 (16%)

Query: 160 HKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNE 219
           H+ + Y L + P    +L+S S D T+ +W++     S + ++   ED V        + 
Sbjct: 410 HEQDIYSLDYFP-AGDKLVSGSGDRTVRIWDLRTGQCSLTLSI---EDGVTTVAVSPGDG 465

Query: 220 NLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNT--------LDFSKHSQNLFAAAGTDS 271
               + S D+T+++ D  T   V RL   +  +T        + F++  +++ + +  D 
Sbjct: 466 KYIAAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGS-LDR 524

Query: 272 LVYLYDLRNT------ADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQI 325
            V L+DLR        A    T +GH+D V S+  +   + IL  S  DR VL W     
Sbjct: 525 SVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGS-KDRGVLFW----- 578

Query: 326 GSEQAQEDAADGVPELMMMHAGHK------SAVNDFSFNWNIPWLMASVEEDNIVHVWKV 379
                  D A G P LM+   GH+      + VN F    +I  + A+   D    +WK 
Sbjct: 579 -------DTASGNPLLMLQ--GHRNSVISVAVVNGFPLGPDI-GVFATGSGDCKARIWKY 628

Query: 380 SKKLTS 385
           +KK +S
Sbjct: 629 TKKTSS 634

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 34/59 (57%), Gaps = 2/59 (3%)

Query: 264 FAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
            A    D L+ ++DL ++   L T+ GHE  + SL++ P  D ++  SG DR V +WDL
Sbjct: 384 LATGAEDKLIRIWDL-SSKKILMTLQGHEQDIYSLDYFPAGDKLVSGSG-DRTVRIWDL 440

 Score = 33.5 bits (75), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 51/98 (52%), Gaps = 6/98 (6%)

Query: 226 SEDKTLQIHDKRTNSTVHRLT-LSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADA 284
           +EDK ++I D  +   +  L        +LD+      L + +G D  V ++DLR    +
Sbjct: 388 AEDKLIRIWDLSSKKILMTLQGHEQDIYSLDYFPAGDKLVSGSG-DRTVRIWDLRTGQCS 446

Query: 285 LHTMSGHEDSVTSLEFSPHKDGILCSSGS-DRRVLLWD 321
           L T+S  ED VT++  SP  DG   ++GS DR V +WD
Sbjct: 447 L-TLS-IEDGVTTVAVSP-GDGKYIAAGSLDRTVRVWD 481

>TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {ON}
           Anc_5.201 YLL011W
          Length = 488

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 64/139 (46%), Gaps = 3/139 (2%)

Query: 186 IALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRL 245
           I LW+     + P   +T   D V    +++   ++  S   D ++ ++D RTNS   ++
Sbjct: 195 IQLWD--ANRSKPISNLTWGADNVTSVKFNQTETDILASTGSDNSIVLYDLRTNSPTQKI 252

Query: 246 TLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKD 305
             S   N + ++      F  A  D   Y YD+RN + AL+    H  +V  ++FSP  D
Sbjct: 253 RQSMRTNAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPTGD 312

Query: 306 GILCSSGSDRRVLLWDLMQ 324
            I+  S  D+ + ++   Q
Sbjct: 313 EIVTGS-YDKTIRIYKTNQ 330

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 90/213 (42%), Gaps = 37/213 (17%)

Query: 143 FDRSKDKNEALVS---EHAF-----------HKDNGYGLSFNPRTKGELLSCSDDGTIAL 188
           F+R+++  +AL +   E  F           H+D  Y ++ N     +L S S DG +  
Sbjct: 35  FERAREYTKALTATKMERMFAKPFIGQMGYGHRDGVYTIAKNYNQLNKLASSSADGVVKY 94

Query: 189 WNVMGTNTSPSKAVTTHEDIVNDCTWHEF-----NENLFGSVSEDKTLQI--------HD 235
           +N M T          +  +   C   E      NE+   S  +DKT+++         +
Sbjct: 95  FN-MSTREEICSFKAHYGLVTGLCVRPETSATNKNEHYMISCGDDKTVKLWSVDSNDFSN 153

Query: 236 KRTNSTVHR-----LTLSSPFNTLDFSKHSQN-LFAAAGTDSLVYLYDLRNTADALHTMS 289
            + + T+H+      T            H  N  F   G  + + L+D  N +  +  ++
Sbjct: 154 NKKDDTIHKGDGLLKTYYGDHAFFGLDHHRNNSTFVTGG--AQIQLWDA-NRSKPISNLT 210

Query: 290 GHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
              D+VTS++F+  +  IL S+GSD  ++L+DL
Sbjct: 211 WGADNVTSVKFNQTETDILASTGSDNSIVLYDL 243

>Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}
           similar to Ashbya gossypii AGL190W
          Length = 374

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 56/244 (22%), Positives = 106/244 (43%), Gaps = 29/244 (11%)

Query: 136 GVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTN 195
           G GK+F+ D +  + + + S     KD  + +++N   + ++L+   DG++ L+++    
Sbjct: 37  GNGKLFILDITP-QGKIVESNSFLTKDGLFDVAWNELHENQVLAAQGDGSLRLFDI-NLQ 94

Query: 196 TSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLD 255
             P      HE  V  C W+  ++  F S S D T++I       ++ R  L +P N   
Sbjct: 95  KYPVAIFQEHEREVFSCNWNLIDKQTFLSSSWDGTVKIWSPARKQSL-RTLLPTPTNN-- 151

Query: 256 FSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSG-HEDSVTSLEFSPHKDGILCSSGSD 314
                         DS V   D+  +  A H  S  ++D +    +SPH   ++ S   +
Sbjct: 152 ----------TVLVDSTVLKQDVPVSNQAQHKYSSNNKDCIYQALYSPHDSNLVMSCSGN 201

Query: 315 RRVLLWDLMQ-IGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNI 373
             V ++D+ Q + +EQ          +  + H G ++   D  FN   P ++A+   D +
Sbjct: 202 SYVSIFDIRQPVNTEQ----------QSFIAHRGLEALTCD--FNKYRPHIVATGGVDKL 249

Query: 374 VHVW 377
           + VW
Sbjct: 250 IKVW 253

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 53/235 (22%), Positives = 91/235 (38%), Gaps = 45/235 (19%)

Query: 129 NFIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIAL 188
           N +    G G + LFD +  K    + +   H+   +  ++N   K   LS S DGT+ +
Sbjct: 75  NQVLAAQGDGSLRLFDINLQKYPVAIFQE--HEREVFSCNWNLIDKQTFLSSSWDGTVKI 132

Query: 189 W-----------------------------NVMGTNTSPSKAVTTHEDIVNDCTWHEFNE 219
           W                             +V  +N +  K  + ++D +    +   + 
Sbjct: 133 WSPARKQSLRTLLPTPTNNTVLVDSTVLKQDVPVSNQAQHKYSSNNKDCIYQALYSPHDS 192

Query: 220 NLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFN----TLDFSKHSQNLFAAAGTDSLVYL 275
           NL  S S +  + I D R      + +  +       T DF+K+  ++ A  G D L+ +
Sbjct: 193 NLVMSCSGNSYVSIFDIRQPVNTEQQSFIAHRGLEALTCDFNKYRPHIVATGGVDKLIKV 252

Query: 276 YDLRNTADA-LHT---------MSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLW 320
           +DLR    + LHT         M GH  +V  + +SPH   +L S+  D     W
Sbjct: 253 WDLRMVRQSLLHTRSSPVSINEMQGHSLAVRRVFWSPHHSDMLLSTSYDMTCRTW 307

>KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8.672
           YPL151C
          Length = 398

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 91/190 (47%), Gaps = 11/190 (5%)

Query: 177 LLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDK 236
            ++ S+D T+ +W++       +  ++ H   V D    E +  +F S SEDK ++  D 
Sbjct: 102 FVTGSNDTTLKVWDLASGKLKLT--LSGHTMGVRDVAVSERHPYMF-SASEDKLVKCWDL 158

Query: 237 RTNSTVHRLTLS-SPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSV 295
             N+ +       S  +T+D    + +L A  G D++V L+D+R T  A+ T+ GH+  +
Sbjct: 159 EKNTAIRDYYGHLSGVHTVDIHP-TLDLIATGGRDAVVKLWDIR-TRKAVKTLVGHKAPI 216

Query: 296 TSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGH---KSAV 352
           T ++ +P  D  + SS +D  V LWD++   S +        V  +  +H G     SA 
Sbjct: 217 TKVKCTP-VDPQVVSSSTDTTVRLWDIVAGKSMKVLTHHKRAVRSI-ALHPGEFSLASAC 274

Query: 353 NDFSFNWNIP 362
            D   +W +P
Sbjct: 275 TDDVRSWRLP 284

>KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {ON}
           some similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 725

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 107/247 (43%), Gaps = 44/247 (17%)

Query: 160 HKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNE 219
           H+ + Y L + P +  +L+S S D T+ +W++     S + ++   ED V        + 
Sbjct: 489 HEQDIYSLDYFP-SGDKLVSGSGDRTVRIWDLRAGQCSLTLSI---EDGVTTVAVSPGDG 544

Query: 220 NLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNT--------LDFSKHSQNLFAAAGTDS 271
            L  + S D+T++I D  T   V RL   +   T        + F++    + + +  D 
Sbjct: 545 KLIAAGSLDRTVRIWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGS-LDR 603

Query: 272 LVYLYDLR-----------NTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLW 320
            V L++LR           NTA +  T +GH+D V S+  + + + IL  S  DR VL W
Sbjct: 604 SVKLWNLRSANGGSTEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGS-KDRGVLFW 662

Query: 321 DLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPW-----LMASVEEDNIVH 375
                       D   G P LM+   GH+++V   +   + P      + A+   D    
Sbjct: 663 ------------DTPSGNPLLMLQ--GHRNSVISVAVANDHPLGPEYGVFATGSGDCKAR 708

Query: 376 VWKVSKK 382
           +WK +KK
Sbjct: 709 IWKYTKK 715

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 80/209 (38%), Gaps = 59/209 (28%)

Query: 148 DKNEALVSEHAFHKDNGYGLSFNPRTKGEL---LSCSDDGTIALWNVMGTNTSPSKAVTT 204
           D +  LV +H   + N Y + +NP    EL   L  S D                     
Sbjct: 336 DLDSQLVPQHLKKQTNDYYILYNPALSRELDVDLHVSLD--------------------- 374

Query: 205 HEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLT---LSSPF-NTLDFSKHS 260
           H  +V  C     N+  + +   +KT Q++   T   V RL+    S+P  N+ D +  +
Sbjct: 375 HSSVV--CCVRFSNDGEYLATGCNKTTQVYKVSTGELVARLSEDAASAPSGNSGDGASGA 432

Query: 261 QN---------------------------LFAAAGTDSLVYLYDLRNTADALHTMSGHED 293
           +N                             A    D L+ ++DL  T   + T+ GHE 
Sbjct: 433 ENAEQTPAVSTSASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDL-TTRRIVMTLQGHEQ 491

Query: 294 SVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
            + SL++ P  D ++  SG DR V +WDL
Sbjct: 492 DIYSLDYFPSGDKLVSGSG-DRTVRIWDL 519

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 65/143 (45%), Gaps = 9/143 (6%)

Query: 181 SDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNS 240
           S DG     N   T   P+ + +   D+         +     + +EDK ++I D  T  
Sbjct: 425 SGDGASGAENAEQT---PAVSTSASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLTTRR 481

Query: 241 TVHRLTL-SSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLE 299
            V  L        +LD+      L + +G D  V ++DLR    +L T+S  ED VT++ 
Sbjct: 482 IVMTLQGHEQDIYSLDYFPSGDKLVSGSG-DRTVRIWDLRAGQCSL-TLS-IEDGVTTVA 538

Query: 300 FSPHKDGILCSSGS-DRRVLLWD 321
            SP  DG L ++GS DR V +WD
Sbjct: 539 VSP-GDGKLIAAGSLDRTVRIWD 560

>Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178W
           (REAL)
          Length = 465

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/211 (22%), Positives = 97/211 (45%), Gaps = 13/211 (6%)

Query: 127 DPNFIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTI 186
           D ++IAT +  G + + +      ++L  +   H      + ++P +  +++SC++DG I
Sbjct: 186 DNDYIATGSWAGDIRILN--SQTLQSLAQKLDSHVGKIGAVQWHPESNNQIISCAEDGLI 243

Query: 187 ALWNVMGTNTSPS--KAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHR 244
             +  +          ++  HE  V+D  +H   +   GS S D T ++ D    ST   
Sbjct: 244 KNFQYLNEEGDLRLLGSLVGHERRVSDLKYHPSGK-FIGSASHDMTWRLWDA---STYQE 299

Query: 245 LTLSSPFNTLDFSKHSQ---NLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFS 301
           L L        F    Q   +L  + G DSL  ++D+R + + + +++GH   V ++++S
Sbjct: 300 LLLQEGHAKGVFCLSFQCDGSLVCSGGMDSLAMIWDIR-SGNKVMSLTGHSKPVYTVDWS 358

Query: 302 PHKDGILCSSGSDRRVLLWDLMQIGSEQAQE 332
           P+   +  + G D  + +WD+ Q    Q  +
Sbjct: 359 PNGYQV-ATGGGDGLINVWDIRQRDGGQVHQ 388

>Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W
           (REAL)
          Length = 467

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 52/236 (22%), Positives = 101/236 (42%), Gaps = 19/236 (8%)

Query: 150 NEALVSE-HAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDI 208
           N ++V E  A H ++   ++F+     + ++CSDD  + +WN   +N    + ++ H   
Sbjct: 165 NFSMVKEIDAAHTESIRDMAFS-SNDSKFVTCSDDNILKIWNF--SNGKQERILSGHHWD 221

Query: 209 VNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHR-LTLSSPFNTLDFSKHSQNLFAAA 267
           V  C WH     L  S S+D  +++ D R+ + +   L          F     NL  A 
Sbjct: 222 VKSCDWHP-EMGLIASASKDNLVKLWDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAI 280

Query: 268 GTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGS 327
             D    ++D+R +   L  +    D +T LE+ P  + +   +  D  +  +DL+Q  +
Sbjct: 281 SKDKSCRVFDIRYSMRELMCVRDETDYMT-LEWHPINESMFTLACYDGSLKHFDLLQDLN 339

Query: 328 EQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKL 383
           E          P L + +A H   +   S+N  +  + A+  +D  +  W  ++ +
Sbjct: 340 E----------PILTIPYA-HDKCITSLSYN-PVGHIFATAAKDRTIRFWTRARPI 383

>KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {ON}
           Anc_6.276 YPL247C
          Length = 553

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 78/161 (48%), Gaps = 16/161 (9%)

Query: 177 LLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDK 236
           L+S S D T  +W++  +N   ++ +  H+  V D  +   +  LF S   D ++++ D 
Sbjct: 296 LISSSIDTTCIVWDLQSSNYVKTQLIA-HDSEVYDVRFLTKSTQLFASCGGDGSVRVFDL 354

Query: 237 RT--NSTVHRLTLSSPFNTLDFSKHSQ------------NLFAAAGTDS-LVYLYDLRNT 281
           R+  +ST+     ++P +  D S+               N+ A   ++S  + + D+RN+
Sbjct: 355 RSLAHSTIIYEPPTNPVSNADLSQQQNALLRLEPSPTDANVIATFVSESNKILILDMRNS 414

Query: 282 ADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
              +  + GH+ ++  +++ P K  IL S   D +VL WDL
Sbjct: 415 ESPVLVLEGHKSAINQIKWHPTKRYILLSCSDDCQVLYWDL 455

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/207 (22%), Positives = 90/207 (43%), Gaps = 28/207 (13%)

Query: 193 GTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFN 252
           GT+ + +  +      V    W++ + NL  S S D T  + D ++++ V    ++    
Sbjct: 267 GTSVTSTSQILGEFPPVTSFDWNQTDTNLLISSSIDTTCIVWDLQSSNYVKTQLIAHDSE 326

Query: 253 TLD--FSKHSQNLFAAAGTDSLVYLYDLRNTADAL------------HTMSGHEDSVTSL 298
             D  F   S  LFA+ G D  V ++DLR+ A +               +S  ++++  L
Sbjct: 327 VYDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPTNPVSNADLSQQQNALLRL 386

Query: 299 EFSPHKDGILCSSGSD-RRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSF 357
           E SP    ++ +  S+  ++L+ D+    S           P L++   GHKSA+N   +
Sbjct: 387 EPSPTDANVIATFVSESNKILILDMRNSES-----------PVLVL--EGHKSAINQIKW 433

Query: 358 NWNIPWLMASVEEDNIVHVWKVSKKLT 384
           +    +++ S  +D  V  W ++   +
Sbjct: 434 HPTKRYILLSCSDDCQVLYWDLNSTFS 460

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 37/76 (48%), Gaps = 3/76 (3%)

Query: 120 RARFMPQDPNFIAT-INGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELL 178
           R    P D N IAT ++   K+ + D    ++  LV E   HK     + ++P  +  LL
Sbjct: 385 RLEPSPTDANVIATFVSESNKILILDMRNSESPVLVLEG--HKSAINQIKWHPTKRYILL 442

Query: 179 SCSDDGTIALWNVMGT 194
           SCSDD  +  W++  T
Sbjct: 443 SCSDDCQVLYWDLNST 458

>TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {ON}
           Anc_3.25 YNL317W
          Length = 459

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 46/213 (21%), Positives = 88/213 (41%), Gaps = 17/213 (7%)

Query: 172 RTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTL 231
           +   + ++CSDD  + +WN   +N    + ++ H   V  C WH     L  S S+D  +
Sbjct: 180 KNDSKFVTCSDDNILKIWNF--SNGKQERTLSGHHWDVKSCDWHP-EMGLIVSASKDNLI 236

Query: 232 QIHDKRTNSTVHR-LTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSG 290
           ++ D R+   V   L          F     NL AA   D    ++D+R     L  +  
Sbjct: 237 KLWDPRSGQCVSTLLNFKHTVLKTKFQPTKGNLLAAISKDKSCRVFDIRYHMKELTVIRD 296

Query: 291 HEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKS 350
             D +T L + P  + +   +  D  +  +D++Q   E          P+ ++ +A H  
Sbjct: 297 EVDYMT-LLWHPTNESMFTIASYDGAIKHFDILQNLEE----------PQQVIPYA-HDK 344

Query: 351 AVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKL 383
            +   S+N  +  ++AS  +D  +  W  ++ +
Sbjct: 345 CITSLSYN-PVGHILASAAKDRTIRFWTRARPV 376

>TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa]
           {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 106/243 (43%), Gaps = 30/243 (12%)

Query: 151 EALVSEHAFHKDNGY--GLSFNPRTKGELLSCSDDGTIALWNVMGTNTS---PSKAVTTH 205
           E LV        NG+   L+ +      L+S S D T+  W + G +     P ++   H
Sbjct: 4   EVLVLRGTLEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQQYGVPVRSFKGH 63

Query: 206 EDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTL-SSPFNTLDFSKHSQNLF 264
             IV DC           S S DKTL++ +  T  T  R T   S   ++   + + ++ 
Sbjct: 64  NHIVQDCALTADGAYAL-SASWDKTLRLWNVATGETYQRFTGHKSDVMSVAIDRKA-SMI 121

Query: 265 AAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHK-----DGILCSSGSDRRVLL 319
            +   D  + ++ ++   D L T+ GH D V+ +  +P++     +  L S+GSD+ V  
Sbjct: 122 ISGSRDKTIKVWSIK--GDCLATLLGHNDWVSQVRVAPNEKQEDDNVTLISAGSDKMVKA 179

Query: 320 WDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKV 379
           W++ Q   E      AD V        GH + +N  + + +   L+AS  +D  + +W +
Sbjct: 180 WNINQFQIE------ADFV--------GHNNYINSITASPDGS-LVASAGKDGDIMLWNL 224

Query: 380 SKK 382
            +K
Sbjct: 225 KQK 227

>KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} similar
           to uniprot|P40968 Saccharomyces cerevisiae YDR364C CDC40
           Pre-mRNA splicing factor important for catalytic step II
           of pre-mRNA splicing and plays a role in cell cycle
           progression required for DNA synthesis during mitosis
           and meiosis has WD repeats
          Length = 429

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 85/190 (44%), Gaps = 8/190 (4%)

Query: 154 VSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCT 213
           ++E+  HK+    L F P+T   LLS  +D  I LW+         +    H   + D  
Sbjct: 128 IAEYYGHKNGTTSLRFIPKTGHLLLSGGNDNIIKLWDFY-HERELLRTYEGHSMTIKDLN 186

Query: 214 WHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLV 273
           + + N + F S S DK ++I +        RL  +S  N + F    +N      ++S +
Sbjct: 187 FTD-NGHSFASASFDKWVKIWNTEKGIIDKRLRFNSVPNCITFHPKDKNQLVVGLSNSEI 245

Query: 274 YLYDLRNTAD--ALHTMSGHEDSVTSLEFSPHKDG-ILCSSGSDRRVLLWD-LMQIGSEQ 329
             YDLR + +   +     H+ S+ +L++ P  DG  L SS  D+ V +W+  + I  +Q
Sbjct: 246 RHYDLRLSENHGEVQKYDHHQGSILALKYFP--DGKKLISSSEDKTVRIWENRINIPIKQ 303

Query: 330 AQEDAADGVP 339
               A   +P
Sbjct: 304 ISGTAQHSMP 313

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 38/94 (40%), Gaps = 14/94 (14%)

Query: 290 GHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHK 349
           GH++  TSL F P    +L S G+D  + LWD                  EL+  + GH 
Sbjct: 133 GHKNGTTSLRFIPKTGHLLLSGGNDNIIKLWDFYH-------------ERELLRTYEGHS 179

Query: 350 SAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKL 383
             + D +F  N     AS   D  V +W   K +
Sbjct: 180 MTIKDLNFTDN-GHSFASASFDKWVKIWNTEKGI 212

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 34/161 (21%), Positives = 73/161 (45%), Gaps = 8/161 (4%)

Query: 167 LSFNPRTKGELLSCSDDGTIALWNV-MGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSV 225
           ++F+P+ K +L+    +  I  +++ +  N    +    H+  +    +    + L  S 
Sbjct: 226 ITFHPKDKNQLVVGLSNSEIRHYDLRLSENHGEVQKYDHHQGSILALKYFPDGKKLISS- 284

Query: 226 SEDKTLQIHDKRTNSTVHRLTLSSPFNT--LDFSKHSQNLFAAAGTDSLVYLYDL--RNT 281
           SEDKT++I + R N  + +++ ++  +   +D +   Q+ F     D+ +Y Y +  +  
Sbjct: 285 SEDKTVRIWENRINIPIKQISGTAQHSMPWIDINPQGQS-FCTQSMDNTIYTYSMLPKYK 343

Query: 282 ADALHTMSGHEDSVTSLEFSPHKDGILCSSG-SDRRVLLWD 321
                T  GH  +   + F+   DG   +SG S  +  +WD
Sbjct: 344 RHPNKTFKGHNTTGYGIHFAFSPDGQYIASGDSKGQTFIWD 384

>CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247c
          Length = 513

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 54/228 (23%), Positives = 96/228 (42%), Gaps = 38/228 (16%)

Query: 121 ARFMPQDPNFIATINGVGKVFLFDRSKDKNEALVSEH----AFHKDNGYGLSFNPRTKGE 176
            +F  Q PN  A    VG   +  ++ D N +++ E     +FH        +NP     
Sbjct: 202 CKFHKQHPNNKAF---VGLSQIPTKTSDVNPSVLGEFPPITSFH--------WNPVDTNI 250

Query: 177 LLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDK 236
           L+S S D T  +W++  +N   ++ +  H+  V D  +   +  LF S   D ++++ D 
Sbjct: 251 LISSSIDTTCIVWDLQSSNYVKTQLIA-HDSEVFDVRFLTQSTQLFASCGGDGSVRVFDL 309

Query: 237 RT---NSTVHRLTLSSP------------------FNTLDFSKHSQNLFAA-AGTDSLVY 274
           R    ++ ++    S P                     L+ S H  N+ A  A   + + 
Sbjct: 310 RCLAHSTIIYEPPASEPGTGNNSSRSDSTDENSHALLRLEPSPHDPNVLATFAIASNEIL 369

Query: 275 LYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
           + D+RN    L  ++GH  S+  +++ P K   L S   D +VL WD+
Sbjct: 370 ILDMRNPDSPLVVLNGHSASINQIKWHPTKKNTLISCSDDCQVLFWDI 417

>Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W
           (REAL)
          Length = 466

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 52/236 (22%), Positives = 101/236 (42%), Gaps = 19/236 (8%)

Query: 150 NEALVSE-HAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDI 208
           N ++V E  A H ++   ++F+     + ++CSDD  + +WN   +N    + ++ H   
Sbjct: 165 NFSMVKEIDAAHTESIRDMAFS-SNDSKFVTCSDDNILKIWNF--SNGKEERVLSGHHWD 221

Query: 209 VNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHR-LTLSSPFNTLDFSKHSQNLFAAA 267
           V  C WH     L  S S+D  +++ D R+ + +   L          F     NL  A 
Sbjct: 222 VKSCDWHP-EMGLIASASKDNLVKLWDPRSGNCISSILKFKHTVLKTRFQPVKGNLLMAI 280

Query: 268 GTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGS 327
             D    ++D+R +   L  +    D +T LE+ P  + +   +  D  +  +DL+Q  +
Sbjct: 281 SKDKSCRVFDIRYSMKELMCVRDETDYMT-LEWHPINESMFTLACYDGSLKHFDLLQDLN 339

Query: 328 EQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKL 383
           E          P L + +A H   +   S+N  +  + A+  +D  +  W  ++ +
Sbjct: 340 E----------PVLTIPYA-HDKCITSLSYN-PVGHIFATAAKDRTIRFWTRARPV 383

>SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa]
           {ON} similar to uniprot|P38968 Saccharomyces cerevisiae
           YDL195W SEC31 involved in protein transport from
           endoplasmic reticulum to Golgi Component (p150) of COPII
           coat of secretory pathway vesicles
          Length = 1261

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 52/201 (25%), Positives = 87/201 (43%), Gaps = 21/201 (10%)

Query: 138 GKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTS 197
           G V  F   + K+ A +S+H    +    L FN +    L S    G I +W++    +S
Sbjct: 84  GIVEFFSPKELKSVAKISKHTTPVNT---LKFNAKQDNVLCSGDSRGEIFIWDINKITSS 140

Query: 198 ------PSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPF 251
                 P  A+T  +++ +   W++   ++F S        I D +    V  L+ +SP 
Sbjct: 141 GYVPFSPGVAMTPIDEVYS-LAWNQSLAHVFASAGSSGYTSIWDLKAKKEVLHLSYTSPS 199

Query: 252 ----NTLDF----SKHSQNLFAAAGTDS--LVYLYDLRNTADALHTMS-GHEDSVTSLEF 300
               N L        +S  +  A G D+  ++ ++DLRN    L  MS GH   + SL++
Sbjct: 200 TGAKNHLSVVEWHPSNSTKIATATGNDNDPVILVWDLRNAKAPLQAMSQGHSKGILSLDW 259

Query: 301 SPHKDGILCSSGSDRRVLLWD 321
               + +L SSG D    LW+
Sbjct: 260 CKQDENLLLSSGRDNTCALWN 280

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 46/83 (55%), Gaps = 2/83 (2%)

Query: 245 LTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHK 304
           +T S+ FN LD+S  + ++ A A  + +V  +  +    ++  +S H   V +L+F+  +
Sbjct: 59  ITASAKFNDLDWSPDN-SILAGALDNGIVEFFSPKEL-KSVAKISKHTTPVNTLKFNAKQ 116

Query: 305 DGILCSSGSDRRVLLWDLMQIGS 327
           D +LCS  S   + +WD+ +I S
Sbjct: 117 DNVLCSGDSRGEIFIWDINKITS 139

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 59/153 (38%), Gaps = 16/153 (10%)

Query: 181 SDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNS 240
           S + T+ LW+++  +    +   T     ND  W   N  L G++          K   S
Sbjct: 37  SSESTLELWSLLSADVEKPQGSITASAKFNDLDWSPDNSILAGALDNGIVEFFSPKELKS 96

Query: 241 TVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHE-------- 292
                  ++P NTL F+    N+  +  +   ++++D+        T SG+         
Sbjct: 97  VAKISKHTTPVNTLKFNAKQDNVLCSGDSRGEIFIWDINKI-----TSSGYVPFSPGVAM 151

Query: 293 ---DSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
              D V SL ++     +  S+GS     +WDL
Sbjct: 152 TPIDEVYSLAWNQSLAHVFASAGSSGYTSIWDL 184

>ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 RiboSome Assembly 2
          Length = 516

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 62/242 (25%), Positives = 104/242 (42%), Gaps = 37/242 (15%)

Query: 164 GYGLSFNPRTK-GELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDI-------VNDCTWH 215
           GYGL ++P  K G LL+    G I L     T    SK +T  +         V D  W 
Sbjct: 281 GYGLDWSPLIKTGALLTGDCSGQIFL-----TQRHTSKWITDKQPFTAANNQSVEDIQWS 335

Query: 216 EFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQN----LFAAAGTDS 271
                +F +   D  ++I D R  S  H+  +S+  +  D +  S N       A+G D+
Sbjct: 336 PTESTVFATSGTDGYVRIWDTR--SKKHKPAISTRASNTDVNVISWNEKLGYLLASGDDN 393

Query: 272 LVY-LYDLRNTADA-------LHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL- 322
             + ++DLR  + A       +     H   +TS+ F+P  D ++  +  D  V LWDL 
Sbjct: 394 GSWGVWDLRQFSPANSEGVQPVAQYDFHRGPITSISFNPLDDSVVAVASEDNTVTLWDLS 453

Query: 323 MQIGSEQAQEDAADG------VPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHV 376
           ++   ++ Q+   +        P+L+ +H   +  V D  ++  IP  + S   D + +V
Sbjct: 454 VEADDDEIQQQTKEYKELQKIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NV 510

Query: 377 WK 378
           WK
Sbjct: 511 WK 512

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 62/130 (47%), Gaps = 11/130 (8%)

Query: 254 LDFSKHSQNLFAAAGTDSLVYLYDLRNTA--DALHTMSGHEDSVTSLEFSPHKDGILCSS 311
           + +S     +FA +GTD  V ++D R+     A+ T + + D V  + ++  K G L +S
Sbjct: 332 IQWSPTESTVFATSGTDGYVRIWDTRSKKHKPAISTRASNTD-VNVISWN-EKLGYLLAS 389

Query: 312 GSDRRVL-LWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEE 370
           G D     +WDL Q     ++     GV + +  +  H+  +   SFN     ++A   E
Sbjct: 390 GDDNGSWGVWDLRQFSPANSE-----GV-QPVAQYDFHRGPITSISFNPLDDSVVAVASE 443

Query: 371 DNIVHVWKVS 380
           DN V +W +S
Sbjct: 444 DNTVTLWDLS 453

 Score = 30.8 bits (68), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 28/56 (50%)

Query: 136 GVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNV 191
           GV  +  F  +  +    V+++ FH+     +SFNP     +   S+D T+ LW++
Sbjct: 397 GVWDLRQFSPANSEGVQPVAQYDFHRGPITSISFNPLDDSVVAVASEDNTVTLWDL 452

>NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {ON}
           Anc_5.201 YLL011W
          Length = 479

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 72/187 (38%), Gaps = 52/187 (27%)

Query: 177 LLSCSDDGTIALWNVMGT-----------NTSPSKAVTTHEDIV---------------- 209
           +LSCSDD T+ LW+V              NT+     T + DI                 
Sbjct: 132 MLSCSDDKTVKLWSVNSEDYVNLKDDEQLNTTSGLLKTFYSDIAFQGIDHHRSNSNFVTG 191

Query: 210 ----------------------NDCTWHEFNEN---LFGSVSEDKTLQIHDKRTNSTVHR 244
                                 ++ T  +FN+N   +F S   D ++ ++D RTNS   +
Sbjct: 192 GAQIQLWDSNRSTPLSNLSWGADNITTVKFNQNETDIFASAGSDNSIVLYDLRTNSPTQK 251

Query: 245 LTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHK 304
           +  +   N + ++      F     D   Y YD+RN + A++    H  +V  ++FSP  
Sbjct: 252 IVQTMRTNAICWNPMEAFNFVIGNEDHNAYYYDMRNMSRAINVFKDHVSAVMDVDFSPTG 311

Query: 305 DGILCSS 311
           D I+  S
Sbjct: 312 DEIVTGS 318

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 57/214 (26%), Positives = 97/214 (45%), Gaps = 39/214 (18%)

Query: 143 FDRSKDKNEALVS---EHAF-----------HKDNGYGLSFNPRTKGELLSCSDDGTIAL 188
           F+R+++  +AL +   E  F           H+D  Y ++ N R   +L + S DG I  
Sbjct: 35  FERAREYTKALTATKMERMFAKPFVGQLGYGHRDGVYVIAKNYRNLNKLATGSADGVIKY 94

Query: 189 WNVMGTNTSPSKAVTTHEDIVNDCTWHEF-----NENLFGSVSEDKTLQI---------- 233
           WN M T          +  I   C   E      N+N   S S+DKT+++          
Sbjct: 95  WN-MSTRDEVCSFKAHYGLITGLCVTPEHLSKNKNDNFMLSCSDDKTVKLWSVNSEDYVN 153

Query: 234 --HDKRTNSTVHRL-TLSS--PFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTM 288
              D++ N+T   L T  S   F  +D  + + N F   G  + + L+D  N +  L  +
Sbjct: 154 LKDDEQLNTTSGLLKTFYSDIAFQGIDHHRSNSN-FVTGG--AQIQLWD-SNRSTPLSNL 209

Query: 289 SGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
           S   D++T+++F+ ++  I  S+GSD  ++L+DL
Sbjct: 210 SWGADNITTVKFNQNETDIFASAGSDNSIVLYDL 243

>CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131c Ribosome assembly protein
          Length = 513

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 90/409 (22%), Positives = 161/409 (39%), Gaps = 72/409 (17%)

Query: 24  PLMYDFVSETKLTWPSLTIQWLPGNSSSTKQE------MILGTHTSGEDDNYLKIASIE- 76
           P +Y+ +    + WP L++  +P    S ++       M   T  S + +N L + S+  
Sbjct: 119 PTVYEMLHNVNMPWPCLSLDIIPDTLGSERRNYPQSILMTTATQASKKKENELMVLSLSN 178

Query: 77  ----LPEDILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMPQDPNFI- 131
               L +D                 +  N+  R               + F  Q    + 
Sbjct: 179 LTKTLLKDEEEEEEEEDDDDVEPIIENENIALRDTTNRIKV-------SPFASQSQEVLT 231

Query: 132 ATINGVGKVFLFD--------RSKDKNEALVSEHAFH------KDNGYGLSFNPRTK-GE 176
           AT++  G+V++FD         S        S+   H         GYGL ++P  K G 
Sbjct: 232 ATMSENGEVYIFDIGAQAKCFNSPGYQIPKQSKRPVHTIRNHGNVEGYGLDWSPLIKSGA 291

Query: 177 LLSCSDDGTIALWNVMGTNTSPSKAVTTHEDI-------VNDCTWHEFNENLFGSVSEDK 229
           LLS    G I L     T    SK VT  +         + D  W +    +F +   D 
Sbjct: 292 LLSGDCSGQIYL-----TQRHTSKWVTDKQAYSVGNNKSIEDIQWSKTESTVFATAGCDG 346

Query: 230 TLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQN----LFAAAGTDSLVY-LYDLR----- 279
            +++ D R  S  H+  +S   +  D +  S N       A+G D+  + ++DLR     
Sbjct: 347 YIRVWDTR--SKKHKPAISVKASNTDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFTPD 404

Query: 280 NTAD--ALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL--------MQIGSEQ 329
           N A+   +   + H+ ++TS+ F+P ++ I+     D  V LWDL        ++  +E+
Sbjct: 405 NAANIQPVAQYNFHKGAITSIAFNPLEESIVAVGSEDNTVTLWDLSVEADDEEIKQQTEE 464

Query: 330 AQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWK 378
            +E   +  P+L+ +H   +  + D  ++  IP  + S   D + ++WK
Sbjct: 465 TKE-LKEIPPQLLFVH--WQKEIKDVKWHKQIPGCLVSTGTDGL-NIWK 509

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 63/130 (48%), Gaps = 11/130 (8%)

Query: 254 LDFSKHSQNLFAAAGTDSLVYLYDLRNTA--DALHTMSGHEDSVTSLEFSPHKDGILCSS 311
           + +SK    +FA AG D  + ++D R+     A+   + + D V  + ++  K G L +S
Sbjct: 329 IQWSKTESTVFATAGCDGYIRVWDTRSKKHKPAISVKASNTD-VNVISWN-EKIGYLLAS 386

Query: 312 GSDRRVL-LWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEE 370
           G D     +WDL Q       ++AA+  P  +  +  HK A+   +FN     ++A   E
Sbjct: 387 GDDNGSWGVWDLRQF----TPDNAANIQP--VAQYNFHKGAITSIAFNPLEESIVAVGSE 440

Query: 371 DNIVHVWKVS 380
           DN V +W +S
Sbjct: 441 DNTVTLWDLS 450

>ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} similar
           to uniprot|Q12523 Saccharomyces cerevisiae YPL247C
           Hypothetical ORF
          Length = 506

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 74/179 (41%), Gaps = 26/179 (14%)

Query: 169 FNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSED 228
           +NP     L+S S D T  +W++  +N   ++ +  H+  V D  +      LF S   D
Sbjct: 251 WNPVDPNLLISSSIDTTCIVWDLQSSNYVRTQLIA-HDSEVYDVRFLTQTTQLFSSCGGD 309

Query: 229 KTLQIHDKRT--NSTVHRLTLSSPFN----------------------TLDFSKHSQNLF 264
            ++++ D R   +ST+     SSP                         L+ S    N+ 
Sbjct: 310 GSVRVFDLRCLAHSTIIYEPPSSPATLQPTTAAGSSSAADSDTGVPLLRLEPSPFDPNVI 369

Query: 265 AAAGTDS-LVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
           A    DS  V + D+RN    +  + GH  +V  + + P K  +L S   D +VL WDL
Sbjct: 370 ATFAIDSPRVLILDMRNPGSPVLVLEGHSAAVNQMRWHPSKRNVLLSCADDCQVLYWDL 428

 Score = 34.3 bits (77), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 41/89 (46%), Gaps = 9/89 (10%)

Query: 125 PQDPNFIATIN-GVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDD 183
           P DPN IAT      +V + D     +  LV E   H      + ++P  +  LLSC+DD
Sbjct: 363 PFDPNVIATFAIDSPRVLILDMRNPGSPVLVLEG--HSAAVNQMRWHPSKRNVLLSCADD 420

Query: 184 GTIALWN----VMG--TNTSPSKAVTTHE 206
             +  W+    +MG  T+  P  AV + +
Sbjct: 421 CQVLYWDLNNYIMGHPTDQDPDHAVDSQQ 449

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 44/205 (21%), Positives = 77/205 (37%), Gaps = 38/205 (18%)

Query: 214 WHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLD--FSKHSQNLFAAAGTDS 271
           W+  + NL  S S D T  + D ++++ V    ++      D  F   +  LF++ G D 
Sbjct: 251 WNPVDPNLLISSSIDTTCIVWDLQSSNYVRTQLIAHDSEVYDVRFLTQTTQLFSSCGGDG 310

Query: 272 LVYLYDLRNTADALHTMSGHEDSVT----------------------SLEFSPHKDGILC 309
            V ++DLR  A +           T                       LE SP    ++ 
Sbjct: 311 SVRVFDLRCLAHSTIIYEPPSSPATLQPTTAAGSSSAADSDTGVPLLRLEPSPFDPNVIA 370

Query: 310 SSGSDR-RVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASV 368
           +   D  RVL+ D+   GS              +++  GH +AVN   ++ +   ++ S 
Sbjct: 371 TFAIDSPRVLILDMRNPGSP-------------VLVLEGHSAAVNQMRWHPSKRNVLLSC 417

Query: 369 EEDNIVHVWKVSKKLTSPGLIQDYD 393
            +D  V  W ++  +      QD D
Sbjct: 418 ADDCQVLYWDLNNYIMGHPTDQDPD 442

>KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1321

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 84/212 (39%), Gaps = 27/212 (12%)

Query: 129 NFIATINGVGKVFLFD--RSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTI 186
           N++A       V LFD  R+   + ALVS  A H  +     FN      L+S   DG +
Sbjct: 205 NYVAVCTNSTTVSLFDINRANQTDSALVSSLAEHTRSVNSFDFNMMQTNLLISGGQDGCV 264

Query: 187 ALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLT 246
            +W++   N  P+K V T +  +N           FGS+ + K +  ++   N       
Sbjct: 265 KIWDIRTNN--PTKIVNTCDVRIN---------TTFGSIRDIKWMPGYNFSGNDR----- 308

Query: 247 LSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDG 306
                N  D   H    FA+      +  +D+R        ++ H      L + PH+D 
Sbjct: 309 -----NYTDLRSHGGYKFASIHDSGALLKFDMRQPNQPEKRINAHTGPGLCLNWHPHQDY 363

Query: 307 ILCSSGSDRRVLLW---DLMQIGSEQAQEDAA 335
           I  S G D +  LW   D M+  +   Q ++A
Sbjct: 364 I-ASGGRDGKCCLWYFGDRMEQSATNLQANSA 394

>KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5.201
           YLL011W
          Length = 480

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 48/99 (48%), Gaps = 3/99 (3%)

Query: 216 EFNEN---LFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSL 272
           +FN+N   +  S   D  + ++D RTNS   ++  +   N + ++      F  A  D  
Sbjct: 219 KFNQNEVDILASTGSDNAIVLYDLRTNSPTQKIIQTMRTNAICWNPMEAFNFVIANEDHN 278

Query: 273 VYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSS 311
            Y YD+RN + ALH    H  +V  ++FSP  D I+  S
Sbjct: 279 AYYYDMRNMSRALHVFKDHVSAVMDVDFSPTGDEIVTGS 317

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 77/180 (42%), Gaps = 20/180 (11%)

Query: 160 HKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEF-- 217
           H+D  Y ++ N     +L S S DG I  WN M T          +  +   C   E   
Sbjct: 66  HRDGVYTIAKNYNNLNKLASGSADGIIKYWN-MSTREEFVSFKAHYGLVTGLCVTPEHTS 124

Query: 218 ---NENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTD---- 270
              NEN   S  +DKT+++     N     +   +  NT    K      A  G D    
Sbjct: 125 KNKNENFMLSCGDDKTVKLWSV-NNDDFSNVKSDAELNTEGLLKTFYGEHAFQGIDHHRE 183

Query: 271 --------SLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
                   + ++L+D  N +  +  +S   D++TS++F+ ++  IL S+GSD  ++L+DL
Sbjct: 184 ASTFVTGGAQIHLWD-SNRSKPISNLSWGADNITSVKFNQNEVDILASTGSDNAIVLYDL 242

>Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}
           YPL247C (REAL)
          Length = 526

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 79/190 (41%), Gaps = 28/190 (14%)

Query: 177 LLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDK 236
           ++S S D T  +W++  ++   ++ +  H+  V D  +   +  LF S   D ++++ D 
Sbjct: 259 IISSSIDTTCIVWDLQSSHYVKTQLIA-HDSEVFDVRFLTKSTQLFASCGGDGSVRVFDL 317

Query: 237 RT----------------------NSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDS-LV 273
           R+                       +T      S     L+ S +  N+ A    DS  +
Sbjct: 318 RSLAHSTIIYEPPSSSSSSSAPAAGTTTPSSDGSYALLRLEPSPYDPNVLATFAADSNKI 377

Query: 274 YLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL----MQIGSEQ 329
            + D+RN    + T+ GH  SV  +++ P K  +L S   D +VL WDL    M+I    
Sbjct: 378 IILDMRNPESPILTLEGHSSSVNEIKWHPTKRNVLLSCSDDCQVLYWDLNNSFMEINGGS 437

Query: 330 AQEDAADGVP 339
            +   A G P
Sbjct: 438 VKSPGASGTP 447

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 43/101 (42%), Gaps = 11/101 (10%)

Query: 120 RARFMPQDPNFIATING-VGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELL 178
           R    P DPN +AT      K+ + D    ++  L  E   H  +   + ++P  +  LL
Sbjct: 356 RLEPSPYDPNVLATFAADSNKIIILDMRNPESPILTLEG--HSSSVNEIKWHPTKRNVLL 413

Query: 179 SCSDDGTIALWNVM--------GTNTSPSKAVTTHEDIVND 211
           SCSDD  +  W++         G+  SP  + T  ED   D
Sbjct: 414 SCSDDCQVLYWDLNNSFMEINGGSVKSPGASGTPLEDTDGD 454

>AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR142C (PEX7)
          Length = 370

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 72/295 (24%), Positives = 111/295 (37%), Gaps = 49/295 (16%)

Query: 129 NFIATINGVGKVFLFDRSKDKNE-ALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIA 187
           N +    G G + LFD +  +   AL  EH   +   +  ++N   K   +S S DGT+ 
Sbjct: 74  NQVLAAQGDGSLRLFDITLQQYPIALFQEH---QREVFSCNWNLLHKDTFVSSSWDGTVK 130

Query: 188 LW------------------NVM---GTNTSPSKAVTTHEDIVN--DCTWHE----FNEN 220
           +W                  +VM   G    P      H+D  +  DC +       + N
Sbjct: 131 VWTPARPQSMLTLLPAPANRSVMVEPGARGLPLSNQQQHKDAADNKDCIYQAQFSPHDPN 190

Query: 221 LFGSVSEDKTLQIHDKR--TNSTVHRLTLSSPFNTL--DFSKHSQNLFAAAGTDSLVYLY 276
           L  S S +  + + D R    S   R    S    L  DF+K+  ++ A  G D +V ++
Sbjct: 191 LVMSCSGNSYVSLFDLRQPAASNQQRFIAHSGLEALSCDFNKYRPHVIATGGVDKMVKVW 250

Query: 277 DLRNTADALHT----------MSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLW-DLMQI 325
           DLR     L T          M GH  +V  + +SPH   IL S+  D     W DL   
Sbjct: 251 DLRMVRQTLTTSRTAPVSINEMQGHSLAVRKVVWSPHHSNILLSTSYDMTCRAWHDLADG 310

Query: 326 GSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNI---PWLMASVEEDNIVHVW 377
              Q      +  P+    +   K +   F  +W++   P  +A+   D  V  W
Sbjct: 311 PGGQHSGRTNNSDPQRGCSYVFSKHSEFVFGADWSLWGQPGYVATTGWDGQVCAW 365

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 55/243 (22%), Positives = 109/243 (44%), Gaps = 29/243 (11%)

Query: 136 GVGKVFLFDRSKDKNEALVSEHAF-HKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGT 194
           G G++F+ D +      +V  ++F  KD  + +++N   + ++L+   DG++ L+++   
Sbjct: 36  GNGRLFIMDLTAQGT--MVESNSFLTKDGLFDVAWNELHENQVLAAQGDGSLRLFDIT-L 92

Query: 195 NTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTL 254
              P      H+  V  C W+  +++ F S S D T+++       ++  L L +P N  
Sbjct: 93  QQYPIALFQEHQREVFSCNWNLLHKDTFVSSSWDGTVKVWTPARPQSMLTL-LPAPAN-- 149

Query: 255 DFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSD 314
                 +++    G   L  L + +   DA    + ++D +   +FSPH   ++ S   +
Sbjct: 150 ------RSVMVEPGARGLP-LSNQQQHKDA----ADNKDCIYQAQFSPHDPNLVMSCSGN 198

Query: 315 RRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIV 374
             V L+DL Q  +   Q           + H+G ++   D  FN   P ++A+   D +V
Sbjct: 199 SYVSLFDLRQPAASNQQR---------FIAHSGLEALSCD--FNKYRPHVIATGGVDKMV 247

Query: 375 HVW 377
            VW
Sbjct: 248 KVW 250

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 65/170 (38%), Gaps = 31/170 (18%)

Query: 120 RARFMPQDPNFIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNG---YGLSFNPRTKGE 176
           +A+F P DPN + + +G   V LFD    +  A  ++  F   +G       FN      
Sbjct: 181 QAQFSPHDPNLVMSCSGNSYVSLFDL---RQPAASNQQRFIAHSGLEALSCDFNKYRPHV 237

Query: 177 LLSCSDDGTIALWNVMGTNTSPSKAVTT---------HEDIVNDCTWHEFNENLFGSVSE 227
           + +   D  + +W++     + + + T          H   V    W   + N+  S S 
Sbjct: 238 IATGGVDKMVKVWDLRMVRQTLTTSRTAPVSINEMQGHSLAVRKVVWSPHHSNILLSTSY 297

Query: 228 DKTLQI-----------HDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAA 266
           D T +            H  RTN++  +   S       FSKHS+ +F A
Sbjct: 298 DMTCRAWHDLADGPGGQHSGRTNNSDPQRGCS-----YVFSKHSEFVFGA 342

>Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {ON}
           complement(56019..57566) [1548 nt, 516 aa]
          Length = 515

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 83/406 (20%), Positives = 156/406 (38%), Gaps = 65/406 (16%)

Query: 24  PLMYDFVSETKLTWPSLTIQWLPGNSSSTKQE------MILGTHTSGEDDNYLKIASI-E 76
           P +Y+ +    L WP +T+  +P    S ++       M   T  + + DN L +  + +
Sbjct: 120 PTVYEMLHNVNLPWPCMTLDIIPDTYGSERRNYPQSILMTTATQAAKKKDNELMVLKLSQ 179

Query: 77  LPEDILGAXXXXXXXXXXXXXQQRNVQSRXXXXXXXXXXXXXXRARFMP----QDPNFIA 132
           L + ++               +   +                 R R  P          A
Sbjct: 180 LSKTLVKENEEEEEDEDNSDNESDPI----LEDENVPLKDTTNRLRVSPFASSGQEVLTA 235

Query: 133 TINGVGKVFLFD-----RSKDKNEALVSEHAFHKDN---------GYGLSFNPRTK-GEL 177
           T++  G+V++FD     R+ D     + + A    +         GY L ++P  + G L
Sbjct: 236 TMSENGEVYIFDIAPQSRAFDTPGYQIPKTAKRPIHTIRNHGNVEGYALDWSPLIRSGAL 295

Query: 178 LSCSDDGTIALWNVMGTNTSPSKAVTTHEDI-------VNDCTWHEFNENLFGSVSEDKT 230
           L+    G +       T    SK VT  +         + D  W      +F +   D  
Sbjct: 296 LTGDCSGQVYF-----TQRHTSKWVTDKQPFTVSNNKSIEDIQWSRTEATVFATAGCDGY 350

Query: 231 LQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQN----LFAAAGTDSLVY-LYDLRN----- 280
           +++ D R  S  H+  +S+  +  D +  S N       A+G D+  + ++DLR      
Sbjct: 351 IRVWDTR--SKKHKPAISTKASNTDVNVISWNEKMGYLLASGDDNGTWGVWDLRQFSPSN 408

Query: 281 -TADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL-MQIGSEQAQEDAADG- 337
             A  +     H+ ++TS+ F P  + I+  +  D  V LWDL ++   E+ ++  A+  
Sbjct: 409 ENAQPVAQYDFHKGAITSISFHPTDESIVAVASEDNTVTLWDLSVEADDEEIKQQTAETK 468

Query: 338 -----VPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWK 378
                 P+L+ +H   +  V D  ++  IP  + S   D + ++WK
Sbjct: 469 ELAQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NIWK 511

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 63/130 (48%), Gaps = 12/130 (9%)

Query: 254 LDFSKHSQNLFAAAGTDSLVYLYDLRNTA--DALHTMSGHEDSVTSLEFSPHKDGILCSS 311
           + +S+    +FA AG D  + ++D R+     A+ T + + D V  + ++  K G L +S
Sbjct: 332 IQWSRTEATVFATAGCDGYIRVWDTRSKKHKPAISTKASNTD-VNVISWN-EKMGYLLAS 389

Query: 312 GSDRRVL-LWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEE 370
           G D     +WDL Q     + E+A     + +  +  HK A+   SF+     ++A   E
Sbjct: 390 GDDNGTWGVWDLRQFSP--SNENA-----QPVAQYDFHKGAITSISFHPTDESIVAVASE 442

Query: 371 DNIVHVWKVS 380
           DN V +W +S
Sbjct: 443 DNTVTLWDLS 452

>Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]
           {ON} YNL317W (PFS2) - Polyadenylation Factor I subunit
           [contig 124] FULL
          Length = 451

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/217 (21%), Positives = 87/217 (40%), Gaps = 14/217 (6%)

Query: 166 GLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSV 225
           G+SF+  T  + ++CSDD  + +WN   +N      ++ H   V  C WH     L  S 
Sbjct: 172 GISFS-GTDSKFVTCSDDNILKIWNF--SNGQQESTLSGHHWDVRSCDWHP-TMGLIASG 227

Query: 226 SEDKTLQIHDKRTNSTVHR-LTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADA 284
           S+D  +++ D R    +   L       +  F     N+ A    D    ++D+R     
Sbjct: 228 SKDNLVKLWDPRAGQCISTILGCKHTIISTKFQPTKGNMLAVISKDKSCRIFDIRQNMKE 287

Query: 285 LHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMM 344
           L       D + SL + P  + +      D  +  +DL+     Q  +D++ G      +
Sbjct: 288 LAVYRDESDYM-SLTWHPINESMFTVGCYDGSMKHFDLL-----QEPQDSSSGC--FHNI 339

Query: 345 HAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSK 381
              H   +   ++N  +  ++AS  +D  +  W  ++
Sbjct: 340 PYAHDKCITSLAYN-PVGHILASASKDRTIRFWTRAR 375

>TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 87/201 (43%), Gaps = 19/201 (9%)

Query: 173 TKGELLSCS-DDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTL 231
           + G+LL+   +DG + L+ V          +  HE  V  C +H F   +  S S D T 
Sbjct: 231 SSGDLLATGGEDGLVKLFTVQSGELRQVADLQGHERRVAGCRFHPFGRYI-ASASFDNTW 289

Query: 232 QIHDKRTNSTVHRLTLSSPFNTLDFSKHSQ---NLFAAAGTDSLVYLYDLRNTADALHTM 288
           ++ D  TN   H L L        F    Q   +L  +AG D    ++D+R+   A+  +
Sbjct: 290 RLWDAETN---HELLLQEGHGKEVFCLAFQSDGSLLCSAGLDCTGMIWDIRSGNCAM-VL 345

Query: 289 SGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQ---AQEDAADGVP-----E 340
           SGH   + S+++SP    +  +SG D  V +WD+ +    Q   A      G+       
Sbjct: 346 SGHTKPIYSVDWSPRGFEVATASG-DGTVNIWDIRKTNQPQVLLAHNSIVSGIRFEKHNG 404

Query: 341 LMMMHAGHKSAVNDFSFN-WN 360
             +M  G+   +N +S + WN
Sbjct: 405 KFLMSCGYDKNINVYSGDSWN 425

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 76/165 (46%), Gaps = 9/165 (5%)

Query: 160 HKDNGYGLSFNPRTKGELL-SCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFN 218
           H    + L+F  ++ G LL S   D T  +W++   N +    ++ H   +    W    
Sbjct: 306 HGKEVFCLAF--QSDGSLLCSAGLDCTGMIWDIRSGNCA--MVLSGHTKPIYSVDWSPRG 361

Query: 219 ENLFGSVSEDKTLQIHD-KRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYD 277
             +  + S D T+ I D ++TN     L  +S  + + F KH+     + G D  + +Y 
Sbjct: 362 FEV-ATASGDGTVNIWDIRKTNQPQVLLAHNSIVSGIRFEKHNGKFLMSCGYDKNINVYS 420

Query: 278 LRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
             ++ + +  + GH D + +L+   H DG + S+G DR V  W++
Sbjct: 421 -GDSWNKITILKGHTDKILALDLGTH-DGSVVSAGWDRSVKSWNV 463

>NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325
          Length = 917

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 53/214 (24%), Positives = 99/214 (46%), Gaps = 24/214 (11%)

Query: 124 MPQDPNFIATINGVGKVFLFDRSKD--------KNEALVSEHAFHKDNGYGLSFNPRTKG 175
           M Q+P    T+N  G+   F  SK         ++E+ + +   H D+   L+++P    
Sbjct: 296 MGQNPVNTVTVNSTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNSLTYSP-DGS 354

Query: 176 ELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHE-----FNENLFGSVSEDKT 230
            +++ +DDG I +W+V+      +   T H   V    + +     F+ +L G+V     
Sbjct: 355 RVVTAADDGKIKVWDVVSGFCLAT--FTEHTSSVTQVQFAKKGQVLFSSSLDGTVRAWDL 412

Query: 231 LQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSL-VYLYDLRNTADALHTMS 289
           ++  + RT +   R+     FN L     S  +  A   DS  ++++ ++ T   L T+S
Sbjct: 413 IRYRNFRTFTAAERI----QFNCLAVDP-SGEVVCAGSIDSFDIHVWSVQ-TGQLLDTLS 466

Query: 290 GHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLM 323
           GHE  V+ L FS  ++ +L S+  D+ V +W + 
Sbjct: 467 GHEGPVSCLSFS-QENSVLASASWDKTVRIWSIF 499

>KNAG0A03080 Chr1 complement(380346..381686) [1341 bp, 446 aa] {ON} 
          Length = 446

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 91/212 (42%), Gaps = 44/212 (20%)

Query: 217 FNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFN----TLDFSKHSQNLFAAAGTDSL 272
           F+   FGS S+D T++  D RT +     +LS P N      D S+ +  LF    +  +
Sbjct: 241 FDNYTFGSCSDDNTIRFWDIRT-ADKPIFSLSEPKNGKLTAFDASQITNELFVTGTSTGV 299

Query: 273 VYLYDLRN----TADALHTMSGHE--------------DSVTSLEFSPHKDGILCSSGSD 314
           + L+D+R+    T D  H  +GH+              DSV  ++FSP       + G  
Sbjct: 300 IKLWDIRSVEFATTDLTHRQNGHDPIQTELVNLYHSGGDSVADVQFSPTSSSEFATVGGS 359

Query: 315 RRVLLWDLMQIGSEQAQEDAADG----VPE------LMMMHAGH----KSAVNDFSFNWN 360
             V  WD+    S+   +DA        PE      L   H G+    ++  N  +++  
Sbjct: 360 GNVYHWDMEFFFSQNDDDDAGATAKLPAPEELQGQCLKFFHIGNNQQKRNVKNSVAWHPT 419

Query: 361 IPWLMASVEEDNIVHVWKVSKKLTSPGLIQDY 392
           I  L+ +V++ +++ V+K       P  I+DY
Sbjct: 420 IDDLVCTVDDTSLISVYK-------PFPIRDY 444

>Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 86/186 (46%), Gaps = 28/186 (15%)

Query: 225 VSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADA 284
           VS+ + L+I   +T   V  L +SSP   LD +  +  L A  GTD  + + D+ N    
Sbjct: 79  VSQAQLLKIFQLKTGRIVRSLKISSPSYILD-TDPTSTLLAVGGTDGSIVIVDIEN-GYI 136

Query: 285 LHTMSGHEDSVTSLEFSPHKDG---ILCSSGSDRRVLLWDLMQ--------------IGS 327
            H++ GH  +++SL+F    D    +L S  ++  V +WDL++               G 
Sbjct: 137 THSLKGHGGTISSLKFYGQLDSETWLLASGDTNGMVKVWDLVKRKCLLTLQEHSSAVRGL 196

Query: 328 EQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKLTSPG 387
           +  + ++ DG   L ++  G    VN + F+          ++  +V    V++++ S G
Sbjct: 197 DIIEGESGDG-SSLKLLSGGRDDIVNVWDFDMK--------KKCKLVKTLPVNQQVESCG 247

Query: 388 LIQDYD 393
            ++++D
Sbjct: 248 FLKNHD 253

>Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa]
           {ON} YDL195W (SEC31) - Component (p150) of COPII coat of
           secretory pathway vesicles [contig 161] FULL
          Length = 1296

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 52/201 (25%), Positives = 88/201 (43%), Gaps = 21/201 (10%)

Query: 138 GKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTS 197
           G V  F  S+ K+ A +++H+        + FN +    L S    G I +W+     T 
Sbjct: 84  GVVEFFSPSEYKSIAKLAQHSTPVKT---VRFNAKQHNVLCSGGSKGEIYIWDANKIETP 140

Query: 198 ------PSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTV----HRLTL 247
                 P  A+T  ++I +   W++   ++F S        I D +    V    H  ++
Sbjct: 141 GYAPFVPGTAMTPMDEIYS-LAWNQNQGHVFASAGSSGFASIWDLKAKKEVIHLSHTSSI 199

Query: 248 SSPFNTLDF----SKHSQNLFAAAGTDS--LVYLYDLRNTADALHTMS-GHEDSVTSLEF 300
           +   N L        +S  +  A+G+DS   + ++DLRN    L T+S GH   V SL++
Sbjct: 200 TGQKNQLSIVEWHPNNSTRIATASGSDSDPSILVWDLRNANVPLQTLSQGHTKGVLSLDW 259

Query: 301 SPHKDGILCSSGSDRRVLLWD 321
               + +L SSG D   +LW+
Sbjct: 260 CKQDETLLLSSGRDNSCVLWN 280

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 29/149 (19%), Positives = 66/149 (44%), Gaps = 8/149 (5%)

Query: 181 SDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNS 240
           S D T+ +W+++  + +  +   + +   ND  W   N  L G++ ++  ++        
Sbjct: 37  SSDSTLEIWSLLSPHEATPQGSVSADAKFNDLDWSYDNSVLTGAL-DNGVVEFFSPSEYK 95

Query: 241 TVHRLTL-SSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALH------TMSGHED 293
           ++ +L   S+P  T+ F+    N+  + G+   +Y++D        +      T     D
Sbjct: 96  SIAKLAQHSTPVKTVRFNAKQHNVLCSGGSKGEIYIWDANKIETPGYAPFVPGTAMTPMD 155

Query: 294 SVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
            + SL ++ ++  +  S+GS     +WDL
Sbjct: 156 EIYSLAWNQNQGHVFASAGSSGFASIWDL 184

 Score = 33.9 bits (76), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 49/106 (46%), Gaps = 11/106 (10%)

Query: 226 SEDKTLQI------HDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLR 279
           S D TL+I      H+     +V   +  + FN LD+S  +  L  A   D+ V  +   
Sbjct: 37  SSDSTLEIWSLLSPHEATPQGSV---SADAKFNDLDWSYDNSVLTGA--LDNGVVEFFSP 91

Query: 280 NTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQI 325
           +   ++  ++ H   V ++ F+  +  +LCS GS   + +WD  +I
Sbjct: 92  SEYKSIAKLAQHSTPVKTVRFNAKQHNVLCSGGSKGEIYIWDANKI 137

>KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {ON}
           Anc_5.201 YLL011W
          Length = 485

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 78/188 (41%), Gaps = 19/188 (10%)

Query: 124 MPQDPNFIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDD 183
           +  D   I   NG G +          +    EHAF      G+  +   + + L  +  
Sbjct: 156 IKSDEELITKTNGSGALL---------KTFYGEHAFQ-----GIDHH---REKPLFVTGG 198

Query: 184 GTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVH 243
             I LW+     ++P   ++   D +    +++   ++  S   D ++ ++D RTNS   
Sbjct: 199 AKIELWD--NNRSTPLTNLSWGADNITSLKFNQSETDIVASAGSDNSVVLYDLRTNSPTQ 256

Query: 244 RLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPH 303
           ++  S   N + ++      F  A  D   Y YD+RN + +L+    H  +V  ++FSP 
Sbjct: 257 KIVQSMRTNAICWNPMEPFNFVVANEDHNAYYYDMRNMSRSLNVFKDHVSAVMDVDFSPT 316

Query: 304 KDGILCSS 311
            D I+  S
Sbjct: 317 GDEIVTGS 324

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 64/146 (43%), Gaps = 30/146 (20%)

Query: 177 LLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDK 236
           +LSC DD TI LW++                          N + F ++  D+ L     
Sbjct: 134 MLSCGDDKTIKLWSI--------------------------NNDDFANIKSDEELITKTN 167

Query: 237 RTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVT 296
            + + +        F  +D  +  + LF   G  + + L+D  N +  L  +S   D++T
Sbjct: 168 GSGALLKTFYGEHAFQGIDHHR-EKPLFVTGG--AKIELWD-NNRSTPLTNLSWGADNIT 223

Query: 297 SLEFSPHKDGILCSSGSDRRVLLWDL 322
           SL+F+  +  I+ S+GSD  V+L+DL
Sbjct: 224 SLKFNQSETDIVASAGSDNSVVLYDL 249

>TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {ON}
           Anc_7.310 YDL195W
          Length = 1300

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/215 (23%), Positives = 97/215 (45%), Gaps = 21/215 (9%)

Query: 127 DPNFIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTI 186
           D  +IA     G V LF  +       + + + H  +   ++FN + +  L S S +G I
Sbjct: 73  DNKYIAGALDNGMVELFKTNSKDTLKSIKKLSKHGTSVTTVNFNAKQENVLASGSKNGEI 132

Query: 187 ALWNVMG---------TNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKR 237
            +W++           +  +P  A+T  E+I +   W++   ++F S        I D +
Sbjct: 133 FIWDLNKCIDQSNDSYSPLTPGMAMTPVEEITS-LAWNQSLSHVFASAGNTSYASIWDLK 191

Query: 238 TNSTVHRLTLSSPFNTLD--------FSKHSQNLFAAAGTDS--LVYLYDLRNTADALHT 287
               V  L+ +SP ++L           ++S  +  A+ +D+  ++ ++DLRN    L  
Sbjct: 192 AKKEVIHLSYTSPSSSLKPQLSVVEWHPENSTRVATASNSDNEPIILIWDLRNANTPLQI 251

Query: 288 M-SGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWD 321
           + +G+   + SL++  H   +L SSG D   +LW+
Sbjct: 252 LENGNSKGILSLDWCKHDSNLLLSSGRDNTAVLWN 286

 Score = 38.5 bits (88), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 28/134 (20%), Positives = 65/134 (48%), Gaps = 7/134 (5%)

Query: 251 FNTLDFSKHSQNLFAAAGTDSLVYLY--DLRNTADALHTMSGHEDSVTSLEFSPHKDGIL 308
           FN +D+S  ++   A A  + +V L+  + ++T  ++  +S H  SVT++ F+  ++ +L
Sbjct: 65  FNDIDWSIDNK-YIAGALDNGMVELFKTNSKDTLKSIKKLSKHGTSVTTVNFNAKQENVL 123

Query: 309 CSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASV 368
            S   +  + +WDL +   +Q+ +  +   P + M        +   ++N ++  + AS 
Sbjct: 124 ASGSKNGEIFIWDLNKC-IDQSNDSYSPLTPGMAMTPVEE---ITSLAWNQSLSHVFASA 179

Query: 369 EEDNIVHVWKVSKK 382
              +   +W +  K
Sbjct: 180 GNTSYASIWDLKAK 193

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 74/156 (47%), Gaps = 16/156 (10%)

Query: 181 SDDGTIALWNVMGTNT-SPSKAVTTHEDIVNDCTWHEFNENLFGSVSED--KTLQIHDKR 237
           S D T+ LW+++ T+  +P  +V  +    ND  W   N+ + G++     +  + + K 
Sbjct: 37  SSDSTLELWSLLSTDKLNPVVSVEANAKF-NDIDWSIDNKYIAGALDNGMVELFKTNSKD 95

Query: 238 TNSTVHRLTL-SSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALH---------- 286
           T  ++ +L+   +   T++F+   +N+ A+   +  ++++DL    D  +          
Sbjct: 96  TLKSIKKLSKHGTSVTTVNFNAKQENVLASGSKNGEIFIWDLNKCIDQSNDSYSPLTPGM 155

Query: 287 TMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
            M+  E+ +TSL ++     +  S+G+     +WDL
Sbjct: 156 AMTPVEE-ITSLAWNQSLSHVFASAGNTSYASIWDL 190

>NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25
          Length = 510

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 84/203 (41%), Gaps = 17/203 (8%)

Query: 176 ELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHD 235
           + +SCSDD  + +WN   +N    + ++ H   V  C WH     L  S S+D  +++ D
Sbjct: 177 KFVSCSDDNILKIWNF--SNGKLERVLSGHHWDVKSCDWHP-EMGLIISASKDNLIKLWD 233

Query: 236 KRTNSTVHR-LTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDS 294
            R+ + V   L        + F     N+ AA   D    ++D+R++   L  +    D 
Sbjct: 234 PRSGNCVSTILKFKHTVLKVKFQPTGGNMIAAISKDKSCRVFDIRHSMKELLCVRDEVDY 293

Query: 295 VTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVND 354
           +T L ++P  + +      D  +  +DL+Q           D      ++   H   V  
Sbjct: 294 MT-LLWNPINESMFTVGNYDGSIKHFDLLQ-----------DLTKPTHVIPYAHDKCVTS 341

Query: 355 FSFNWNIPWLMASVEEDNIVHVW 377
            S+N  +  ++AS  +D  V  W
Sbjct: 342 LSYN-PMGNILASASKDRTVRFW 363

>Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178W
           (REAL)
          Length = 470

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 78/164 (47%), Gaps = 11/164 (6%)

Query: 166 GLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPS--KAVTTHEDIVNDCTWHEFNENLFG 223
            + ++P +  +++SC++DG I  +  +              HE  V+D  +H   +   G
Sbjct: 228 AVEWHPSSNNQMVSCAEDGLIKNFQYLNKEGELRLLGDFVGHERRVSDVKYHPSGK-FIG 286

Query: 224 SVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQ---NLFAAAGTDSLVYLYDLRN 280
           S S D T ++ D    ST   L L    +   FS   Q   +L  + G DSL  L+D+R+
Sbjct: 287 SASHDMTWRLWDA---STHQELLLQEGHSKGVFSLSFQCDGSLVCSGGMDSLTMLWDIRS 343

Query: 281 TADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQ 324
            +  + T++GH   V ++ +SP+   +  + G D  + +WD+ Q
Sbjct: 344 GSKVM-TLAGHSKPVYTVAWSPNGYQV-ATGGGDGLINVWDIRQ 385

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 79/189 (41%), Gaps = 23/189 (12%)

Query: 199 SKAVTTHEDIVNDCTWHEFNENLFGSVSED---KTLQIHDKRTNSTVHRLTLSSPFNTLD 255
           S+ + +H   +    WH  + N   S +ED   K  Q  +K     +    +       D
Sbjct: 216 SQKLDSHVGKIGAVEWHPSSNNQMVSCAEDGLIKNFQYLNKEGELRLLGDFVGHERRVSD 275

Query: 256 FSKHSQNLFAAAGTDSLVY-LYDLRNTADALHTMSGHEDSVTSLEFSPHKDG-ILCSSGS 313
              H    F  + +  + + L+D  +T   L    GH   V SL F    DG ++CS G 
Sbjct: 276 VKYHPSGKFIGSASHDMTWRLWDA-STHQELLLQEGHSKGVFSLSFQC--DGSLVCSGGM 332

Query: 314 DRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNI 373
           D   +LWD+ + GS+             +M  AGH   V   +++ N  + +A+   D +
Sbjct: 333 DSLTMLWDI-RSGSK-------------VMTLAGHSKPVYTVAWSPN-GYQVATGGGDGL 377

Query: 374 VHVWKVSKK 382
           ++VW + ++
Sbjct: 378 INVWDIRQR 386

>TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25
           YNL317W
          Length = 451

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/207 (21%), Positives = 85/207 (41%), Gaps = 17/207 (8%)

Query: 176 ELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHD 235
           + ++CSDD  + +WN   +N    + ++ H   V  C WH     L  S S+D  +++ D
Sbjct: 179 KFVTCSDDNILKIWNF--SNGQQERVLSGHHWDVKSCDWHP-EMGLIASASKDNLVKLWD 235

Query: 236 KRTNSTVHR-LTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDS 294
            R    +   L          F     NL AA   D    ++D+R++   L  +    D 
Sbjct: 236 PRVGQCISTILKFKHTVLKTRFQPTGGNLLAAISKDKSCRVFDIRHSLKELMVVRDEVDY 295

Query: 295 VTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVND 354
           +T L ++P  + +L  +  D  +  +D++Q           D    +  +   H   +  
Sbjct: 296 MT-LLWNPINESMLTVACYDGSLKDFDVVQ-----------DLKKPVHTIPYAHDKCITS 343

Query: 355 FSFNWNIPWLMASVEEDNIVHVWKVSK 381
            S+N  +  ++AS  +D  +  W  ++
Sbjct: 344 LSYN-PVGHILASASKDRTIRFWTRAR 369

>KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} similar
           to uniprot|P38968 Saccharomyces cerevisiae YDL195W SEC31
           involved in protein transport from endoplasmic reticulum
           to Golgi Component (p150) of COPII coat of secretory
           pathway vesicles
          Length = 1299

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 86/204 (42%), Gaps = 23/204 (11%)

Query: 135 NGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGT 194
           NGV + F  +  +      V++ A H      ++FN R    L S    G I +W+    
Sbjct: 83  NGVVEFFAPEEPRS-----VAKLAQHTTPVKTVTFNARQHNVLCSGGSKGEIYIWDANKI 137

Query: 195 NTS------PSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLS 248
            T       P  A+T  ++I +   W++   ++F S        I D +    V  L+ +
Sbjct: 138 ETPGYAPFVPGTAMTPMDEIYS-LAWNQNQAHVFASAGSSGYASIWDLKAKKEVIHLSYA 196

Query: 249 SPF----NTLDF----SKHSQNLFAAAGTDS--LVYLYDLRNTADALHTMS-GHEDSVTS 297
           SP     N L        +S  +  A+G DS   + ++DLRN    +  +S  H   V S
Sbjct: 197 SPVTGQRNQLSIVEWHPNNSTRIATASGNDSDPSILIWDLRNANVPMQVLSQPHTKGVLS 256

Query: 298 LEFSPHKDGILCSSGSDRRVLLWD 321
           L++    + +L SSG D   +LW+
Sbjct: 257 LDWCKQDETLLLSSGRDNVCVLWN 280

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/149 (20%), Positives = 67/149 (44%), Gaps = 8/149 (5%)

Query: 181 SDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNS 240
           S + T+ +W+++  + +  +A  T +   ND  W   N  + G++ E+  ++        
Sbjct: 37  SSESTLEIWSLLSPHEATPQASITADAKFNDLDWSHDNAIIAGAL-ENGVVEFFAPEEPR 95

Query: 241 TVHRLTL-SSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALH------TMSGHED 293
           +V +L   ++P  T+ F+    N+  + G+   +Y++D        +      T     D
Sbjct: 96  SVAKLAQHTTPVKTVTFNARQHNVLCSGGSKGEIYIWDANKIETPGYAPFVPGTAMTPMD 155

Query: 294 SVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
            + SL ++ ++  +  S+GS     +WDL
Sbjct: 156 EIYSLAWNQNQAHVFASAGSSGYASIWDL 184

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 2/81 (2%)

Query: 245 LTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHK 304
           +T  + FN LD+S H   + A A  + +V  +       ++  ++ H   V ++ F+  +
Sbjct: 59  ITADAKFNDLDWS-HDNAIIAGALENGVVEFF-APEEPRSVAKLAQHTTPVKTVTFNARQ 116

Query: 305 DGILCSSGSDRRVLLWDLMQI 325
             +LCS GS   + +WD  +I
Sbjct: 117 HNVLCSGGSKGEIYIWDANKI 137

>Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {ON}
           YPL151C (REAL)
          Length = 451

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 74/154 (48%), Gaps = 19/154 (12%)

Query: 177 LLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDK 236
            ++ S+D T+ +W++       +  +T H   V D    + +  LF SVSEDKT++  D 
Sbjct: 155 FVTGSNDTTMKVWDLASGKLKVT--LTGHVMTVRDIAVSDRHPYLF-SVSEDKTVKCWDL 211

Query: 237 RTNSTVHR-------LTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMS 289
             N  +         +   S   TLD       L A AG DS+V L+D+R     + T+ 
Sbjct: 212 EKNQIIRDYHGHLSGVRTVSIHPTLD-------LIATAGRDSVVKLWDIRTRVPVI-TLV 263

Query: 290 GHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLM 323
           GH+  +  +E +P  D  + SS +D  V LWD++
Sbjct: 264 GHKGPINQVECAP-VDPQIVSSSTDATVRLWDIV 296

>Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa]
           {ON} YCR084C (TUP1) - glucose repression regulatory
           protein, exhibits similarity to beta subunits of G
           proteins [contig 17] FULL
          Length = 750

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 62/247 (25%), Positives = 105/247 (42%), Gaps = 44/247 (17%)

Query: 160 HKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNE 219
           H+ + Y L + P +  +L+S S D T+ +W++     S + ++   ED V        + 
Sbjct: 511 HEQDIYSLDYFP-SGDKLVSGSGDRTVRIWDLRTGQCSLTLSI---EDGVTTVAVSPGDG 566

Query: 220 NLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNT--------LDFSKHSQNLFAAAGTDS 271
            L  + S D+T++I D  T   V RL   +   T        + F++    + + +  D 
Sbjct: 567 KLIAAGSLDRTVRIWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGS-LDR 625

Query: 272 LVYLYDLR-----------NTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLW 320
            V L++LR           NTA +  T +GH+D V S+  +   D  + S   DR VL W
Sbjct: 626 SVKLWNLRSANGGTAEGKANTAASEVTYTGHKDFVLSVATT-QNDEFILSGSKDRGVLFW 684

Query: 321 DLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPW-----LMASVEEDNIVH 375
                       D   G P LM+   GH+++V   +   + P      + A+   D    
Sbjct: 685 ------------DTPSGNPLLMLQ--GHRNSVISVAVANDHPLGPEYGVFATGSGDCKAR 730

Query: 376 VWKVSKK 382
           +WK SK+
Sbjct: 731 IWKYSKQ 737

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 76/202 (37%), Gaps = 57/202 (28%)

Query: 153 LVSEHAFHKDNGYGLSFNPRTKGEL---LSCSDDGTIALWNVMGTNTSPSKAVTTHEDIV 209
           LV +H   + N Y + +NP    EL   L  S D                     H  +V
Sbjct: 365 LVPQHLKKQTNDYYILYNPALPRELDVDLHVSLD---------------------HSSVV 403

Query: 210 NDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLT--LSSPFNTLDFSKHSQN----- 262
             C     ++  F +   +KT Q++   T   + RL+   SS  +  D S  S+N     
Sbjct: 404 --CCVRFSHDGEFLATGCNKTTQVYKVSTGELIARLSEDASSAPSGADASATSENAKASP 461

Query: 263 ----------------------LFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEF 300
                                   A    D L+ ++DL  T   + T+ GHE  + SL++
Sbjct: 462 AVATSASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDL-ATRRIVMTLQGHEQDIYSLDY 520

Query: 301 SPHKDGILCSSGSDRRVLLWDL 322
            P  D ++  SG DR V +WDL
Sbjct: 521 FPSGDKLVSGSG-DRTVRIWDL 541

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 61/127 (48%), Gaps = 6/127 (4%)

Query: 197 SPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTL-SSPFNTLD 255
           SP+ A +   D+         +     + +EDK ++I D  T   V  L        +LD
Sbjct: 460 SPAVATSASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLD 519

Query: 256 FSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGS-D 314
           +      L + +G D  V ++DLR    +L T+S  ED VT++  SP  DG L ++GS D
Sbjct: 520 YFPSGDKLVSGSG-DRTVRIWDLRTGQCSL-TLS-IEDGVTTVAVSP-GDGKLIAAGSLD 575

Query: 315 RRVLLWD 321
           R V +WD
Sbjct: 576 RTVRIWD 582

>TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.276
           YPL247C
          Length = 598

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 75/174 (43%), Gaps = 29/174 (16%)

Query: 177 LLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDK 236
           L+S S D T  +W++  +N   ++ +  H+  V D  +   +  LF S   D ++++ D 
Sbjct: 316 LISSSIDTTCIVWDLQSSNYVKTQLIA-HDSEVFDVKFLIQSTQLFASCGGDGSIRVFDL 374

Query: 237 RT-------NSTVHRLTLSSPFNT--------------------LDFSKHSQNLFAAAGT 269
           R          T + L  ++ FN                     L+ S    NL A  G 
Sbjct: 375 RALQHSTIIYETANDLQGNNTFNNDVTTKIDNSSANSLSHALLRLEPSPTDPNLIATFGL 434

Query: 270 DS-LVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
           D   + + D+RN    +  +SGH  SV  +++ P K  +L S G D +VL WDL
Sbjct: 435 DKKAILILDMRNPGVPVLVLSGHSPSVNQIKWHPSKPYVLLSCGDDCQVLYWDL 488

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 85/197 (43%), Gaps = 39/197 (19%)

Query: 214 WHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLD--FSKHSQNLFAAAGTDS 271
           W+  + NL  S S D T  + D ++++ V    ++      D  F   S  LFA+ G D 
Sbjct: 308 WNSIDTNLLISSSIDTTCIVWDLQSSNYVKTQLIAHDSEVFDVKFLIQSTQLFASCGGDG 367

Query: 272 LVYLYDLR---------NTADALHTMSGHEDSVTS----------------LEFSPHKDG 306
            + ++DLR          TA+ L   +   + VT+                LE SP    
Sbjct: 368 SIRVFDLRALQHSTIIYETANDLQGNNTFNNDVTTKIDNSSANSLSHALLRLEPSPTDPN 427

Query: 307 ILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMA 366
           ++ + G D++ +L   M+            GVP L++  +GH  +VN   ++ + P+++ 
Sbjct: 428 LIATFGLDKKAILILDMR----------NPGVPVLVL--SGHSPSVNQIKWHPSKPYVLL 475

Query: 367 SVEEDNIVHVWKVSKKL 383
           S  +D  V  W ++ +L
Sbjct: 476 SCGDDCQVLYWDLNSEL 492

>Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa]
           {ON} complement(180839..181954) [1116 nt, 372 aa]
          Length = 371

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 64/295 (21%), Positives = 116/295 (39%), Gaps = 49/295 (16%)

Query: 129 NFIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIAL 188
           N +    G G + LFD S  K    + +   H       ++N   K   +S S DGT+ +
Sbjct: 75  NQVLVAQGDGSLRLFDTSLQKFPIAIFKE--HSKEVLSCNWNLINKQTFVSSSWDGTVKI 132

Query: 189 W-----------------------NVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSV 225
           W                       N +         ++ +++ +    +   +ENL    
Sbjct: 133 WTPNRKESLRTLQVQPVMQSQLVDNTIAKTNGSRGTISANKNCIYQAQFSPHDENLVMCC 192

Query: 226 SEDKTLQIHDKR---TNSTVHRLTLSSPFNTL--DFSKHSQNLFAAAGTDSLVYLYDLR- 279
           S +  + + D R   +N+   R    +   TL  DF+K+   + A +G DS + ++D+R 
Sbjct: 193 SGNSYVTLFDLRQPNSNNKQQRFLAHNGSETLTCDFNKYRPTVVATSGVDSSIRIWDIRM 252

Query: 280 ------------NTADALHTMS-GHEDSVTSLEFSPHKDGILCSSGSDRRVLLW-DLMQI 325
                       ++A  ++ ++  HE +V  + +SPH   +L S+  D    +W DL   
Sbjct: 253 LVNLGPQSQHINSSAACINEITRAHELAVRKVAWSPHHPNVLLSASYDMTCSVWQDLSYD 312

Query: 326 GSE-QAQEDAADGVPELMMMHAGHKSAV--NDFSFNWNIPWLMASVEEDNIVHVW 377
           GS    + ++ D     +    GH   V   D+S  W  P  +A+   D  V +W
Sbjct: 313 GSRFTMKTNSIDSSKGFIKRFTGHSEFVFGADWSL-WGQPGFIATTGWDGNVFLW 366

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 55/246 (22%), Positives = 105/246 (42%), Gaps = 34/246 (13%)

Query: 136 GVGKVFLFDRSKDKNEALVSEHAFH-KDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGT 194
           G G +F+ D   D    + S ++F  +D  Y +++N   + ++L    DG++ L++    
Sbjct: 37  GNGNLFILD--IDPQGRIHSMNSFMTQDCLYDVAWNELHENQVLVAQGDGSLRLFDT-SL 93

Query: 195 NTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTL 254
              P      H   V  C W+  N+  F S S D T++I       ++  L +       
Sbjct: 94  QKFPIAIFKEHSKEVLSCNWNLINKQTFVSSSWDGTVKIWTPNRKESLRTLQV------- 146

Query: 255 DFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDG-ILCSSGS 313
                 Q +  +   D+ +       T  +  T+S +++ +   +FSPH +  ++C SG 
Sbjct: 147 ------QPVMQSQLVDNTI-----AKTNGSRGTISANKNCIYQAQFSPHDENLVMCCSG- 194

Query: 314 DRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNI 373
           +  V L+DL Q  S   Q+          + H G ++   D  FN   P ++A+   D+ 
Sbjct: 195 NSYVTLFDLRQPNSNNKQQR--------FLAHNGSETLTCD--FNKYRPTVVATSGVDSS 244

Query: 374 VHVWKV 379
           + +W +
Sbjct: 245 IRIWDI 250

 Score = 34.3 bits (77), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 48/221 (21%), Positives = 82/221 (37%), Gaps = 44/221 (19%)

Query: 120 RARFMPQDPNFIATINGVGKVFLFD-RSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELL 178
           +A+F P D N +   +G   V LFD R  + N       A +        FN      + 
Sbjct: 178 QAQFSPHDENLVMCCSGNSYVTLFDLRQPNSNNKQQRFLAHNGSETLTCDFNKYRPTVVA 237

Query: 179 SCSDDGTIALWNV-MGTNTSP------------SKAVTTHEDIVNDCTWHEFNENLFGSV 225
           +   D +I +W++ M  N  P            ++    HE  V    W   + N+  S 
Sbjct: 238 TSGVDSSIRIWDIRMLVNLGPQSQHINSSAACINEITRAHELAVRKVAWSPHHPNVLLSA 297

Query: 226 SEDKTLQI-HDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADA 284
           S D T  +  D   + +  R T+ +  N++D SK                          
Sbjct: 298 SYDMTCSVWQDLSYDGS--RFTMKT--NSIDSSK------------------------GF 329

Query: 285 LHTMSGHEDSVTSLEFSP-HKDGILCSSGSDRRVLLWDLMQ 324
           +   +GH + V   ++S   + G + ++G D  V LW+ +Q
Sbjct: 330 IKRFTGHSEFVFGADWSLWGQPGFIATTGWDGNVFLWNGLQ 370

>ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {ON}
           highly similar to uniprot|Q75AV4 Ashbya gossypii ADL184W
           PSF2 Polyadenylation factor subunit 2 and similar to
           YNL317W uniprot|P42841 Saccharomyces cerevisiae YNL317W
           PFS2 Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 445

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/207 (22%), Positives = 82/207 (39%), Gaps = 17/207 (8%)

Query: 176 ELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHD 235
           + ++CSDD  + +WN   +N    + ++ H   V  C WH     L  S S+D  +++ D
Sbjct: 179 KFVTCSDDNILKIWNF--SNGQQERVLSGHHWDVKSCDWHP-QMGLIASASKDNLVKLWD 235

Query: 236 KRTNSTVHR-LTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDS 294
            R+   V   L          F     NL AA   D    ++DLR +   L       D 
Sbjct: 236 PRSGQCVSTLLKFKHTVLKTKFQPTQGNLMAAISKDKSCRVFDLRQSMKELMVTRDEVDY 295

Query: 295 VTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVND 354
           +T L + P  + +   +  D  +  +D++     Q  E     +P        H   +  
Sbjct: 296 MT-LLWHPINETMFTVACYDGSLKNFDIL-----QDTEGPTHTIP------YAHDKCITS 343

Query: 355 FSFNWNIPWLMASVEEDNIVHVWKVSK 381
            S+N  +  ++AS  +D  +  W  ++
Sbjct: 344 LSYN-PVGHILASASKDRTIRFWTRAR 369

>Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa]
           {ON} similar to Ashbya gossypii AFR199C
          Length = 318

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 60/244 (24%), Positives = 107/244 (43%), Gaps = 31/244 (12%)

Query: 151 EALVSEHAFHKDNGY--GLSFNPRTKGELLSCSDDGTIALWNVMGTNTS---PSKAVTTH 205
           E LV        NG+   L+ +P     LLS S D T+  W + G +     P K+   H
Sbjct: 5   EFLVLRGTLEGHNGWVTSLATSPAQPNMLLSASRDKTLITWRLTGEDQQYGVPVKSFKGH 64

Query: 206 EDIVNDCTWHEFNENLFG-SVSEDKTLQIHDKRTNSTVHRLTL-SSPFNTLDFSKHSQNL 263
             I+ DCT    N+  +  S S DKTL++ D  +  ++ R     S   ++     +  +
Sbjct: 65  SHIIQDCT--VTNDGKYALSASWDKTLRLWDLASGESLIRFVGHKSDVMSVSIDAGATQI 122

Query: 264 FAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDG----ILCSSGSDRRVLL 319
            +A+  D  V +++     + + T+ GH D V+ +  +P  +      + S+G D+ V +
Sbjct: 123 VSAS-RDKTVKVWN--TVGECVVTLLGHNDWVSHVRIAPKDNADDPVTVISAGMDKVVKV 179

Query: 320 WDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKV 379
           WDL     E      AD +        GH + VN  + + +   + AS  +D  + +W +
Sbjct: 180 WDLQSFTIE------ADFI--------GHNNYVNTVTPSPDGS-IFASAGKDGQIMLWNL 224

Query: 380 SKKL 383
           + K+
Sbjct: 225 NAKI 228

>TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {ON}
           Anc_5.201 YLL011W
          Length = 481

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 58/127 (45%), Gaps = 2/127 (1%)

Query: 185 TIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHR 244
           TI LW+     + P   ++   D +    +++   ++  S   D ++ ++D RTNS   +
Sbjct: 194 TIQLWDT--ARSKPLSNLSWGADNITSVKFNQTETDILASTGSDNSIVLYDVRTNSPTQK 251

Query: 245 LTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHK 304
           +      N + ++      F  A  D   Y YD+RN + AL+    H  +V  ++F+P  
Sbjct: 252 IVQRLRTNAICWNPMEAFNFVTANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFAPTG 311

Query: 305 DGILCSS 311
           D I+  S
Sbjct: 312 DEIVTGS 318

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 67/163 (41%), Gaps = 40/163 (24%)

Query: 166 GLSFNP------RTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNE 219
           GL  +P      R +  +LSC DD T+ LW++ G +                        
Sbjct: 115 GLCVSPQRSPLNRDQHFMLSCGDDKTVKLWSMNGDD------------------------ 150

Query: 220 NLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLR 279
             F +V +D+ L   D      +        F  +D  K  +  F   G    + L+D  
Sbjct: 151 --FANVKDDQNLNSQD----GLLKTFYGEHAFQGIDHHK-VKTTFVTGG--PTIQLWDTA 201

Query: 280 NTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
            +   L  +S   D++TS++F+  +  IL S+GSD  ++L+D+
Sbjct: 202 RSK-PLSNLSWGADNITSVKFNQTETDILASTGSDNSIVLYDV 243

>TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {ON}
           Anc_8.544 YBR198C
          Length = 1034

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 103/234 (44%), Gaps = 29/234 (12%)

Query: 160 HKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTT---HEDIVNDCTWHE 216
           H D  Y ++F+P  +  LLS S D T  LW+     T   K + +   HE  + D  +  
Sbjct: 759 HSDAVYSVNFSPCNRF-LLSGSGDKTARLWS-----TDTYKGLVSYKGHEKPIWDVNFSP 812

Query: 217 FNENLFGSVSEDKTLQIHDKRTNSTVHRLTLS-SPFNTLDFSKHSQNLFAAAGTDSLVYL 275
              NLF + S D T ++        V  L    S  + + F  + Q +F  + +D    +
Sbjct: 813 TGNNLFATASSDNTARVWSCDRVYPVRILAGHLSDVDCVSFHPNGQYVFTGS-SDKTSRM 871

Query: 276 YDLRNTADALHTMSGHEDSVTSLEFSPHKDGI-LCSSGSDRRVLLWDLMQIGSEQAQEDA 334
           +DL ++ D++    GH  +VT+   SP  DG  L ++  D  + +WD   IGS +     
Sbjct: 872 WDL-SSGDSVRLFIGHSSAVTATAVSP--DGRWLSTANEDGTITVWD---IGSGK----- 920

Query: 335 ADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKLTSPGL 388
                +L  M    K+++   S+N     L++S   DN V VW + K    P L
Sbjct: 921 -----KLKSMRGHGKNSIYSLSYNKTGNILVSS-GADNSVRVWDIKKNTHEPSL 968

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 58/142 (40%), Gaps = 30/142 (21%)

Query: 253 TLDFSKHSQNLFAAAG-TDSLVYLYDLRNTA------------DALHTMSGHEDSVTSLE 299
           +LDFS  S    AA G  DS + ++ L  T+                T+ GH D+V S+ 
Sbjct: 710 SLDFS--SDYTLAATGFQDSYIKIWSLEGTSINENEQNYSQINSIFKTLVGHSDAVYSVN 767

Query: 300 FSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNW 359
           FSP    +L  SG D+   LW            D   G    ++ + GH+  + D +F+ 
Sbjct: 768 FSPCNRFLLSGSG-DKTARLWST----------DTYKG----LVSYKGHEKPIWDVNFSP 812

Query: 360 NIPWLMASVEEDNIVHVWKVSK 381
               L A+   DN   VW   +
Sbjct: 813 TGNNLFATASSDNTARVWSCDR 834

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 84/181 (46%), Gaps = 9/181 (4%)

Query: 146 SKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTH 205
           S D  + LVS +  H+   + ++F+P       + S D T  +W+       P + +  H
Sbjct: 788 STDTYKGLVS-YKGHEKPIWDVNFSPTGNNLFATASSDNTARVWSC--DRVYPVRILAGH 844

Query: 206 EDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFA 265
              V+  ++H   + +F + S DKT ++ D  +  +V      S   T           +
Sbjct: 845 LSDVDCVSFHPNGQYVF-TGSSDKTSRMWDLSSGDSVRLFIGHSSAVTATAVSPDGRWLS 903

Query: 266 AAGTDSLVYLYDLRNTADALHTMSGH-EDSVTSLEFSPHKDG-ILCSSGSDRRVLLWDLM 323
            A  D  + ++D+  +   L +M GH ++S+ SL +  +K G IL SSG+D  V +WD+ 
Sbjct: 904 TANEDGTITVWDI-GSGKKLKSMRGHGKNSIYSLSY--NKTGNILVSSGADNSVRVWDIK 960

Query: 324 Q 324
           +
Sbjct: 961 K 961

>AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR222C (UTP13)
          Length = 806

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 82/179 (45%), Gaps = 23/179 (12%)

Query: 226 SEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADAL 285
           S+++ L+ +D  T  T   + +SSP   LD  + S  L A  GTD  V ++D+ N     
Sbjct: 79  SQNQLLRFYDLETKRTTRSMKISSPAYVLDCDE-SSTLLAVGGTDGSVNVFDIAN-GYVT 136

Query: 286 HTMSGHEDSVTSLEFSPHKDG---ILCSSGSDRRVLLWDLMQ---IGSEQAQEDAADGV- 338
           H++ GH  +++S++F    D    +L S  ++  V +WDL++   I + Q    A  G+ 
Sbjct: 137 HSLKGHGATISSVKFYGEVDSGMWLLASGDTNGMVKIWDLVKRRCIHTVQEHTAAVRGLD 196

Query: 339 ------PELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKLTSPGLIQD 391
                  E +++  G    V+   F+          ++  ++    V +++ S G I D
Sbjct: 197 IRVQEGAESLLLSGGRDDVVHVHHFDMK--------KKCKLLQTIPVKRQIESCGFIGD 247

>KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 422

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 63/253 (24%), Positives = 116/253 (45%), Gaps = 39/253 (15%)

Query: 159 FHKDNGYGLSFNPRTKGELLSCSDDGTIAL--WNVMGTNTSPSKAVTTHED--IVNDCTW 214
           + ++N + L   P  +  L++   DG++ L  W  + T +S     T+  D  ++N    
Sbjct: 10  YFEENNWCLKLQPLYQHGLMTSISDGSVHLLDWGNLKTISSIQCHTTSINDMKVINS--- 66

Query: 215 HEFNEN-LFGSVSEDKTLQIHDKRTNSTVHRLT--LSSPFNTLDFSKHSQNLFAAAGT-- 269
            +F+   +F + +ED  +++ D R  + V  L    +SPF +LD S+H+     A GT  
Sbjct: 67  -DFDTGAVFATAAEDG-VKVWDIRARNNVASLQNDKASPFFSLD-SRHN---MLACGTEL 120

Query: 270 ---DSLVYLYDLRNTADALHT-MSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQI 325
              D+ +++YD+RN    + + +  H D +T ++F P    +L S  +D  V ++DL Q 
Sbjct: 121 KDYDAELHIYDIRNWTKPVRSFVDSHHDDITDIKFHPCDSNLLMSGSTDGYVNIYDLTQ- 179

Query: 326 GSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIP---WLMASVEEDNIVHVWKVSKK 382
                +EDA   V     +H          S  W  P   W ++ +E   I  +   S +
Sbjct: 180 ---DDEEDALHQVINFASIH----------SCGWLGPKRIWSLSHMETFGIHELNDKSDE 226

Query: 383 LTSPGLIQDYDIR 395
           +  P  ++  D+R
Sbjct: 227 MIEPKPLEFGDVR 239

>Skud_4.401 Chr4 complement(712131..713261) [1131 bp, 376 aa] {ON}
           YDR142C (REAL)
          Length = 376

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 68/307 (22%), Positives = 116/307 (37%), Gaps = 67/307 (21%)

Query: 129 NFIATINGVGKVFLFDRS-KDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIA 187
           N +    G G + LFD S K+   A+  EH   +   +  ++N   +   LS S DG+I 
Sbjct: 74  NQVLVAQGDGTLRLFDTSLKEYPIAIFKEH---EREVFSCNWNLVNRQNFLSSSWDGSIK 130

Query: 188 LW-------------------------NVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLF 222
           +W                         N +  N      ++ + + V    +   ++NL 
Sbjct: 131 IWSPLRKQSLMSLTPRPLEITKMVDPLNAILLNKKKFAGISKNRNCVYQAQFSPHDQNLI 190

Query: 223 GSVSEDKTLQIHDKR-------TNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYL 275
            S S +    + D R       +N  VH    +    T DF+K+   + A  G D+ + +
Sbjct: 191 ISCSGNSYASLFDIRLPPSKSQSNFLVHSGLEAL---TCDFNKYRPYVVATGGVDNAIRI 247

Query: 276 YDLR-------------------NTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRR 316
           +D+R                   N+A      + HE +V  + +SPH   IL S+  D  
Sbjct: 248 WDIRMLNAIGSTAIDRTTHNKSHNSACINEIPNAHELAVRKVAWSPHHSNILMSASYDMT 307

Query: 317 VLLW-DLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFN-----WNIPWLMASVEE 370
             +W DL   G+++  +  + GV    +  +   S   +F F      W  P  +AS   
Sbjct: 308 CRIWKDLSNDGTKETYKTNSTGVGRGCVSKSTQHS---EFVFGIDWSLWGKPGYVASTAW 364

Query: 371 DNIVHVW 377
           D  V +W
Sbjct: 365 DGNVFIW 371

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/257 (20%), Positives = 105/257 (40%), Gaps = 55/257 (21%)

Query: 136 GVGKVFLFD-----RSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWN 190
           G GK+++ +     R ++KN  L       +D  + +++N   + ++L    DGT+ L++
Sbjct: 36  GNGKLYILEISRSGRIEEKNSFLT------QDCLFDVAWNESHENQVLVAQGDGTLRLFD 89

Query: 191 VMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLT---- 246
                  P      HE  V  C W+  N   F S S D +++I       ++  LT    
Sbjct: 90  T-SLKEYPIAIFKEHEREVFSCNWNLVNRQNFLSSSWDGSIKIWSPLRKQSLMSLTPRPL 148

Query: 247 ----LSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSP 302
               +  P N +  +K     FA                      +S + + V   +FSP
Sbjct: 149 EITKMVDPLNAILLNKKK---FAG---------------------ISKNRNCVYQAQFSP 184

Query: 303 HKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIP 362
           H   ++ S   +    L+D+ ++   ++Q +         ++H+G ++   DF  N   P
Sbjct: 185 HDQNLIISCSGNSYASLFDI-RLPPSKSQSN--------FLVHSGLEALTCDF--NKYRP 233

Query: 363 WLMASVEEDNIVHVWKV 379
           +++A+   DN + +W +
Sbjct: 234 YVVATGGVDNAIRIWDI 250

>Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {ON}
           complement(30466..31824) [1359 nt, 453 aa]
          Length = 452

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/214 (21%), Positives = 88/214 (41%), Gaps = 19/214 (8%)

Query: 172 RTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTL 231
           +   + ++C+DD  + +WN   +N    + ++ H   V  C WH     L  S S+D  +
Sbjct: 176 KNDSKFVTCADDNVLKIWNF--SNGQQERVLSGHHWDVKSCDWHP-EMGLIVSASKDNLI 232

Query: 232 QIHDKRTNSTVHRLTLSSPFNTLD--FSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMS 289
           ++ D R+   +  L L+     L   F     NL  A   D    ++D+R++   L    
Sbjct: 233 RLWDPRSGQCISSL-LNFKHTVLKTRFQPTKGNLLTAISKDKSCRVFDIRHSMRELMVYR 291

Query: 290 GHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHK 349
              D +T LE+ P  + +   +  D  +  +D++     Q  E     VP        H 
Sbjct: 292 DEVDYMT-LEWHPTNETMFTVASYDGSLKHFDIL-----QDLEKPTHVVP------YAHD 339

Query: 350 SAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKL 383
             +   S+N  +  ++AS  +D  +  W  ++ +
Sbjct: 340 KCITSLSYN-PVGHILASAAKDRTIRFWTRARPV 372

>Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {ON}
           similar to Ashbya gossypii AER255C
          Length = 471

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 86/192 (44%), Gaps = 6/192 (3%)

Query: 151 EALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVN 210
           + +++ +  H++    L F P++    LS  +D  + +W++   +    +    H+  + 
Sbjct: 168 KKIINVYDGHENGTTALKFLPKSGHLFLSGGNDNKLKIWDLY-HDRRLLRDFCGHQKPIR 226

Query: 211 DCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTD 270
           D  +   +   F SVS DK L+I D    + +HR  L+S  N + F   +         +
Sbjct: 227 DFNFTT-DSKQFTSVSYDKFLKIWDTEKGAIIHRTKLTSVPNCVTFHPINNYELVVGLLN 285

Query: 271 SLVYLYDLRNTAD--ALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWD-LMQIGS 327
           S +  YD R+      + T   H  S+ +L+F P+    + SS  D+ + +WD  + I  
Sbjct: 286 SEIKHYDTRDNYKNGLIQTYDHHTSSIIALKFFPNGSKFISSS-EDKTIRIWDNQINIPI 344

Query: 328 EQAQEDAADGVP 339
           +Q  + A   +P
Sbjct: 345 KQISDTAQHSMP 356

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 51/122 (41%), Gaps = 22/122 (18%)

Query: 285 LHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMM 344
           ++   GHE+  T+L+F P    +  S G+D ++ +WDL                  L+  
Sbjct: 171 INVYDGHENGTTALKFLPKSGHLFLSGGNDNKLKIWDLYH-------------DRRLLRD 217

Query: 345 HAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSK-------KLTS-PGLIQDYDIRS 396
             GH+  + DF+F  +      SV  D  + +W   K       KLTS P  +  + I +
Sbjct: 218 FCGHQKPIRDFNFTTDSK-QFTSVSYDKFLKIWDTEKGAIIHRTKLTSVPNCVTFHPINN 276

Query: 397 LE 398
            E
Sbjct: 277 YE 278

>Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 92/204 (45%), Gaps = 19/204 (9%)

Query: 152 ALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVND 211
           +LV  + F  +N + L   P  K  LL+   +G I L +     +   + +   E  +ND
Sbjct: 5   SLVESNFFGSEN-WCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSL--QNIKASETAIND 61

Query: 212 CTW--HEFNENLFGSVSEDKTLQIHDKRTNSTVHRLT--LSSPFNTLDFSKHSQNLFAAA 267
                 +F+     S +    +++ D RTNS +  +    +SPF +LD S+H   L A  
Sbjct: 62  LKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLD-SRH--GLLACG 118

Query: 268 ----GTDSLVYLYDLRNTADALHTM-SGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
               G D+ V++YD+R     L ++   H D VT ++F P    IL S  +D    ++DL
Sbjct: 119 TELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDL 178

Query: 323 MQIGSEQAQEDAADGVPELMMMHA 346
            Q      +EDA   V     +H+
Sbjct: 179 KQ----DEEEDALHQVINYASIHS 198

>TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa]
           {ON} Anc_3.25 YNL317W
          Length = 461

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/217 (22%), Positives = 84/217 (38%), Gaps = 17/217 (7%)

Query: 173 TKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQ 232
           T  + ++CSDD  + +WN   +N    + +T H   V  C WH     L  S S+D  ++
Sbjct: 178 TDSKFVTCSDDNILKIWNF--SNGKQERILTGHHWDVKSCDWHP-EMGLIVSGSKDNLVK 234

Query: 233 IHDKRTNSTVHR-LTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGH 291
             D R+   V   L          F     N       D    ++D+RN    L T+   
Sbjct: 235 FWDPRSGQCVSTILNFKHTVLRTRFQPTRGNYLLGISKDKSCRVFDIRNHTKELLTVRDE 294

Query: 292 EDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSA 351
            D +T L + P  + +   +  D  +  +D+++           D    +  +   H+  
Sbjct: 295 VDFMT-LSWHPINESVFTLANYDGSIKHFDILE-----------DLEKPIHTIPFAHEKC 342

Query: 352 VNDFSFNWNIPWLMASVEEDNIVHVWKVSKKLTSPGL 388
           +   S+N  I  ++AS  +D  +  W  SK +   G 
Sbjct: 343 ITAMSYN-PIGHILASASKDRTIRFWTRSKPIDPNGF 378

>YKL213C Chr11 complement(31960..34107) [2148 bp, 715 aa] {ON}
           DOA1WD repeat protein required for ubiquitin-mediated
           protein degradation, forms complex with Cdc48p, plays a
           role in controlling cellular ubiquitin concentration;
           also promotes efficient NHEJ in postdiauxic/stationary
           phase
          Length = 715

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 75/169 (44%), Gaps = 28/169 (16%)

Query: 160 HKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNE 219
           H+ N   LSF     G ++S S D T  +W       S    +  H   V D     F+E
Sbjct: 98  HQGNVCSLSFQ---DGVVISGSWDKTAKVWK----EGSLVYNLQAHNASVWDAKVVSFSE 150

Query: 220 NLFGSVSEDKTLQI--HDK--RTNSTVHRLTLSSPFNTLDFSKHSQNL----FAAAGTDS 271
           N F + S DKT+++  +DK  +T S +H           D  +H   +    F +   D 
Sbjct: 151 NKFLTASADKTIKLWQNDKVIKTFSGIHN----------DVVRHLAVVDDGHFISCSNDG 200

Query: 272 LVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLW 320
           L+ L D+ +T D L T  GHE  V  ++  P+ D + C  G DR V +W
Sbjct: 201 LIKLVDM-HTGDVLRTYEGHESFVYCIKLLPNGDIVSC--GEDRTVRIW 246

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 5/62 (8%)

Query: 261 QNLFAAAGTDSLVYLYDLRNTA--DALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVL 318
           + L    G D+++    L  T+  D L+T+ GH+ +V SL F   +DG++ S   D+   
Sbjct: 66  KELLLFGGKDTMINGVPLFATSGEDPLYTLIGHQGNVCSLSF---QDGVVISGSWDKTAK 122

Query: 319 LW 320
           +W
Sbjct: 123 VW 124

>Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}
           YPL247C (REAL)
          Length = 522

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 82/187 (43%), Gaps = 26/187 (13%)

Query: 177 LLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDK 236
           ++S S D T  +W++  ++   ++ +  H+  V D  +   +  LF S   D ++++ D 
Sbjct: 259 IISSSIDTTCIVWDLQSSHYVKTQLIA-HDSEVFDVRFLTKSTQLFASCGGDGSVRVFDL 317

Query: 237 RT--NSTVHRLTLSSPFN------------------TLDFSKHSQNLFAAAGTDS-LVYL 275
           R+  +ST+     SSP +                   L+ S +  N+ A    DS  + +
Sbjct: 318 RSLAHSTIIYEPPSSPASGPNAGATTPSLKGSDALLRLEPSPYDPNVLATFAADSNKIII 377

Query: 276 YDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL----MQIGSEQAQ 331
            D+RN    +  + GH  SV  +++ P K  +L S   D + L WDL    M+I    ++
Sbjct: 378 LDMRNPESPILNLEGHTCSVNEIKWHPTKRNVLLSCSDDCQALYWDLNNSFMEINGSDSK 437

Query: 332 EDAADGV 338
              A G 
Sbjct: 438 SPTASGA 444

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 40/89 (44%), Gaps = 7/89 (7%)

Query: 120 RARFMPQDPNFIATING-VGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELL 178
           R    P DPN +AT      K+ + D    ++  L  E   H  +   + ++P  +  LL
Sbjct: 354 RLEPSPYDPNVLATFAADSNKIIILDMRNPESPILNLEG--HTCSVNEIKWHPTKRNVLL 411

Query: 179 SCSDDGTIALWNV----MGTNTSPSKAVT 203
           SCSDD     W++    M  N S SK+ T
Sbjct: 412 SCSDDCQALYWDLNNSFMEINGSDSKSPT 440

>TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.316
           YDR142C
          Length = 378

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 64/307 (20%), Positives = 118/307 (38%), Gaps = 62/307 (20%)

Query: 129 NFIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIAL 188
           N +    G G + LFD +  K    + +   HK      ++N  TKG  +S S DG + +
Sbjct: 75  NQVLVAQGDGSLRLFDTTLQKYPIGIFKE--HKKEVLSCNWNLITKGTFVSSSWDGAVKM 132

Query: 189 WNVMG-----------------------------TNTSPSKAVTTHEDIVNDCTWHEFNE 219
           W+ +                               N + S  +  ++D V    +   + 
Sbjct: 133 WSPLREQSLLTLLPKSSEQSSKINHNQIAKIPPHVNNNQSTPILQNKDCVYQAQFSPHDN 192

Query: 220 NLFGSVSEDKTLQIHDKR-------TNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSL 272
           NL    S +  + + D R        NS +    L +   TLDF+K+   + A++G D+ 
Sbjct: 193 NLIACCSGNSYITLFDTREQNNRFNNNSFIAHSGLETL--TLDFNKYRPTVLASSGADNS 250

Query: 273 VYLYDLR-----NTADALHTMS----------GHEDSVTSLEFSPHKDGILCSSGSDRRV 317
           + ++D+R     N+ + +   S           H+ +V  + +SPH+  +L S+  D   
Sbjct: 251 IKIWDMRMIRNNNSNNTVMPTSNPICMNEIRKAHDLAVRRVVWSPHQSNLLLSTSYDMTS 310

Query: 318 LLW-----DLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDN 372
            +W     D  +I  +    D   G+ +    H        D+S  W  P  +A+   D+
Sbjct: 311 KVWKDFSFDGSKITGKTNSIDPGSGLIKTFHHHTEFVFGA-DWSL-WGQPGFIATTGWDS 368

Query: 373 IVHVWKV 379
            V++W  
Sbjct: 369 KVYIWNC 375

 Score = 34.3 bits (77), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 120 RARFMPQDPNFIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNG---YGLSFNPRTKGE 176
           +A+F P D N IA  +G   + LFD  +  N    + ++F   +G     L FN      
Sbjct: 184 QAQFSPHDNNLIACCSGNSYITLFDTREQNNR--FNNNSFIAHSGLETLTLDFNKYRPTV 241

Query: 177 LLSCSDDGTIALWN--VMGTNTSPSKAVTT------------HEDIVNDCTWHEFNENLF 222
           L S   D +I +W+  ++  N S +  + T            H+  V    W     NL 
Sbjct: 242 LASSGADNSIKIWDMRMIRNNNSNNTVMPTSNPICMNEIRKAHDLAVRRVVWSPHQSNLL 301

Query: 223 GSVSEDKTLQI 233
            S S D T ++
Sbjct: 302 LSTSYDMTSKV 312

>Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W
           (REAL)
          Length = 490

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 58/128 (45%), Gaps = 2/128 (1%)

Query: 184 GTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVH 243
             I LW+V      P   ++   D +    +++   ++  S   D ++ ++D RTNS   
Sbjct: 199 AKIQLWDV--NRVKPVSNLSWGADNITSVKFNQNETDILASTGSDNSIVLYDLRTNSPTQ 256

Query: 244 RLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPH 303
           ++  +   N + ++      F  A  D   Y YD+RN + +L+    H  +V  ++FSP 
Sbjct: 257 KIVQTMRTNAICWNPMEAFNFVIANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVDFSPT 316

Query: 304 KDGILCSS 311
            D I+  S
Sbjct: 317 GDEIVTGS 324

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 86/189 (45%), Gaps = 31/189 (16%)

Query: 160 HKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCT----WH 215
           H+D  Y ++ N  +  +L + S DG I  WN M T          +  I   C     +H
Sbjct: 66  HRDGVYAIAKNYGSLNKLATGSADGVIKYWN-MSTREEFVSFKAHYGLITGLCVTQPHFH 124

Query: 216 EF-----NENLFGSVSEDKTLQI--------HDKRTNST---------VHRLTLSSPFNT 253
           +      N+N   S S+DKT+++         +KR++           V      S F  
Sbjct: 125 DKKPDLKNQNFMLSCSDDKTVKLWSINVDDYSNKRSSDNDSVINEEGLVRTFDGESAFQG 184

Query: 254 LDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGS 313
           +D S    + FA  G  + + L+D+ N    +  +S   D++TS++F+ ++  IL S+GS
Sbjct: 185 ID-SHRVNSTFATGG--AKIQLWDV-NRVKPVSNLSWGADNITSVKFNQNETDILASTGS 240

Query: 314 DRRVLLWDL 322
           D  ++L+DL
Sbjct: 241 DNSIVLYDL 249

>CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa]
           {ON} highly similar to uniprot|Q12417 Saccharomyces
           cerevisiae YPL151c PRP46 Pre-mRNA splicing factor PRP46
          Length = 427

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 71/144 (49%), Gaps = 7/144 (4%)

Query: 181 SDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNS 240
           S+D TI +WN+       +  +  H+  V D      +  +F SVSEDKT++  D   N+
Sbjct: 135 SNDKTIKIWNLASGKLKVT--LKAHDMTVRDLAISNRHPYMF-SVSEDKTVKCWDLEKNT 191

Query: 241 TVHRLTLS-SPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLE 299
            +       S  +T+D    + ++   AG DS+V ++D+R     + T+ GH+  +T + 
Sbjct: 192 AIRNYHGHLSGVHTVDIHP-TVDVVVTAGRDSVVKVWDIRTRLPVM-TLPGHKGPITKVR 249

Query: 300 FSPHKDGILCSSGSDRRVLLWDLM 323
             P  D  + SS  D  + LWDL+
Sbjct: 250 CLP-VDPQVISSSVDASIRLWDLV 272

>KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {ON}
           Anc_3.25 YNL317W
          Length = 456

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 48/218 (22%), Positives = 87/218 (39%), Gaps = 18/218 (8%)

Query: 167 LSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVS 226
           +SFN     + ++CSDD  + +WN   +N    + ++ H   V  C WH     L  S S
Sbjct: 171 ISFN-NADSKFVTCSDDNILKIWNF--SNGQQERVLSGHHWDVKSCDWHP-TMGLIASAS 226

Query: 227 EDKTLQIHDKRTNSTVHR-LTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADAL 285
           +D  +++ D R+ + V   L          F     NL  A   D    ++D+R++   L
Sbjct: 227 KDNLIKLWDPRSGNCVSTILKFKHTVLKTRFQPTKGNLLVAISKDKSCRVFDIRHSMKEL 286

Query: 286 HTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMH 345
             +    D +T L + P  + +      D  +  +D++Q  S          +P      
Sbjct: 287 MVVRDEVDYMT-LLWHPINESVFTVGNYDGSLKHFDILQDLSNPTH-----SIP------ 334

Query: 346 AGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKL 383
             H   +   S+N  +  ++AS  +D  V  W  ++  
Sbjct: 335 FAHDKCITSMSYN-AMGTVLASASKDRTVRFWTRARPF 371

>TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa]
           {ON} Anc_2.283 YNL035C
          Length = 403

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 95/193 (49%), Gaps = 18/193 (9%)

Query: 163 NGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVND--CTWHEFNEN 220
           N + L F P     LL+   +G I++ +   TN    K +   E  +ND     + +N  
Sbjct: 14  NNWCLKFKPLYNYGLLTSLSNGEISILD-WKTNQIKDK-IKIGETSINDFEIVNNNYNGG 71

Query: 221 LFGSVSEDKTLQIHDKRTNSTVHRLT--LSSPFNTLDFSKHSQNLFAA----AGTDSLVY 274
                + +++++I+D ++N  +  +T   +SPF +LD S H  N+ A     +G D+ +Y
Sbjct: 72  SLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLD-SLH--NMMACGTELSGVDAELY 128

Query: 275 LYDLRNTADALHT-MSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQED 333
           +YD+R+    + + +  H D +T ++F P+   +L S  +D    ++DL    +E  +ED
Sbjct: 129 IYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDL----TETEEED 184

Query: 334 AADGVPELMMMHA 346
           +   V     +H+
Sbjct: 185 SLHQVINYSSIHS 197

>TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.122
           YGL003C
          Length = 556

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 75/144 (52%), Gaps = 11/144 (7%)

Query: 183 DGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRT-NST 241
           +G + +++V+       + ++ H+D V   +W   N ++  S S D+ +   D R  +S 
Sbjct: 313 NGLVEIYDVVKRKCI--RTLSGHKDRVACLSW---NNHILTSGSRDRRILHRDVRVPDSF 367

Query: 242 VHRL-TLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEF 300
             R+ T S     L ++  S N  A+ G D++VY+YD  + +  L     H  +V +L +
Sbjct: 368 FERIETHSQEVCGLKWNPES-NKLASGGNDNMVYVYDGTSRSPVLK-FEEHTAAVKALAW 425

Query: 301 SPHKDGILCSSG--SDRRVLLWDL 322
           SPHK GIL S G  +DR++  W++
Sbjct: 426 SPHKRGILASGGGTADRKLKTWNV 449

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 49/99 (49%), Gaps = 5/99 (5%)

Query: 224 SVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTAD 283
           +V+  K++ + D  +   VH     + + +L +     +L A    + LV +YD+     
Sbjct: 268 AVALGKSIFLTDNASGDVVHLCDTENEYTSLSWVGAGSHL-AIGQANGLVEIYDVVKRK- 325

Query: 284 ALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
            + T+SGH+D V  L ++ H   IL S   DRR+L  D+
Sbjct: 326 CIRTLSGHKDRVACLSWNNH---ILTSGSRDRRILHRDV 361

>Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}
           similar to Ashbya gossypii AAL157C
          Length = 484

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 60/117 (51%), Gaps = 4/117 (3%)

Query: 209 VNDCTWHEFNEN---LFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFA 265
           +++ T  +FN+N   L  S   D ++ ++D RTNS   ++  +   N++ ++      F 
Sbjct: 215 IDNITAVKFNQNEADLLLSSGSDNSVVLYDLRTNSPTQKIVQTMKTNSMCWNPMEPFNFV 274

Query: 266 AAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
            A  D   Y YD+RN + ALH    H  ++  ++ SP  + I+  S  D+ + ++++
Sbjct: 275 TANEDQNAYYYDMRNMSRALHVFKDHVSAIMDVDISPTGEEIVTGS-YDKTIRIFNI 330

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/217 (23%), Positives = 87/217 (40%), Gaps = 43/217 (19%)

Query: 143 FDRSKDKNEALVS---EHAF-----------HKDNGYGLSFNPRTKGELLSCSDDGTIAL 188
           F+R+++  +AL +   E  F           H+D  Y ++ N      L S S DG +  
Sbjct: 35  FERAREYTKALTATKLERMFAKPFVGQLGYGHRDGCYVIAKNYNVLNRLASASADGVVKY 94

Query: 189 WN----------------VMGTNTSPSKAVTTHEDIVNDC-------TWHEFNENLFGSV 225
           WN                V G   SP       +  +  C        W   +   F +V
Sbjct: 95  WNISTREELCSFKAHYGLVTGLCVSPQHIGNQSDSYMLSCGDDKMVKMW-SVDSGDFNNV 153

Query: 226 SEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADAL 285
            +D T  +H    N  +        F  +D  K + + F   G    + L+D+ N    L
Sbjct: 154 KDD-TKVLHPSDGNGLIKTFYGEHAFQGIDHHKENTS-FVTGGAQ--IELWDI-NRRKPL 208

Query: 286 HTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
             +S   D++T+++F+ ++  +L SSGSD  V+L+DL
Sbjct: 209 SNLSWGIDNITAVKFNQNEADLLLSSGSDNSVVLYDL 245

>Ecym_8044 Chr8 (97649..98584) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii ADR108C
          Length = 311

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 73/166 (43%), Gaps = 9/166 (5%)

Query: 176 ELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHD 235
           +LL+   +G + +++V  T     +    H+ +VN+       E+LFGSVS+D TL   D
Sbjct: 68  QLLAGCANGKVCIYDVE-TGRKMRQWGGGHKRVVNEIV-GLCEEHLFGSVSDDGTLCWWD 125

Query: 236 KRTNSTVHRLTLSSPFNTLDFSKHSQN-----LFAAAGTDSLVYLYDLRNTADAL-HTMS 289
            R    V R+    P  TL   +             +G + +V  YDLR   D +    +
Sbjct: 126 SRVRKPVGRVVGEFPLLTLALGRRGDGDERSPFLYTSGVEPVVRCYDLRKNTDLIAECET 185

Query: 290 GHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAA 335
            H   V+SL  S +   + CS G D  +   D+   G  + ++D A
Sbjct: 186 THATGVSSLCVSSNGSRV-CSLGFDDNLQFHDIDASGKLKNRQDGA 230

>Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 58/128 (45%), Gaps = 2/128 (1%)

Query: 184 GTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVH 243
             I LW+V      P   ++   D +    +++   ++  S   D ++ ++D RTNS   
Sbjct: 199 AKIHLWDV--NRLKPVSNLSWGADNITSVKFNQSETDILASTGSDNSIVLYDLRTNSPTQ 256

Query: 244 RLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPH 303
           ++  +   N + ++      F  A  D   Y YD+RN + +L+    H  +V  ++FSP 
Sbjct: 257 KIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVDFSPT 316

Query: 304 KDGILCSS 311
            D I+  S
Sbjct: 317 GDEIVTGS 324

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 85/189 (44%), Gaps = 31/189 (16%)

Query: 160 HKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCT----WH 215
           H+D  Y ++ N  +  +L + S DG I  WN M T          +  I   C     +H
Sbjct: 66  HRDGVYAIAKNYGSLNKLATGSADGVIKYWN-MSTREEFVSFKAHYGLITGLCVTQPRFH 124

Query: 216 EF-----NENLFGSVSEDKTLQI---------------HDKRTNST--VHRLTLSSPFNT 253
           +      N+N   S S+DKT+++               +D  TN    V      S F  
Sbjct: 125 DKKPDLKNQNFMLSCSDDKTVKLWSINVDDFSNKSSSDNDSVTNEEGLVRTFDGESAFQG 184

Query: 254 LDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGS 313
           +D S    + FA  G  + ++L+D+ N    +  +S   D++TS++F+  +  IL S+GS
Sbjct: 185 ID-SHRENSTFATGG--AKIHLWDV-NRLKPVSNLSWGADNITSVKFNQSETDILASTGS 240

Query: 314 DRRVLLWDL 322
           D  ++L+DL
Sbjct: 241 DNSIVLYDL 249

>ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL151C (PRP46)
          Length = 425

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 87/194 (44%), Gaps = 23/194 (11%)

Query: 167 LSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVS 226
           +  +P       + S+D TI +W++       +  +  H   V D      +  +F S S
Sbjct: 119 VCVDPVDNAWFATGSNDSTIRVWDLATGKLKVT--LQGHIMTVRDICISARHPYMF-SAS 175

Query: 227 EDKTLQIHDKRTNSTVHRL--TLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADA 284
           +DK ++  D   N+ V     TLS   +++D    S +L  +AG DS+V ++D+R+ +  
Sbjct: 176 QDKLVKCWDLERNTVVRDFHGTLSG-VHSVDLHP-SLDLIVSAGRDSVVRVWDIRSRSCV 233

Query: 285 LHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMM 344
           L T++GH   +  +   P  D  + S  +D  V LWDL+             G P   + 
Sbjct: 234 L-TLAGHRGPINKVRCLP-VDPQIVSCSTDATVKLWDLVA------------GKPMKTLT 279

Query: 345 HAGHKSAVNDFSFN 358
           H  HK  V D +FN
Sbjct: 280 H--HKRNVRDLAFN 291

>Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C
           (REAL)
          Length = 523

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 76/170 (44%), Gaps = 28/170 (16%)

Query: 177 LLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDK 236
           ++S S D T  +W++  ++   ++ +  H+  V D  +   +  LF S   D ++++ D 
Sbjct: 259 IISSSIDTTCIVWDLQSSHYVKTQLIA-HDSEVFDVRFLTKSTQLFASCGGDGSVRVFDL 317

Query: 237 RTNSTVHRLTLSSPFNT----------------------LDFSKHSQNLFA--AAGTDSL 272
           R  S  H   +  P  +                      L+ S +  N+ A  AA ++ +
Sbjct: 318 R--SLAHSTIIYEPPASSAPGLNADTTTPASKGSDALLRLEPSPYDPNVLATFAAESNKI 375

Query: 273 VYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
           + L D+RN    +  + GH  SV  +++ P K  +L S G D +VL WDL
Sbjct: 376 IIL-DMRNPESPILNLEGHSSSVNEIKWHPTKRNVLLSCGDDCQVLYWDL 424

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 33/73 (45%), Gaps = 3/73 (4%)

Query: 120 RARFMPQDPNFIATING-VGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELL 178
           R    P DPN +AT      K+ + D    ++  L  E   H  +   + ++P  +  LL
Sbjct: 354 RLEPSPYDPNVLATFAAESNKIIILDMRNPESPILNLEG--HSSSVNEIKWHPTKRNVLL 411

Query: 179 SCSDDGTIALWNV 191
           SC DD  +  W++
Sbjct: 412 SCGDDCQVLYWDL 424

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 33/167 (19%), Positives = 64/167 (38%), Gaps = 22/167 (13%)

Query: 176 ELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHD 235
           +L +CSD  ++ +WNV             HE+        +F E +  S+ +       +
Sbjct: 192 KLATCSD--SLRIWNV------------NHEE-------RQFQEQINLSLCKYNRQHPAN 230

Query: 236 KRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSV 295
                 +  +    P  + D++    NL  ++  D+   ++DL+++      +  H+  V
Sbjct: 231 PAATDDMKVIGTFPPITSFDWNMVDTNLIISSSIDTTCIVWDLQSSHYVKTQLIAHDSEV 290

Query: 296 TSLEFSPHKDGILCSSGSDRRVLLWDLMQIG-SEQAQEDAADGVPEL 341
             + F      +  S G D  V ++DL  +  S    E  A   P L
Sbjct: 291 FDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPASSAPGL 337

>Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C
           (REAL)
          Length = 451

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 76/157 (48%), Gaps = 7/157 (4%)

Query: 168 SFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSE 227
           + +P      ++ S+D T+ +W++       + A   H   V D    + +  LF SVSE
Sbjct: 146 AIDPVNNEWFITGSNDTTMKVWDLATGKLRTTLA--GHVMTVRDIAISDRHPYLF-SVSE 202

Query: 228 DKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKH-SQNLFAAAGTDSLVYLYDLRNTADALH 286
           DKT++  D   N  + R            S H + +L A AG DS++ L+D+R     + 
Sbjct: 203 DKTVKCWDLEKNQII-RDYYGHLSGVRTVSIHPTLDLIATAGRDSVIKLWDIRTRVPVI- 260

Query: 287 TMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLM 323
           T+ GH+  +  ++ +P  D  + SS +D  V LWD++
Sbjct: 261 TLVGHKGPINQVQCTP-VDPQIVSSSTDATVRLWDVV 296

>Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 72/189 (38%), Gaps = 54/189 (28%)

Query: 177 LLSCSDDGTIALWNV-----MGTNTSPSKAVTTHEDIV---------------------- 209
           +LSCSDD T+ LW++         +S + +VT  E +V                      
Sbjct: 136 MLSCSDDKTVKLWSINVDDYSNKRSSDNDSVTNEEGLVRTFDGESAFQGIDSHRENSTFA 195

Query: 210 ------------------------NDCTWHEFNEN---LFGSVSEDKTLQIHDKRTNSTV 242
                                   ++ T   FN+N   +  S   D ++ ++D RTNS  
Sbjct: 196 TGGAKIHLWDVNRLKPISNLSWGADNITSVRFNQNETDILASTGSDNSIVLYDLRTNSPT 255

Query: 243 HRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSP 302
            ++  +   N + ++      F  A  D   Y YD+RN + +L     H  +V  ++FSP
Sbjct: 256 QKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLTVFKDHVSAVMDVDFSP 315

Query: 303 HKDGILCSS 311
             D I+  S
Sbjct: 316 TGDEIVTGS 324

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 85/189 (44%), Gaps = 31/189 (16%)

Query: 160 HKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCT----WH 215
           H+D  Y ++ N  +  +L + S DG I  WN M T          +  I   C     +H
Sbjct: 66  HRDGIYAIAKNYGSLNKLATGSADGVIKYWN-MSTREEFVSFKAHYGLITGLCVTQPHFH 124

Query: 216 EF-----NENLFGSVSEDKTLQI---------------HDKRTNST--VHRLTLSSPFNT 253
           +      N+N   S S+DKT+++               +D  TN    V      S F  
Sbjct: 125 DKKSDWKNQNFMLSCSDDKTVKLWSINVDDYSNKRSSDNDSVTNEEGLVRTFDGESAFQG 184

Query: 254 LDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGS 313
           +D S    + FA  G  + ++L+D+ N    +  +S   D++TS+ F+ ++  IL S+GS
Sbjct: 185 ID-SHRENSTFATGG--AKIHLWDV-NRLKPISNLSWGADNITSVRFNQNETDILASTGS 240

Query: 314 DRRVLLWDL 322
           D  ++L+DL
Sbjct: 241 DNSIVLYDL 249

>NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672
          Length = 434

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 88/193 (45%), Gaps = 21/193 (10%)

Query: 167 LSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVS 226
           ++ +P      ++ S+D TI +W++   +   + A   H   V D    E +  +F S S
Sbjct: 128 VAVDPIDNEWFVTGSNDATIKIWDLAKGHLKLTLA--GHAMTVRDIAISERHPYMF-SAS 184

Query: 227 EDKTLQIHDKRTNSTVHRLTLS-SPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADAL 285
           EDK ++  D   N+ +       S  +++D    + +L A AG DS+V L+D+R     +
Sbjct: 185 EDKLVKCWDLEKNTAIRDYHGHLSGVHSVDIHP-TLDLIATAGRDSVVRLWDIRARVSVM 243

Query: 286 HTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMH 345
            T+ GH+  +  +   P  D  + S  +D  + LWD++             G    ++ H
Sbjct: 244 -TLIGHKSPINKVHCLP-VDPQIVSCSTDATIRLWDIIA------------GKSRKVLTH 289

Query: 346 AGHKSAVNDFSFN 358
             HK +V D SF+
Sbjct: 290 --HKKSVRDMSFH 300

 Score = 36.6 bits (83), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 62/140 (44%), Gaps = 17/140 (12%)

Query: 176 ELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHD 235
           +++SCS D TI LW+++   +   K +T H+  V D ++H    ++  + ++D       
Sbjct: 263 QIVSCSTDATIRLWDIIAGKS--RKVLTHHKKSVRDMSFHPREFSMVSASTDDIRSWRLP 320

Query: 236 KRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSV 295
           +    T      S   N+L  S +  N+  A G +  +  YD +         SGH+   
Sbjct: 321 EGALLTNFNSEKSGIINSL--SVNQDNVLCAGGDNGTLSFYDYK---------SGHKYQT 369

Query: 296 TSLEFSP----HKDGILCSS 311
            + +  P     + GILCS+
Sbjct: 370 LATKEIPGSLGSERGILCST 389

>KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25
           YNL317W
          Length = 452

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 79/211 (37%), Gaps = 21/211 (9%)

Query: 176 ELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHD 235
           + +SCSDD  + +WN   TN    + +T H   V  C WH     L  S S+D  +++ D
Sbjct: 180 KFVSCSDDNILKIWNF--TNGQQERVLTGHHWDVKSCDWHP-TMGLIASASKDNLVKLWD 236

Query: 236 KRTNSTVHR-LTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDS 294
            RT + V   L          F     NL      D    ++D+R     L       D 
Sbjct: 237 PRTGNCVSTILKFKHTVLKTRFQPGGGNLLLGISKDKSCRVFDIRQNMTELMVFRDDVDY 296

Query: 295 VTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVND 354
           +T L + P           D  +  +D++Q           D    + ++   H   V  
Sbjct: 297 MT-LLWHPINHSTFTVGNYDGSIKHFDVLQ-----------DITKPVHVIPFAHDKCVTS 344

Query: 355 FSFN--WNIPWLMASVEEDNIVHVWKVSKKL 383
            S+N   NI   +AS  +D  +  W  ++ +
Sbjct: 345 LSYNPAGNI---LASASKDRTIRFWTRARPV 372

>TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {ON}
           Anc_5.201 YLL011W
          Length = 473

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 66/137 (48%), Gaps = 3/137 (2%)

Query: 186 IALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRL 245
           I LW+   +N  P   ++   D V +  +++   ++  S   D ++ ++D RTNS   ++
Sbjct: 194 IELWDSNRSN--PISNLSWGADNVTNVKFNQNEHDILASTGSDNSIVLYDLRTNSPTQKI 251

Query: 246 TLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKD 305
             +   N+L ++      F  A  D   Y YD+R  + AL+    H  +V  ++FSP   
Sbjct: 252 VQTMRTNSLCWNPMEAFNFVTANEDQNSYYYDMRYMSRALNVFKDHVSAVMDVDFSPTGQ 311

Query: 306 GILCSSGSDRRVLLWDL 322
            I+  S  D+ + ++++
Sbjct: 312 EIVTGS-YDKTIRIYNI 327

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 82/181 (45%), Gaps = 22/181 (12%)

Query: 160 HKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCT--WHEF 217
           H+D  Y ++ N     +L S S DG I  WN M T    +     +  +   C     E 
Sbjct: 66  HRDGVYHIAKNYNNLNKLASASADGIIKYWN-MSTREEYASFKAHYGLVTGLCVTPVSEK 124

Query: 218 NENLFGSVSEDKTLQI----HDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTD--- 270
           N+    S  +DK +++     D   ++       ++  N L  + +SQN  A  G D   
Sbjct: 125 NKQFMLSAGDDKMIKLWSIESDDFADNKNEDDNDNNTSNGLIKTFYSQN--AIQGLDHHR 182

Query: 271 ---------SLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWD 321
                     ++ L+D  N ++ +  +S   D+VT+++F+ ++  IL S+GSD  ++L+D
Sbjct: 183 IDPTFVTGGPMIELWD-SNRSNPISNLSWGADNVTNVKFNQNEHDILASTGSDNSIVLYD 241

Query: 322 L 322
           L
Sbjct: 242 L 242

>SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 470

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 48/204 (23%), Positives = 96/204 (47%), Gaps = 8/204 (3%)

Query: 124 MPQDPNFIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDD 183
           +  D + +AT +  G + +   S +  E + +    H     G+ +NP     L++ + +
Sbjct: 190 ISSDDSMVATCSWGGDLKIL--STETLEIIKAFDTAHDSKIGGVDWNPDGTA-LVTGAAN 246

Query: 184 GTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVH 243
           G I +WN+   + SP+  +T HE+ V    +H   + +  S S D T ++ D      + 
Sbjct: 247 GEIRIWNLNNDSESPAGTLTGHENRVARVRFHPSGKYV-ASASFDMTWRLWDVEKQIELQ 305

Query: 244 -RLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSP 302
            +   +     + F K   +L  + G DS+  ++DLR +  ++  + GH   +  L++SP
Sbjct: 306 LQEGHAKEVYCVAFQKDG-SLLCSTGLDSVGLVWDLR-SGKSIMALEGHIKPIYGLDWSP 363

Query: 303 HKDGILCSSGSDRRVLLWDLMQIG 326
           +   I   S +D  + LWD+ ++G
Sbjct: 364 NGYDIATGS-ADGTIRLWDVRKVG 386

>NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {ON}
           Anc_8.435
          Length = 857

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 77/172 (44%), Gaps = 33/172 (19%)

Query: 242 VHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFS 301
           +  L LSSP   +D    S  L A  GTD  + + D+ N     H+  GH  +++S++F 
Sbjct: 112 IKTLKLSSPSYIMDCDSTS-TLVAVGGTDGSIIVVDIEN-GFITHSFKGHGGTISSVKFY 169

Query: 302 PHKDG---ILCSSGSDRRVLLWDLMQ---IGSEQAQEDAADGVPELMMMHAGHKSAVNDF 355
            + D    +LCS  ++  V +WDL++   I + Q    A  G      +     S  ND 
Sbjct: 170 GNNDTNCWLLCSGDTNGMVKIWDLVKRSCIHTLQEHNSAVRG------LDVRSVSKEND- 222

Query: 356 SFNWNIPWLMASVEEDNIVHVWK--------------VSKKLTSPGLIQDYD 393
               N+   + S   DNIV++W+              V++++ S G I D+D
Sbjct: 223 ----NVVLQLLSGSRDNIVNLWEFNLRKLCKLLKTLPVNQQVESCGFIHDHD 270

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 89/186 (47%), Gaps = 19/186 (10%)

Query: 144 DRSKDKNEAL-VSE---HAFHKD-NGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSP 198
           D SKDK   + VSE   HA  KD N   +S N      + + S D +  LWN+       
Sbjct: 512 DESKDKTHIIKVSEYTRHAHDKDINSISISPNDSL---IATGSYDKSCKLWNLDSGELVA 568

Query: 199 SKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSK 258
           +  +  H+  + D ++ +F++ L  + S DKT+++    T + +   T +   N +    
Sbjct: 569 T--LNNHKRGIWDVSFCQFDK-LIATCSGDKTIKLWSLDTFAVLK--TFAGHTNAVQRCT 623

Query: 259 --HSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDG-ILCSSGSDR 315
             + Q    ++G D L+ ++D   T D L T+ GH++ + +L  +   DG ++ S+ +D 
Sbjct: 624 FINKQKQLVSSGADGLIKIWDC-TTGDCLKTLDGHDNRIWAL--TTWNDGELIVSADADG 680

Query: 316 RVLLWD 321
            +  W+
Sbjct: 681 VLQFWN 686

>YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON}
           PRP46Member of the NineTeen Complex (NTC) that contains
           Prp19p and stabilizes U6 snRNA in catalytic forms of the
           spliceosome containing U2, U5, and U6 snRNAs
          Length = 451

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 77/158 (48%), Gaps = 7/158 (4%)

Query: 167 LSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVS 226
           ++ +P      ++ S+D T+ +W++       + A   H   V D    + +  LF SVS
Sbjct: 145 VAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTLA--GHVMTVRDVAVSDRHPYLF-SVS 201

Query: 227 EDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKH-SQNLFAAAGTDSLVYLYDLRNTADAL 285
           EDKT++  D   N  + R            S H + +L A AG DS++ L+D+R     +
Sbjct: 202 EDKTVKCWDLEKNQII-RDYYGHLSGVRTVSIHPTLDLIATAGRDSVIKLWDMRTRIPVI 260

Query: 286 HTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLM 323
            T+ GH+  +  ++ +P  D  + SS +D  V LWD++
Sbjct: 261 -TLVGHKGPINQVQCTP-VDPQVVSSSTDATVRLWDVV 296

>Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178W
           (REAL)
          Length = 465

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 81/177 (45%), Gaps = 25/177 (14%)

Query: 160 HKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKA---------VTTHEDIVN 210
           HK     + ++P +  +++SC++DG I        N   SK          +  HE  V+
Sbjct: 217 HKGKIGAVQWHPESNNQIISCAEDGHIK-------NFQYSKEEGEIKLLGDLVGHERRVS 269

Query: 211 DCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQ---NLFAAA 267
           D  +H   + L GS S D T ++ D    ST   L L        FS   Q   +L  + 
Sbjct: 270 DVKYHPSGK-LIGSASHDMTWRLWDA---STYQELLLQEGHTEGVFSLSFQCDGSLVCSG 325

Query: 268 GTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQ 324
           G D+L  ++D+R + + + T++GH   V ++ +S +   +  + G D  + +WD+ Q
Sbjct: 326 GMDTLSMIWDIR-SGNKVMTLTGHSKPVYTVAWSTNGYQV-ATGGGDGLINVWDIRQ 380

>Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {ON}
           YLR222C (REAL)
          Length = 818

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 69/151 (45%), Gaps = 19/151 (12%)

Query: 225 VSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADA 284
           VS+ + L+I   +T   V  + +SSP   LD +  +  L A  GTD  + + D+ N    
Sbjct: 79  VSQAQLLKIFQLKTGKVVRSMKISSPSYILD-TDSTSTLLAVGGTDGSIIVVDIEN-GYI 136

Query: 285 LHTMSGHEDSVTSLEFSPHKDG---ILCSSGSDRRVLLWDLMQ--------------IGS 327
            H++ GH  +++SL+F    D    +L S  ++  V +WDL++               G 
Sbjct: 137 THSLKGHGGTISSLKFYGQLDSKVWLLASGDTNGMVKVWDLVKRKCLHTLQEHTSAVRGL 196

Query: 328 EQAQEDAADGVPELMMMHAGHKSAVNDFSFN 358
           +  + +  DG   L ++  G    VN + F+
Sbjct: 197 DITEVENNDGPSHLKLISGGRDDIVNFWDFD 227

>ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} similar
           to uniprot|Q12417 Saccharomyces cerevisiae YPL151C PRP46
           Splicing factor that is found in the Cef1p subcomplex of
           the spliceosome
          Length = 427

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 87/193 (45%), Gaps = 21/193 (10%)

Query: 167 LSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVS 226
           L  +P       + S+D T+ +W++       + A   H   V D    + +  LF S S
Sbjct: 121 LKVDPVDNEWFATGSNDTTVKIWDLASGKLKLTLA--GHVMTVRDVAISQRHPYLF-SAS 177

Query: 227 EDKTLQIHDKRTNSTVHRLTLS-SPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADAL 285
           EDK ++  D   N  +       S  +T+D    + +L A+AG D +V L+D+R+   A+
Sbjct: 178 EDKMVKCWDLEKNQIIRDYHGHLSGVHTVDIHP-TLDLIASAGRDGVVKLWDIRSRT-AV 235

Query: 286 HTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMH 345
            T+ GH+  +T +   P    ++ SS +D  V LWD+              G    ++ H
Sbjct: 236 MTLIGHKSPITKVHCLPVNPQVV-SSSTDATVRLWDVTA------------GKSYKILTH 282

Query: 346 AGHKSAVNDFSFN 358
             HK +V DFS +
Sbjct: 283 --HKRSVRDFSLH 293

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 46/108 (42%), Gaps = 19/108 (17%)

Query: 285 LHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMM 344
           +  ++GH   V  L+  P  +    +  +D  V +WDL            A G  +L + 
Sbjct: 108 IRVINGHVGWVRCLKVDPVDNEWFATGSNDTTVKIWDL------------ASG--KLKLT 153

Query: 345 HAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKLTSPGLIQDY 392
            AGH   V D + +   P+L  S  ED +V  W + K      +I+DY
Sbjct: 154 LAGHVMTVRDVAISQRHPYLF-SASEDKMVKCWDLEKN----QIIRDY 196

>KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.325
           YCR057C
          Length = 918

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 54/240 (22%), Positives = 109/240 (45%), Gaps = 16/240 (6%)

Query: 124 MPQDPNFIATINGVGKVFLFDRSKD--------KNEALVSEHAFHKDNGYGLSFNPRTKG 175
           M Q+P    T+N  G+   F  SK         ++E+ + +   H D+   L+++P    
Sbjct: 296 MGQNPVNTVTVNSTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNSLTYSP-DGS 354

Query: 176 ELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHD 235
            +++ ++DG I +W+V+      +  +  H   V    + +  + LF S S D T++  D
Sbjct: 355 RVVTAAEDGKIKVWDVVSGFCLAT--LDEHTAAVTQVQFAKKGQVLF-SASLDGTVKAWD 411

Query: 236 --KRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHED 293
             +  N  V        FN+L      + + A +  +  ++++ ++ T   L ++SGHE 
Sbjct: 412 LIRYRNFRVFTAAERIQFNSLAVDPSGEVVCAGSMDNFDIHVWSVQ-TGQLLDSLSGHEG 470

Query: 294 SVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVN 353
            V+ L FS  ++G+L S+  D+ + +W +     +    +    V  L +   G + AV+
Sbjct: 471 PVSCLAFS-QENGVLASASWDKTIRIWYIFGRSQQVDPIEVYSDVLSLTIRPDGKQVAVS 529

>Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}
           YCR057C (REAL)
          Length = 920

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 54/246 (21%), Positives = 109/246 (44%), Gaps = 28/246 (11%)

Query: 124 MPQDPNFIATINGVGKVFLFDRSKD--------KNEALVSEHAFHKDNGYGLSFNPRTKG 175
           M Q+P    T+N  G+   F  SK         ++E+ + +   H D+   L+++P    
Sbjct: 300 MGQNPVNTVTVNNTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNSLAYSP-DGS 358

Query: 176 ELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEF--------NENLFGSVSE 227
            +++ SDDG I +W+V     +    + T E+  +  T  +F        + ++ G+V  
Sbjct: 359 RVVTASDDGKIKVWDV-----TSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSMDGTVRA 413

Query: 228 DKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHT 287
              ++  + RT +   R+     FN L      + + A +  +  ++++ ++ T   L  
Sbjct: 414 WDLIRYRNFRTFTGTERI----QFNCLAVDPSGEVVCAGSLDNFDIHVWSVQ-TGQLLDA 468

Query: 288 MSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAG 347
           +SGHE  V+ L FS  ++ +L S+  D+ + +W +     +    +    V  L M   G
Sbjct: 469 LSGHEGPVSCLSFS-QENSVLASASWDKTIRIWSIFGRSQQVEPLEVYSDVLALSMRPDG 527

Query: 348 HKSAVN 353
            + AV+
Sbjct: 528 KEVAVS 533

>SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some
           similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 660

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 61/247 (24%), Positives = 100/247 (40%), Gaps = 45/247 (18%)

Query: 160 HKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNE 219
           H+ + Y L + P +  +L+S S D T+ +W++     S + ++   ED V          
Sbjct: 419 HEQDIYSLDYFP-SGDKLVSGSGDRTVRIWDLRTGQCSLTLSI---EDGVTTVAVSPGEG 474

Query: 220 NLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNT--------LDFSKHSQNLFAAAGTDS 271
               + S D+TL++ D  T   V RL   +   T        + F++  Q + + +  D 
Sbjct: 475 KFIAAGSLDRTLRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGQGVVSGS-LDR 533

Query: 272 LVYLYDLRNT------------ADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLL 319
            V L++L NT            A    T +GH+D V S+  +   D  + S   DR VL 
Sbjct: 534 SVKLWNLHNTGSSSKNDSKPTAATCEVTYTGHKDFVLSVATT-QNDKYILSGSKDRGVLF 592

Query: 320 WDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPW-----LMASVEEDNIV 374
           WD               G P LM+   GH+++V   +     P      + A+   D   
Sbjct: 593 WDTQ------------SGNPLLMLQ--GHRNSVISVAVANGFPLGPDYGVFATGSGDCKA 638

Query: 375 HVWKVSK 381
            +WK SK
Sbjct: 639 RIWKYSK 645

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 56/218 (25%), Positives = 100/218 (45%), Gaps = 20/218 (9%)

Query: 167 LSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTT---HEDIVNDCTWHEFNENLFG 223
           + F+P  K  L + ++D  I +W++     S  + V T   HE  +    +    + L  
Sbjct: 384 VCFSPDGKF-LATGAEDKLIRIWDL-----STKRIVMTLQGHEQDIYSLDYFPSGDKLV- 436

Query: 224 SVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYD-----L 278
           S S D+T++I D RT      L++     T+  S       AA   D  + ++D     L
Sbjct: 437 SGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTLRVWDSETGFL 496

Query: 279 RNTADALHTM-SGHEDSVTSLEFSPHKDGILCSSGS-DRRVLLWDLMQIGSEQAQEDAAD 336
               D+ + + +GH+DSV S+ F+  +DG    SGS DR V LW+L   GS  ++ D+  
Sbjct: 497 VERLDSENELGTGHKDSVYSVVFT--RDGQGVVSGSLDRSVKLWNLHNTGSS-SKNDSKP 553

Query: 337 GVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIV 374
                 + + GHK  V   +   N  ++++  ++  ++
Sbjct: 554 TAATCEVTYTGHKDFVLSVATTQNDKYILSGSKDRGVL 591

>TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.276
           YPL247C
          Length = 531

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 78/191 (40%), Gaps = 38/191 (19%)

Query: 169 FNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSED 228
           +NP     L+S S D T  +W++   N   ++ +  H+  V D  +   +  LF S   D
Sbjct: 251 WNPIDTNFLISSSIDTTCIVWDLQSNNYVKTQLI-AHDSEVFDVRFLTQSTQLFASCGGD 309

Query: 229 KTLQIHDKR---------------------------------TNSTVHRLTLSSPFNT-- 253
            ++++ D R                                 T+S V  + LSS  N   
Sbjct: 310 GSVRVFDLRSLAHSTIIYESAANTSMSNLSSGGMVDHPGSLNTSSRVGSVDLSSKSNALL 369

Query: 254 -LDFSKHSQNLFAAAGTDS-LVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSS 311
            L+ S    N+ A  G DS  V + D+RN    + T+ GH   +  +++ P K   + SS
Sbjct: 370 RLEPSPTDPNVIATFGADSNSVLILDMRNPGTPVLTLDGHSAPINQIKWHPTKKNTILSS 429

Query: 312 GSDRRVLLWDL 322
             D +VL W+L
Sbjct: 430 SDDCQVLYWNL 440

>Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {ON}
           YPL151C (REAL)
          Length = 451

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 76/157 (48%), Gaps = 7/157 (4%)

Query: 168 SFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSE 227
           + +P      ++ S+D T+ +W++       + A   H   V D    + +  LF SVSE
Sbjct: 146 AIDPVDNEWFVTGSNDTTMKVWDLATGKLKTTLA--GHVMTVRDIAVSDRHPYLF-SVSE 202

Query: 228 DKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKH-SQNLFAAAGTDSLVYLYDLRNTADALH 286
           DKT++  D   N  + R            S H + +L A AG DS+V L+D+R     + 
Sbjct: 203 DKTVKCWDLEKNHII-RDYYGHLSGVRTVSIHPTLDLIATAGRDSVVKLWDIRTRMPVI- 260

Query: 287 TMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLM 323
           T+ GH+  +  ++ +P  D  + SS +D  V LWD++
Sbjct: 261 TLVGHKGPINQVQCTP-VDPQIVSSSTDATVRLWDIV 296

>YDR142C Chr4 complement(740473..741600) [1128 bp, 375 aa] {ON}
           PEX7Peroxisomal signal receptor for the N-terminal
           nonapeptide signal (PTS2) of peroxisomal matrix
           proteins; WD repeat protein; defects in human homolog
           cause lethal rhizomelic chondrodysplasia punctata (RCDP)
          Length = 375

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/228 (21%), Positives = 94/228 (41%), Gaps = 38/228 (16%)

Query: 136 GVGKVFLFDRSKDKNEALVSEHAF-HKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGT 194
           G GK+F+ +   D++  +V  ++F  +D  + L++N   + ++L    DGT+ L++    
Sbjct: 36  GNGKLFILE--IDRSGRIVEVNSFLTQDCLFDLAWNESHENQVLVAQGDGTLRLFDTT-F 92

Query: 195 NTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLT-------- 246
              P      HE  V  C W+  N   F S S D +++I       ++  LT        
Sbjct: 93  KEFPIAIFKEHEREVFSCNWNLVNRQNFLSSSWDGSIKIWSPLRKQSLMTLTPRPLEITK 152

Query: 247 LSSPFNTL--------------------DFSKHSQNLFAAAGTDSLVYLYDLR----NTA 282
           +  P N +                     FS H QNL  +   +S   L+D+R       
Sbjct: 153 MVDPLNAIILKKKSFTGISKNRNCVYQAQFSPHDQNLVLSCSGNSYASLFDIRLPSGKNQ 212

Query: 283 DALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQA 330
           +     SG E    + +F+ ++  ++ + G D  + +WD+  +   ++
Sbjct: 213 NNFLVHSGLE--ALTCDFNKYRPYVVATGGVDNAIRIWDIRMLNKNES 258

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 65/302 (21%), Positives = 114/302 (37%), Gaps = 57/302 (18%)

Query: 129 NFIATINGVGKVFLFDRS-KDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIA 187
           N +    G G + LFD + K+   A+  EH   +   +  ++N   +   LS S DG+I 
Sbjct: 74  NQVLVAQGDGTLRLFDTTFKEFPIAIFKEH---EREVFSCNWNLVNRQNFLSSSWDGSIK 130

Query: 188 LW-------------------------NVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLF 222
           +W                         N +         ++ + + V    +   ++NL 
Sbjct: 131 IWSPLRKQSLMTLTPRPLEITKMVDPLNAIILKKKSFTGISKNRNCVYQAQFSPHDQNLV 190

Query: 223 GSVSEDKTLQIHDKRTNSTVHR--LTLSSPFN--TLDFSKHSQNLFAAAGTDSLVYLYDL 278
            S S +    + D R  S  ++    + S     T DF+K+   + A  G D+ + ++D+
Sbjct: 191 LSCSGNSYASLFDIRLPSGKNQNNFLVHSGLEALTCDFNKYRPYVVATGGVDNAIRIWDI 250

Query: 279 R-----NTADALHTMSG--------------HEDSVTSLEFSPHKDGILCSSGSDRRVLL 319
           R      +A    T+ G              H  ++  + +SPH   IL S+  D    +
Sbjct: 251 RMLNKNESATIKRTVPGQLHNSSCINEIPNAHGLAIRKVTWSPHHSNILMSASYDMTCRI 310

Query: 320 W-DLMQIGS-EQAQEDAADGVPELMMMHAGHKSAV--NDFSFNWNIPWLMASVEEDNIVH 375
           W DL   G+ E  + ++ D     +     H   V   D+S  W  P  +AS   D  + 
Sbjct: 311 WRDLSNDGAKETYKTNSTDATKGSIFNFTQHSEFVFGADWSL-WGKPGYVASTAWDGNLF 369

Query: 376 VW 377
           VW
Sbjct: 370 VW 371

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 65/179 (36%), Gaps = 41/179 (22%)

Query: 120 RARFMPQDPNFIATINGVGKVFLFD----RSKDKNEALVSEHAFHKDNGYGLSFNPRTKG 175
           +A+F P D N + + +G     LFD      K++N  LV              FN     
Sbjct: 179 QAQFSPHDQNLVLSCSGNSYASLFDIRLPSGKNQNNFLVHSGL----EALTCDFNKYRPY 234

Query: 176 ELLSCSDDGTIALWNVMGTNTSPSKAV------------------TTHEDIVNDCTWHEF 217
            + +   D  I +W++   N + S  +                    H   +   TW   
Sbjct: 235 VVATGGVDNAIRIWDIRMLNKNESATIKRTVPGQLHNSSCINEIPNAHGLAIRKVTWSPH 294

Query: 218 NENLFGSVSEDKTLQI----------HDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAA 266
           + N+  S S D T +I             +TNST    T  S FN   F++HS+ +F A
Sbjct: 295 HSNILMSASYDMTCRIWRDLSNDGAKETYKTNST--DATKGSIFN---FTQHSEFVFGA 348

>KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa]
           {ON} Anc_4.309 YLR429W
          Length = 620

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 71/175 (40%), Gaps = 20/175 (11%)

Query: 169 FNPRTKGELLSCSDDGTIALWNV--------------MGTNTSPSKAVTTHEDIVNDCTW 214
           F+P     + SCSDD  IA+W +                 +  P K +  H   V    +
Sbjct: 89  FDPFNDRRIASCSDDSKIAIWEIPEDYSFHKYVDADNEPKDVKPVKWLAGHGRKVGHVLF 148

Query: 215 HEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVY 274
           H   EN+  S S D T++I +  T   V+ L       ++ FS +  +L A  G D  + 
Sbjct: 149 HPVAENILASSSLDYTVKIWNVETGEVVYTLKHPDMVTSMSFSYNGAHL-ATVGRDKKLR 207

Query: 275 LYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSG----SDRRVLLWDLMQI 325
           ++D+R     +   + H  + T           L ++G    SDR++ +WD   +
Sbjct: 208 VWDIR-AEKIVSEGAAHAGAKTQRVIWLGNSDRLATTGFSRLSDRQIGIWDAFNL 261

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 25/117 (21%), Positives = 49/117 (41%), Gaps = 2/117 (1%)

Query: 265 AAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQ 324
           +  G  +++ + ++    D +    GH   V   +F P  D  + S   D ++ +W++ +
Sbjct: 54  SGGGAFAVIPVEEVGKAPDQVPLFRGHTAQVLDTDFDPFNDRRIASCSDDSKIAIWEIPE 113

Query: 325 IGSEQAQEDAADGVPELMMMH--AGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKV 379
             S     DA +   ++  +   AGH   V    F+     ++AS   D  V +W V
Sbjct: 114 DYSFHKYVDADNEPKDVKPVKWLAGHGRKVGHVLFHPVAENILASSSLDYTVKIWNV 170

>YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splicing
           factor, component of the U4/U6-U5 snRNP complex
          Length = 465

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 79/164 (48%), Gaps = 15/164 (9%)

Query: 166 GLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKA----VTTHEDIVNDCTWHEFNENL 221
            + ++P +  +++SC++DG I   N   +N          +  HE  ++D  +H   +  
Sbjct: 223 AIDWHPDSNNQMISCAEDGLIK--NFQYSNEEGGLRLLGDLVGHERRISDVKYHPSGK-F 279

Query: 222 FGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQ---NLFAAAGTDSLVYLYDL 278
            GS S D T ++ D    ST   L L    +   FS   Q   +L  + G DSL  L+D+
Sbjct: 280 IGSASHDMTWRLWDA---STHQELLLQEGHDKGVFSLSFQCDGSLVCSGGMDSLSMLWDI 336

Query: 279 RNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
           R+ +  + T++GH   + ++ +SP+   +  + G D  + +WD+
Sbjct: 337 RSGSKVM-TLAGHSKPIYTVAWSPNGYQV-ATGGGDGIINVWDI 378

>ZYRO0F06776g Chr6 (555965..557263) [1299 bp, 432 aa] {ON} similar
           to uniprot|Q12206 Saccharomyces cerevisiae YOR229W WTM2
           WD repeat containing transcriptional modulator 2
           Transcriptional modulator
          Length = 432

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/226 (24%), Positives = 94/226 (41%), Gaps = 20/226 (8%)

Query: 172 RTKGELLSCSDD-----GTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVS 226
           R K EL+ C  D      TI + +      +P +       +++  ++   + NL+ + S
Sbjct: 193 RDKKELVKCQADRKEGQSTIKIVDNSDKVGTPLRRFNVEASVIHSVSF--LDNNLYVTCS 250

Query: 227 EDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQ-NLFAAAGTDS-LVYLYDLRNTADA 284
           ++  +   DKR++S +   T S   N    S  SQ + F A GTD+ ++ L+DLR     
Sbjct: 251 DENVVSFWDKRSDSQLWSFTDSQDGNITSLSSSSQLDGFFATGTDAGVIKLWDLRAIMSQ 310

Query: 285 LHTM----SGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPE 340
              M      +ED V  L+FSP       S G    V  WD     + +  ++    +  
Sbjct: 311 QQEMVSFYHSNEDPVVDLQFSPTNSTEFLSVGKSGNVYQWDTDFFFTNEEVDEEDLHLQC 370

Query: 341 LMMMHAG---HKSAVNDFS--FNWN--IPWLMASVEEDNIVHVWKV 379
           L  +H G        ND     NW+  I  L+ +++ D  +  +K 
Sbjct: 371 LKFLHTGGSRRSIGANDKRNMVNWHPAIDQLVGTIDNDCSIAAYKA 416

>Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to
           Ashbya gossypii AEL246C
          Length = 800

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 69/249 (27%), Positives = 112/249 (44%), Gaps = 32/249 (12%)

Query: 146 SKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTH 205
           SK K  +  +    H    Y +SF+P  +  L+S S+D T+ LW+ + T T    +   H
Sbjct: 512 SKSKEASNTTTLIGHSGPVYSVSFSPDNR-YLVSASEDKTVRLWS-LDTFTC-LVSYKGH 568

Query: 206 EDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTL-SSPFNTLD-FSKHSQNL 263
              V D  +     + F +VS D+T ++    +   ++ L + +   N +D  + H    
Sbjct: 569 NHPVWDVKFSPLG-HYFATVSHDQTARLW---SCDHIYPLRIFAGHLNDVDCVAFHPNGT 624

Query: 264 FAAAGT-DSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGS-DRRVLLWD 321
           +   G+ D    ++D++ T D++    GH  SV S+  SP  DG   ++GS D  +++WD
Sbjct: 625 YVLTGSSDKTCRMWDIQ-TGDSVRLFLGHTASVVSVAVSP--DGRWLTTGSEDGVIIVWD 681

Query: 322 LMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFN--WNIPWLMASVEEDNIVHVWKV 379
              IG+ +           +  M    KSAVN  SFN   NI   + S   D  V VW +
Sbjct: 682 ---IGTGK----------RIKQMRGHGKSAVNSLSFNKEGNI---LVSGGADQSVRVWDL 725

Query: 380 SKKLTSPGL 388
            K    P L
Sbjct: 726 KKFTNEPAL 734

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 76/157 (48%), Gaps = 10/157 (6%)

Query: 179 SCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRT 238
           + S D T  LW+    +  P +    H + V DC     N     + S DKT ++ D +T
Sbjct: 586 TVSHDQTARLWSC--DHIYPLRIFAGHLNDV-DCVAFHPNGTYVLTGSSDKTCRMWDIQT 642

Query: 239 NSTVHRLTLSSPFNTLDFSKHSQNLFAAAGT-DSLVYLYDLRNTADALHTMSGH-EDSVT 296
             +V RL L    + +  +      +   G+ D ++ ++D+  T   +  M GH + +V 
Sbjct: 643 GDSV-RLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDI-GTGKRIKQMRGHGKSAVN 700

Query: 297 SLEFSPHKDG-ILCSSGSDRRVLLWDLMQIGSEQAQE 332
           SL F  +K+G IL S G+D+ V +WDL +  +E A E
Sbjct: 701 SLSF--NKEGNILVSGGADQSVRVWDLKKFTNEPALE 735

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 54/137 (39%), Gaps = 29/137 (21%)

Query: 253 TLDFSKHSQNLFAAAGTDSLVYLYDLRNT------------ADALHTMSGHEDSVTSLEF 300
           +L FS+ S+ L AA   DS + ++ L  T            A    T+ GH   V S+ F
Sbjct: 477 SLQFSEDSR-LVAAGFQDSHIKIWSLDGTPLESKLPSKSKEASNTTTLIGHSGPVYSVSF 535

Query: 301 SPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWN 360
           SP  +  L S+  D+ V LW L                   ++ + GH   V D  F+  
Sbjct: 536 SP-DNRYLVSASEDKTVRLWSLDTF--------------TCLVSYKGHNHPVWDVKFS-P 579

Query: 361 IPWLMASVEEDNIVHVW 377
           +    A+V  D    +W
Sbjct: 580 LGHYFATVSHDQTARLW 596

>CAGL0B01529g Chr2 (137174..138283) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P39108 Saccharomyces cerevisiae
           YDR142c PAS7 peroxisomal import protein -peroxin
          Length = 369

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 90/223 (40%), Gaps = 24/223 (10%)

Query: 128 PNFIATINGVGKVFLFDRSKDKNE-ALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTI 186
           PN +    G G + LFD +  K   A+  EH+      Y  ++N  +K   +S S DG +
Sbjct: 73  PNQVVVAQGDGSLRLFDTTLQKFPIAMFHEHS---KEVYSCNWNLVSKSNFVSSSWDGQV 129

Query: 187 ALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLT 246
            +W       SP++  +      +        +NL      DK       +  + +++ T
Sbjct: 130 KIW-------SPNRKASLITFSPHPIDVSRALDNLPEVSQRDKLSPNQVAQNRNCIYQAT 182

Query: 247 LSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLR-NTADALHTMSGHE-DSVTSLEFSPHK 304
                    FS H  NL      +S V L+DLR N  +       H      S +F+ ++
Sbjct: 183 ---------FSPHDDNLILCCAGNSYVTLFDLRQNPGNNQKNFIAHRGKGALSCDFNKYR 233

Query: 305 DGILCSSGSDRRVLLWDLMQIGSEQAQEDAADG--VPELMMMH 345
             I+ +SG D  + +WD+  + +   Q+    G  V E++  H
Sbjct: 234 PNIIATSGVDNSIGIWDIRMLPNSSNQQGFQTGTLVNEIVNAH 276

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 27/125 (21%), Positives = 45/125 (36%), Gaps = 11/125 (8%)

Query: 120 RARFMPQDPNFIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLS 179
           +A F P D N I    G   V LFD  ++      +  A          FN      + +
Sbjct: 180 QATFSPHDDNLILCCAGNSYVTLFDLRQNPGNNQKNFIAHRGKGALSCDFNKYRPNIIAT 239

Query: 180 CSDDGTIALWNV-----------MGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSED 228
              D +I +W++             T T  ++ V  H+  V    W   + ++  S S D
Sbjct: 240 SGVDNSIGIWDIRMLPNSSNQQGFQTGTLVNEIVNAHDLAVKKVCWSPHHSDILLSTSYD 299

Query: 229 KTLQI 233
            + +I
Sbjct: 300 MSCKI 304

>NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25
          Length = 461

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/211 (21%), Positives = 86/211 (40%), Gaps = 21/211 (9%)

Query: 176 ELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHD 235
           + ++CSDD  + +WN   +N    + ++ H   +  C WH     L  S S+D  +++ D
Sbjct: 188 KFVTCSDDNVLKIWNF--SNGQVERTLSGHHWDIKSCDWHP-EMGLIVSASKDNLVKLWD 244

Query: 236 KRTNSTVHRLT-LSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDS 294
            R+   +  +           F     NL AA   D    ++D+R++   L  +    D 
Sbjct: 245 PRSGQCISTIIKFKHTVLKTRFQPTRGNLLAAISKDKSCRVFDIRHSMKELMCVRDEVDY 304

Query: 295 VTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVND 354
           +T L ++P  + +      D  +  +DL+     Q  E  +  +P        H   V  
Sbjct: 305 MT-LTWNPINESMFTVGNYDGAMKYFDLL-----QDLEGPSHVIP------YAHDKCVTS 352

Query: 355 FSFN--WNIPWLMASVEEDNIVHVWKVSKKL 383
            ++N   NI   +AS  +D  +  W  +K +
Sbjct: 353 MAYNPAGNI---LASASKDRTIRFWTRAKPV 380

>Kpol_1062.32 s1062 (69674..71074) [1401 bp, 466 aa] {ON}
           (69674..71074) [1401 nt, 467 aa]
          Length = 466

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 87/201 (43%), Gaps = 24/201 (11%)

Query: 160 HKDNGYGLSFNPRTKGELLSCSDDGTIALWN------VMGTNTSPSKAVTTHEDIVNDCT 213
           H+     L F P+T    +S  +D  I +W+      ++      SKA+ T         
Sbjct: 172 HRHGTTSLEFFPKTGHLFVSGGNDNVIRIWDFYHKRELLRDYIGHSKAIKT--------- 222

Query: 214 WHEFNEN--LFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDS 271
              FN++  +F S S DK ++I D  T     +L L+S  N + F   + N +    ++S
Sbjct: 223 -TNFNDDGKMFISSSFDKYVKIWDTETGKVRSKLRLNSTPNDVKFRPLNPNEYIVGLSNS 281

Query: 272 LVYLYDLRNTADA--LHTMSGHEDSVTSLEFSPHKDGI-LCSSGSDRRVLLWD-LMQIGS 327
            +  YD R +     +     H+ S+ +L + P  DG    SS  D+ V +W+  + I  
Sbjct: 282 QIKHYDTRVSEKQGLIQVYDHHQSSILNLRYFP--DGTKFISSSEDKSVRIWENQINIPI 339

Query: 328 EQAQEDAADGVPELMMMHAGH 348
           +Q  + A   +P + +   GH
Sbjct: 340 KQISDTAQHSMPFINIHPQGH 360

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 45/118 (38%), Gaps = 19/118 (16%)

Query: 285 LHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMM 344
           ++   GH    TSLEF P    +  S G+D  + +WD                  EL+  
Sbjct: 166 IYVYQGHRHGTTSLEFFPKTGHLFVSGGNDNVIRIWDFYH-------------KRELLRD 212

Query: 345 HAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVW-----KVSKKLTSPGLIQDYDIRSL 397
           + GH  A+   +FN +    ++S   D  V +W     KV  KL       D   R L
Sbjct: 213 YIGHSKAIKTTNFNDDGKMFISS-SFDKYVKIWDTETGKVRSKLRLNSTPNDVKFRPL 269

>TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {ON}
           Anc_8.672 YPL151C
          Length = 414

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 82/179 (45%), Gaps = 21/179 (11%)

Query: 181 SDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNS 240
           S D TI +W++       +  ++ H   V D    + +  LF S SEDK ++  D   N 
Sbjct: 122 SSDTTIKIWDLESGKLKIT--LSGHVMPVRDIAISKRSPYLF-SASEDKLIKCWDLEKNM 178

Query: 241 TVHR-LTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLE 299
            +       S  NT+D    + +L A AG DS + L+D+R+   A+ T+ GH+  VT+++
Sbjct: 179 AIREYFGHLSGVNTVDVHP-TLDLIATAGRDSTIRLWDIRSRT-AVMTLIGHKAPVTTVK 236

Query: 300 FSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFN 358
             P  D  + S+ +D  V LWD++          A   +  L      HK  V D + N
Sbjct: 237 CIP-VDPQVVSASNDATVKLWDIV----------AGKAIKTL----THHKRTVRDIAVN 280

>KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {ON}
           Anc_8.672 YPL151C
          Length = 417

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 80/158 (50%), Gaps = 7/158 (4%)

Query: 167 LSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVS 226
           ++ +P       + S+D TI +W+        +  ++ H   V D    + +  +F S S
Sbjct: 114 IAMDPVDNEWFATGSNDSTIKVWDFASGKLKLT--LSGHVMGVRDLVVSKRHPYMF-SAS 170

Query: 227 EDKTLQIHDKRTNSTVH-RLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADAL 285
           EDK ++  D   N+ +       S  +T+D    + +L A+AG DS+V L+D+R +  A+
Sbjct: 171 EDKLVKCWDLEKNAPIRDYFGHLSGVHTVDIHP-TLSLIASAGRDSVVKLWDIR-SKKAV 228

Query: 286 HTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLM 323
            T+ GH+  + S++ +P  D  + S  +D  V+ WDL+
Sbjct: 229 ITLVGHKSPINSVKCTP-ADPQIISCSNDTTVITWDLV 265

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 22/40 (55%), Gaps = 2/40 (5%)

Query: 176 ELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWH 215
           +++SCS+D T+  W+++     P K +T H   V D   H
Sbjct: 249 QIISCSNDTTVITWDLVAAK--PMKVITHHRKAVRDIAVH 286

>Suva_2.303 Chr2 complement(535706..536839) [1134 bp, 377 aa] {ON}
           YDR142C (REAL)
          Length = 377

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 54/251 (21%), Positives = 110/251 (43%), Gaps = 30/251 (11%)

Query: 136 GVGKVFLFDRSKDKNEALVSEHAF-HKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGT 194
           G GK+++ + ++D    +   ++F  +D  + +++N   + ++L    DGT+ L++    
Sbjct: 36  GNGKLYILEINRDGK--IEERNSFLTQDCLFDVAWNESHENQVLVAQGDGTLRLFDTT-L 92

Query: 195 NTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTL 254
              P      HE  V  C W+  N   F S S D +++I     + ++  LT       L
Sbjct: 93  KEYPIAIFKEHEREVFSCNWNLVNRQTFLSSSWDGSIKIWSPLRSQSLMSLTP----RPL 148

Query: 255 DFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSD 314
           + +K    L A            L N       +S +++ V   +FSPH   ++ S   +
Sbjct: 149 EITKMVDPLNAI-----------LSNKKKNFTGISQNKNCVYQAQFSPHDQNLVISCSGN 197

Query: 315 RRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIV 374
               L+D+ ++   ++Q +         ++H+G ++   DF  N   P+++A+   DN +
Sbjct: 198 SYASLFDI-RLPPSRSQTN--------FLVHSGLEALTCDF--NKYRPYVIATGGVDNAI 246

Query: 375 HVWKVSKKLTS 385
            +W +    TS
Sbjct: 247 RIWDIRMLKTS 257

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 68/307 (22%), Positives = 117/307 (38%), Gaps = 66/307 (21%)

Query: 129 NFIATINGVGKVFLFDRS-KDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIA 187
           N +    G G + LFD + K+   A+  EH   +   +  ++N   +   LS S DG+I 
Sbjct: 74  NQVLVAQGDGTLRLFDTTLKEYPIAIFKEH---EREVFSCNWNLVNRQTFLSSSWDGSIK 130

Query: 188 LWN------VMGTNTSPSK--------------------AVTTHEDIVNDCTWHEFNENL 221
           +W+      +M     P +                     ++ +++ V    +   ++NL
Sbjct: 131 IWSPLRSQSLMSLTPRPLEITKMVDPLNAILSNKKKNFTGISQNKNCVYQAQFSPHDQNL 190

Query: 222 FGSVSEDKTLQIHDKR-------TNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVY 274
             S S +    + D R       TN  VH    +    T DF+K+   + A  G D+ + 
Sbjct: 191 VISCSGNSYASLFDIRLPPSRSQTNFLVHSGLEAL---TCDFNKYRPYVIATGGVDNAIR 247

Query: 275 LYDLR--------NTADALHTMS-----------GHEDSVTSLEFSPHKDGILCSSGSDR 315
           ++D+R         T    HT S            H  ++  + +SPH   IL S+  D 
Sbjct: 248 IWDIRMLKTSGSATTGRPTHTSSHNSACINEIPNAHGLAIRKVTWSPHHSNILMSASYDM 307

Query: 316 RVLLW-DLMQIGSEQAQE----DAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEE 370
              +W DL   G+++  +    D   G       H+     + D+S  W  P  +AS   
Sbjct: 308 TCRVWKDLSNDGAKETYKTNSTDTGKGCLSNFTQHSEFVFGI-DWSL-WGKPGYVASTAW 365

Query: 371 DNIVHVW 377
           D  + VW
Sbjct: 366 DGNLFVW 372

>CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highly
           similar to uniprot|P25635 Saccharomyces cerevisiae
           YCR057c PWP2 periodic tryptophan protein
          Length = 911

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/213 (24%), Positives = 100/213 (46%), Gaps = 22/213 (10%)

Query: 124 MPQDPNFIATINGVGKVFLFDRSKD--------KNEALVSEHAFHKDNGYGLSFNPRTKG 175
           M Q+P    ++N  G+   F  SK         ++E+ + +   H D    L+++P    
Sbjct: 296 MGQNPVNTVSVNNSGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDATNSLTYSP-DGS 354

Query: 176 ELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNE--NLFGSVSEDKTLQI 233
            +++ ++DG I +W+V     +    + T E+  +  T  +F +   +  S S D T++ 
Sbjct: 355 RVVTAAEDGKIKVWDV-----ASGFCLATFEEHTSAVTAVQFAKKGQVLFSASLDGTVRA 409

Query: 234 HD--KRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSL-VYLYDLRNTADALHTMSG 290
            D  +  N  V   T    F  L   + S  + +A  TDS  V+++ ++ T   L T+SG
Sbjct: 410 WDLIRYRNFRVFTATERVQFTCLAV-EPSGEVVSAGSTDSFDVFVWSVQ-TGQLLDTLSG 467

Query: 291 HEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLM 323
           HE  V+ L FS  ++ +L S+  D+ + +W + 
Sbjct: 468 HEGPVSCLAFS-MENAVLASASWDKTIRIWSIF 499

>KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {ON}
           Anc_6.276 YPL247C
          Length = 504

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 73/161 (45%), Gaps = 16/161 (9%)

Query: 177 LLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDK 236
           L+S S D T  +W++   N   ++ +  H+  V D  +   + +LF S   D ++++ D 
Sbjct: 262 LVSSSIDTTCIVWDLQSPNYVKTQLIA-HDSEVYDVRFLSQSTHLFASCGGDGSVRVFDL 320

Query: 237 RT-------------NSTVHRLTL-SSPFNTLDFSKHSQNLFAAAGTDSL-VYLYDLRNT 281
           R+               TV+ +T  ++    L+ S    N+ A    DS  + + D+RN 
Sbjct: 321 RSLAHSTIVYEPPAGEGTVNDVTAQNNALLRLEPSLMDPNIIATLVADSKDILILDMRNP 380

Query: 282 ADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
                T+ GH   V  +++ P K  +L S   D +VL WDL
Sbjct: 381 ESPALTLKGHSSLVNQIKWHPTKRNVLLSCSDDCQVLYWDL 421

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 3/66 (4%)

Query: 127 DPNFIATINGVGK-VFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGT 185
           DPN IAT+    K + + D    ++ AL  +   H      + ++P  +  LLSCSDD  
Sbjct: 358 DPNIIATLVADSKDILILDMRNPESPALTLKG--HSSLVNQIKWHPTKRNVLLSCSDDCQ 415

Query: 186 IALWNV 191
           +  W++
Sbjct: 416 VLYWDL 421

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 19/88 (21%), Positives = 37/88 (42%)

Query: 239 NSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSL 298
           N+T   L    P  + D++    NL  ++  D+   ++DL++       +  H+  V  +
Sbjct: 237 NTTTAILGELPPVTSFDWNTVDTNLLVSSSIDTTCIVWDLQSPNYVKTQLIAHDSEVYDV 296

Query: 299 EFSPHKDGILCSSGSDRRVLLWDLMQIG 326
            F      +  S G D  V ++DL  + 
Sbjct: 297 RFLSQSTHLFASCGGDGSVRVFDLRSLA 324

>YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}
           MDV1Peripheral protein of the cytosolic face of the
           mitochondrial outer membrane, required for mitochondrial
           fission; interacts with Fis1p and with the
           dynamin-related GTPase Dnm1p; contains WD repeats
          Length = 714

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 79/187 (42%), Gaps = 40/187 (21%)

Query: 172 RTKGELLSCSDDGTIALWNV--------------MGTNTSPSKAVTTHEDIVNDCTWHEF 217
           R  G L++   D  + LWN+                TN   S  V T E   ++ T    
Sbjct: 451 RDYGTLVTGGRDAALKLWNLNLAQQLYQETQNLTSPTNHIDSPCVHTFEAHTDEVTALSL 510

Query: 218 NENLFGSVSEDKTLQIHDKRTNSTVHRLTLS-----SPFNTLDFSKHS------------ 260
           + +   S S+D+T++  D R+   +  + LS     +    +D SK +            
Sbjct: 511 DPSFLVSGSQDRTIRQWDLRSGKCLQTIDLSFANVLTTSTNVDLSKSTLLTQRNERPSIG 570

Query: 261 --QNLFAAAGT---DSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDR 315
             Q+  AA  T   D +V L+DLR +   + T+ GH D++TSL+F       L +   DR
Sbjct: 571 ALQSFDAALATGTKDGVVRLWDLR-SGKVIRTLKGHTDAITSLKFDS---ACLVTGSYDR 626

Query: 316 RVLLWDL 322
            V +WDL
Sbjct: 627 TVRIWDL 633

>SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highly
           similar to uniprot|P53622 Saccharomyces cerevisiae
           YDL145C COP1 Alpha subunit of COPI vesicle coatomer
           complex which surrounds transport vesicles in the early
           secretory pathway
          Length = 1203

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 57/223 (25%), Positives = 89/223 (39%), Gaps = 41/223 (18%)

Query: 177 LLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDK 236
           ++SCSDD TI +WN    N      +T H   V    +H  +E+L  S S D+T+++ D 
Sbjct: 110 IISCSDDQTIRIWN--WQNRKEIACLTGHNHFVMCAQFHP-SEDLVVSASLDETVRVWDI 166

Query: 237 RTNSTVHRLTLSSPF--------NTLD-----------FSKHSQN-----------LFAA 266
                 H    +S F        N LD              H++            L  +
Sbjct: 167 SGLRKKHSAPGASSFEEQMIAQQNLLDGGFGECVVKFILEGHTRGVNWASFHPTLPLIVS 226

Query: 267 AGTDSLVYLYDLRNT-ADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL--- 322
            G D  V ++ +  T A  + T  GH ++V S+ F PH++ ++ S G D+ +  WDL   
Sbjct: 227 GGDDRQVKIWRMSATKAWEVDTCRGHTNNVDSVIFHPHQN-LIISVGEDKTIRTWDLDKR 285

Query: 323 ---MQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIP 362
               Q   E  +       P + +  A H S V  F  +   P
Sbjct: 286 TPVKQFKRENDRFWLIRAHPNINLFGAAHDSGVMVFKLDRERP 328

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 43/107 (40%), Gaps = 17/107 (15%)

Query: 271 SLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQA 330
           S + L+D R     LH    HE  V  ++F P +  +  S+G D  + +W L        
Sbjct: 33  STIQLWDYR-MGTLLHRFEDHEGPVRGIDFHPTQP-LFVSAGDDYTIKVWSLE------- 83

Query: 331 QEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVW 377
                    + +    GH   V    F+  +PW++ S  +D  + +W
Sbjct: 84  -------TKKCLFTLNGHLDYVRTVFFHHELPWII-SCSDDQTIRIW 122

>NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {ON}
           Anc_8.288
          Length = 1145

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 74/155 (47%), Gaps = 5/155 (3%)

Query: 188 LWNVMGTNTSPSKAVT-THEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLT 246
           +WN+  T++     V   H   + D  ++  N ++  + S D  +   D R+       T
Sbjct: 98  IWNLARTSSDAIDHVLHGHSRAITDINFNPENPDILATCSVDTYVHAWDMRSPHRPFYTT 157

Query: 247 LS--SPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHK 304
            +  S  + + ++    N+ A+A ++  +Y++DLR  +  LH + GH+ SV S++F+  K
Sbjct: 158 SAWRSGASQVKWNYKDSNILASAHSND-IYIWDLRMGSTPLHKLVGHDSSVNSIDFNRFK 216

Query: 305 DGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVP 339
              + SS +D  V  WD+ + GS+      +   P
Sbjct: 217 SSEIMSSSNDGTVKFWDISK-GSDNCTSTVSTDFP 250

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 42/84 (50%), Gaps = 12/84 (14%)

Query: 295 VTSLEFSPH-KDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVN 353
           V  +++SPH        S S+++ L+W+L +  S     DA D V     +H GH  A+ 
Sbjct: 73  VADVQWSPHPAKPYWVVSTSNQKALIWNLARTSS-----DAIDHV-----LH-GHSRAIT 121

Query: 354 DFSFNWNIPWLMASVEEDNIVHVW 377
           D +FN   P ++A+   D  VH W
Sbjct: 122 DINFNPENPDILATCSVDTYVHAW 145

 Score = 38.1 bits (87), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 43/195 (22%), Positives = 82/195 (42%), Gaps = 12/195 (6%)

Query: 167 LSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVS 226
           ++FNP     L +CS D  +  W+ M +   P    +      +   W+  + N+  S  
Sbjct: 123 INFNPENPDILATCSVDTYVHAWD-MRSPHRPFYTTSAWRSGASQVKWNYKDSNILASAH 181

Query: 227 EDKTLQIHDKRTNST-VHRLT-LSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADA 284
            +  + I D R  ST +H+L    S  N++DF++   +   ++  D  V  +D+   +D 
Sbjct: 182 SND-IYIWDLRMGSTPLHKLVGHDSSVNSIDFNRFKSSEIMSSSNDGTVKFWDISKGSDN 240

Query: 285 LHTMSGHEDSVTSLEFSPHKDG--ILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELM 342
             +    +  +    + P  +G  I+   G    V L  L     EQ   + ++ + +L 
Sbjct: 241 CTSTVSTDFPIWRGRYLPFGNGFCIMPQEGGGNAVYLSTL----KEQENLNESNKLTKLQ 296

Query: 343 MMHA--GHKSAVNDF 355
            +++  GH   V DF
Sbjct: 297 PIYSFKGHSERVIDF 311

>Kpol_1061.36 s1061 (100800..102569) [1770 bp, 589 aa] {ON}
           (100800..102569) [1770 nt, 590 aa]
          Length = 589

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 64/136 (47%), Gaps = 27/136 (19%)

Query: 200 KAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKH 259
           + ++ H D V+  +W   N N+  S S D+ +   D R         ++ PF       H
Sbjct: 361 RTLSGHTDRVSCLSW---NNNILSSGSRDRRILHRDVR---------IADPF-FAQIETH 407

Query: 260 SQ-----------NLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGIL 308
           +Q           N  A+ G D++V +YD  +    L T   H  +V ++ +SPHK GIL
Sbjct: 408 TQEVCGLKWNVEENKLASGGNDNIVCVYDGTSVTPTL-TFREHTAAVKAIGWSPHKRGIL 466

Query: 309 CSSG--SDRRVLLWDL 322
            + G  +DRR+ +W++
Sbjct: 467 ATGGGTADRRLKIWNV 482

 Score = 33.5 bits (75), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 47/99 (47%), Gaps = 5/99 (5%)

Query: 224 SVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTAD 283
           +V+  K++ + D      +H       + +L +     +L    G + L+ +YD+     
Sbjct: 301 AVALGKSIFLTDNSNGDVIHLCDTKDEYTSLSWVGAGSHLAVGQG-NGLMEIYDVVK-KK 358

Query: 284 ALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
            + T+SGH D V+ L ++   + IL S   DRR+L  D+
Sbjct: 359 CIRTLSGHTDRVSCLSWN---NNILSSGSRDRRILHRDV 394

>Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa]
           {ON} YDR128W - Hypothetical ORF [contig 174] FULL
          Length = 1102

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 66/137 (48%), Gaps = 4/137 (2%)

Query: 188 LWNVMGTNTSPSKAVT-THEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRL- 245
           LWN+   ++   + V   H   + D  +H  +  +  + S D  +   D R+    +   
Sbjct: 95  LWNLSRNSSDAIEHVLHGHSRAITDINFHPTHPEILATCSIDAYVHAWDMRSPRRAYYSA 154

Query: 246 -TLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHK 304
              S+  + + ++  + N+ A+A ++  VY++DLR     LH + GH +SV S++FS   
Sbjct: 155 SVWSAGASQVKWNYKNSNVMASAHSND-VYIWDLRKGCTPLHVLQGHVNSVNSIDFSKFD 213

Query: 305 DGILCSSGSDRRVLLWD 321
           +  + SS +D  V  WD
Sbjct: 214 ETEIMSSSNDGTVKFWD 230

 Score = 34.7 bits (78), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 49/116 (42%), Gaps = 17/116 (14%)

Query: 279 RNTADAL-HTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADG 337
           RN++DA+ H + GH  ++T + F P    IL +   D  V  WD+               
Sbjct: 100 RNSSDAIEHVLHGHSRAITDINFHPTHPEILATCSIDAYVHAWDMRS------------- 146

Query: 338 VPELMMMHAGHKSA-VNDFSFNWNIPWLMASVEEDNIVHVWKVSKKLTSPGLIQDY 392
            P      A   SA  +   +N+    +MAS    N V++W + K  T   ++Q +
Sbjct: 147 -PRRAYYSASVWSAGASQVKWNYKNSNVMASA-HSNDVYIWDLRKGCTPLHVLQGH 200

>KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {ON}
           Anc_8.435 YLR222C
          Length = 783

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 69/149 (46%), Gaps = 17/149 (11%)

Query: 225 VSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADA 284
           VS+ + L+I +  T   +  + +SSP   +D  K S  L    GTD  V + D+ N    
Sbjct: 47  VSQAQLLKIVNVSTGKIIKSMKVSSPSYIIDCDKTS-TLVTIGGTDGSVVVIDIEN-GYI 104

Query: 285 LHTMSGHEDSVTSLEFSPHKDG---ILCSSGSDRRVLLWDLMQ---IGSEQAQEDAADGV 338
            H++ GH  +++SL+F    +    +LCS  ++  V +WDL++   I + Q       GV
Sbjct: 105 THSLKGHGGTISSLKFFGELNSNIWLLCSGDTNGMVKIWDLVKRKCIHTVQEHTSPVRGV 164

Query: 339 ---------PELMMMHAGHKSAVNDFSFN 358
                      L ++  G  + VN + FN
Sbjct: 165 DIVESENDTDVLQLVTGGRDNIVNFWEFN 193

 Score = 38.1 bits (87), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 84/180 (46%), Gaps = 16/180 (8%)

Query: 160 HKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKA-VTTHEDIVNDCTWHEFN 218
           H+ +   LS +P       + S D T  +W++    T  S A ++ H+  + D ++ +F+
Sbjct: 462 HEKDINALSISPN-DSIFATASYDKTCKIWDL---ETGESVATLSNHKRGLWDVSFCQFD 517

Query: 219 ENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSK--HSQNLFAAAGTDSLVYLY 276
           + +  + S DKT++I    T S +   TL    N +      + QN   + G D L+ ++
Sbjct: 518 K-IIATCSGDKTIKIWSLDTFSVIK--TLEGHTNAVQKCSFINKQNQLVSTGADGLIKIW 574

Query: 277 DLRNTADALHTMSGHEDSVTSLEFSPHKDG-ILCSSGSDRRVLLWDLMQIGSEQAQEDAA 335
           D+ N  + + T+ GH + + +L      DG ++ S+ +D     W       EQ +ED A
Sbjct: 575 DISN-GECISTLDGHNNRIWAL--CVQNDGDLIVSADADGVFQFW--RDCTDEQREEDMA 629

>TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.122
           YGL003C
          Length = 631

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 64/136 (47%), Gaps = 27/136 (19%)

Query: 200 KAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKH 259
           + ++ H D V+  +W   N ++  S S D+ +          +HR   S          H
Sbjct: 403 RTLSGHSDRVSCLSW---NNHILSSGSRDRKI----------LHRDVRSPDSYFTQIETH 449

Query: 260 SQ-----------NLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGIL 308
           +Q           N  A+ G D++VY+YD  N+   L   + H  +V ++ +SPH+ GIL
Sbjct: 450 TQEVCGLKWNIEDNRLASGGNDNIVYVYDGVNSKPTL-MFTEHTAAVKAMTWSPHRRGIL 508

Query: 309 CSSG--SDRRVLLWDL 322
            + G  +DRR+ +W++
Sbjct: 509 ATGGGTADRRLKIWNV 524

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 68/155 (43%), Gaps = 21/155 (13%)

Query: 224 SVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTAD 283
           +V+  K++ + D      +H     + F +L++     +L A   ++ LV +YD+     
Sbjct: 343 AVALGKSIFLTDNNNGDVIHLCDTDNEFTSLNWVGTGSHL-AVGQSNGLVEIYDIIKRK- 400

Query: 284 ALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMM 343
            + T+SGH D V+ L ++ H   IL S   DR++L  D+    S   Q +          
Sbjct: 401 CIRTLSGHSDRVSCLSWNNH---ILSSGSRDRKILHRDVRSPDSYFTQIET--------- 448

Query: 344 MHAGHKSAVNDFSFNWNIP-WLMASVEEDNIVHVW 377
               H   V      WNI    +AS   DNIV+V+
Sbjct: 449 ----HTQEV--CGLKWNIEDNRLASGGNDNIVYVY 477

 Score = 30.4 bits (67), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 69/164 (42%), Gaps = 11/164 (6%)

Query: 176 ELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLF--GSVSEDKTLQI 233
            L S  +D  + +++  G N+ P+   T H   V   TW      +   G  + D+ L+I
Sbjct: 464 RLASGGNDNIVYVYD--GVNSKPTLMFTEHTAAVKAMTWSPHRRGILATGGGTADRRLKI 521

Query: 234 HDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRN--TADALHTMSGH 291
            +  T++ ++ +   S    + +SK++  +  + G     Y   L N  T + +    GH
Sbjct: 522 WNVNTSAKLNDVDSGSQICNMIWSKNTDEIVTSHGYSR--YNLTLWNYPTLEPVAIFKGH 579

Query: 292 EDSVTSLEFSPHKDGILCSSGS-DRRVLLWDLMQIGSEQAQEDA 334
              V  L  S  +DG    SG+ D  +  W +      +AQ ++
Sbjct: 580 SFRVLHLTLS--EDGTTVVSGAGDETLRYWKIFNKPKAKAQPES 621

>KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247C Hypothetical ORF
          Length = 420

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 75/177 (42%), Gaps = 32/177 (18%)

Query: 177 LLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDK 236
           ++S S D T  +W++  TN   ++ +  H+  V D  +   +  LF S   D ++++ D 
Sbjct: 181 IISSSIDTTCTVWDLQATNYVKTQLIA-HDSEVFDVKFLTQSTQLFASCGGDGSVRVFDL 239

Query: 237 RT--NSTVHRLTLSSPFNT----------------------------LDFSKHSQNLFAA 266
           R+  +ST+     S P                               L+ S    N+ A 
Sbjct: 240 RSLAHSTIIYEPSSQPTAGSSGDSSAASGGSGSGSNSASSGSNALLRLEPSPFDPNVVAT 299

Query: 267 AGTDS-LVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
              DS  V + D+R    A+ T+ GH  +V  +++ P +  +L + G D + LLWDL
Sbjct: 300 FAHDSNSVLILDMRYPGAAILTLEGHVGAVNQIQWHPSRHNVLLTCGDDCQALLWDL 356

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 2/71 (2%)

Query: 214 WHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLD--FSKHSQNLFAAAGTDS 271
           W+  + NL  S S D T  + D +  + V    ++      D  F   S  LFA+ G D 
Sbjct: 173 WNAVDPNLIISSSIDTTCTVWDLQATNYVKTQLIAHDSEVFDVKFLTQSTQLFASCGGDG 232

Query: 272 LVYLYDLRNTA 282
            V ++DLR+ A
Sbjct: 233 SVRVFDLRSLA 243

>SAKL0G02398g Chr7 complement(200123..201538) [1416 bp, 471 aa] {ON}
           similar to uniprot|P40968 Saccharomyces cerevisiae
           YDR364C CDC40 Pre-mRNA splicing factor important for
           catalytic step II of pre-mRNA splicing and plays a role
           in cell cycle progression required for DNA synthesis
           during mitosis and meiosis has WD repeats
          Length = 471

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 80/185 (43%), Gaps = 6/185 (3%)

Query: 167 LSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVS 226
           L F P T    LS  +D  I +W++    T   +    H   V D  ++  +   F SVS
Sbjct: 184 LKFLPETGHLFLSGGNDNVINIWDMYHERTL-LRDYRGHRKAVRDINFNS-DGTEFLSVS 241

Query: 227 EDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLR--NTADA 284
            D+TL++ D  T     RL   S  N   +   + N +    ++S +  YD R  N    
Sbjct: 242 FDQTLKVWDTETGKVKSRLKWHSVPNCATYHPTNNNEYIVGLSNSEIRHYDSRVSNKEGL 301

Query: 285 LHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWD-LMQIGSEQAQEDAADGVPELMM 343
           + T + H  S+ SL++ P     + SS  D+ V +W+  + I  +Q  + +   +P L +
Sbjct: 302 IQTYNHHLSSIISLKYFPDGSKFISSS-EDKTVRIWENQVNIPIKQISDTSQYSMPYLEI 360

Query: 344 MHAGH 348
               H
Sbjct: 361 HPEQH 365

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 42/93 (45%), Gaps = 14/93 (15%)

Query: 285 LHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMM 344
           ++T  GH +  T L+F P    +  S G+D  + +WD+    +             L+  
Sbjct: 171 IYTFKGHVNGTTKLKFLPETGHLFLSGGNDNVINIWDMYHERT-------------LLRD 217

Query: 345 HAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVW 377
           + GH+ AV D +FN +    + SV  D  + VW
Sbjct: 218 YRGHRKAVRDINFNSDGTEFL-SVSFDQTLKVW 249

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 50/104 (48%), Gaps = 4/104 (3%)

Query: 222 FGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKH-SQNLFAAAGTDSLVYLYDL-- 278
           F S SEDKT++I + + N  + +++ +S ++      H  Q+ F+A   D+ +Y + +  
Sbjct: 324 FISSSEDKTVRIWENQVNIPIKQISDTSQYSMPYLEIHPEQHYFSAQSMDNAIYSFSMKP 383

Query: 279 RNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDR-RVLLWD 321
           +   +      GH  +   + F    DG    SG  R  V++WD
Sbjct: 384 KYKKNLKKVFRGHLCAGFGINFGFSPDGQYIVSGDSRGSVVVWD 427

>ACR199C Chr3 complement(698881..699768) [888 bp, 295 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR208W
           (SEC13)
          Length = 295

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 88/210 (41%), Gaps = 21/210 (10%)

Query: 131 IATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSF-NPRTKGELLSCSDDGTIALW 189
           +AT +    + +F+   D ++ + S H  H+   + + + +P+    L SCS DG + +W
Sbjct: 24  LATCSSDKTIQIFEVDGDSHKLVDSLHG-HEGPVWQVDWAHPKFGVILASCSYDGKVLIW 82

Query: 190 NVMGTNTSPSKAVTTHEDIVNDCTW--HEFNENLFGSVSEDKTLQIHDKRTNST------ 241
                  S   A   H   VN   W  HE+   L  S S+ K   +  K   +T      
Sbjct: 83  KEENGRWSQIAAYEVHSASVNSVKWAPHEYGPLLLCSSSDGKFSVVEFKENGTTSPIIID 142

Query: 242 VHRLTLS----SPFNTLDFSKHSQNL--FAAAGTDSLVYLYDLRNTADAL---HTMSGHE 292
            H + ++    +P    D  + SQ+L   A  G D+LV ++     A+      T++ H 
Sbjct: 143 AHAIGVNAACWAPATIEDDGQQSQHLRRIATGGADNLVKIWKYNPEANTYLLEDTLAAHA 202

Query: 293 DSVTSLEFSPH--KDGILCSSGSDRRVLLW 320
           D V  + +SP       L +   DR  ++W
Sbjct: 203 DWVRDVAWSPSVLPRAYLATVSQDRTCIIW 232

>TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {ON}
           Anc_8.316 YDR142C
          Length = 362

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/290 (20%), Positives = 114/290 (39%), Gaps = 42/290 (14%)

Query: 127 DPNFIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTI 186
           +P  +    G G + LFD +    +  + +   H    +  ++N  T+   +S S DG +
Sbjct: 72  NPTQVLVAQGDGTLTLFDLTNKLQQIQIYKE--HYSEVFSCNWNMLTRRTFISGSWDGKV 129

Query: 187 ALWNV--------MGTNTS--------PSKAV---TTHEDIVNDCTWHEFNENLFGSVSE 227
            +W+         +  N S         +KA+   + ++D +    +   + N+    S 
Sbjct: 130 KIWDCARSESVLTLRNNRSLGHTGEHIETKALQRNSKNKDCIYQALFSPHDPNMAMCCSG 189

Query: 228 DKTLQIHDKRTNSTVHRLTLSSPFNTL--DFSKHSQNLFAAAGTDSLVYLYDLRNTADAL 285
           +  L   D R  +  + +   S   TL  D++K+   + A+AG D  + ++DLR   +  
Sbjct: 190 NSYLTFFDLRQPNQQNSILAHSGLETLSCDYNKYRSYIVASAGVDKAIRIWDLRMIKNKP 249

Query: 286 HTM--------------SGHEDSVTSLEFSPHKDGILCSSGSDRRVLLW-DLMQIGSEQA 330
           H M              + HE ++  + +SPH      ++  D    +W DL   G+ Q 
Sbjct: 250 HNMFADISSYNCTNEVVNAHELAIRKILWSPHHSNYFLTTSYDLTCRVWQDLSHDGTRQV 309

Query: 331 -QEDAADGVPELMMMHAGHKSAV--NDFSFNWNIPWLMASVEEDNIVHVW 377
            + ++ +           H   V   D+S  W  P  +AS   D  V +W
Sbjct: 310 WKTNSTEPGKGCRYKFNKHTEFVLGADWSL-WGQPGFVASTAWDGKVFIW 358

 Score = 30.4 bits (67), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 36/171 (21%), Positives = 61/171 (35%), Gaps = 32/171 (18%)

Query: 120 RARFMPQDPNFIATINGVGKVFLFD-RSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELL 178
           +A F P DPN     +G   +  FD R  ++  ++++             +N      + 
Sbjct: 173 QALFSPHDPNMAMCCSGNSYLTFFDLRQPNQQNSILAHSGLET---LSCDYNKYRSYIVA 229

Query: 179 SCSDDGTIALWNVMGTNTSP-------------SKAVTTHEDIVNDCTWHEFNENLFGSV 225
           S   D  I +W++      P             ++ V  HE  +    W   + N F + 
Sbjct: 230 SAGVDKAIRIWDLRMIKNKPHNMFADISSYNCTNEVVNAHELAIRKILWSPHHSNYFLTT 289

Query: 226 SEDKTLQI-----HDK-----RTNSTVHRLTLSSPFNTLDFSKHSQNLFAA 266
           S D T ++     HD      +TNST         FN     KH++ +  A
Sbjct: 290 SYDLTCRVWQDLSHDGTRQVWKTNSTEPGKGCRYKFN-----KHTEFVLGA 335

>KLTH0B01628g Chr2 (129632..132004) [2373 bp, 790 aa] {ON} similar
           to uniprot|P42935 Saccharomyces cerevisiae YGR200C ELP2
           Elongator protein part of the six- subunit RNA
           polymerase II Elongator histone acetyltransferase
           complex target of Kluyveromyces lactis zymocin
          Length = 790

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/202 (23%), Positives = 85/202 (42%), Gaps = 16/202 (7%)

Query: 136 GVGKVFLFDRSKD-KNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGT 194
           G GK   F +  D  +  + +    H      + F P T+  +++ S+D  + LW   G 
Sbjct: 33  GAGKTIAFWKPLDPAHRGVYATLKGHDAEVTCVRFVPGTEF-MITASEDSQVRLWAFDGE 91

Query: 195 NTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIH--DKRTNSTVHRLTLSSPFN 252
           + S    + + +   +  T      NL      D ++ +   ++R  S VH   L +   
Sbjct: 92  DNSAMACIQSTDHHKHTITSLSVLSNLLTVGCADGSVSVWQINERQISLVHSFVLKAGVF 151

Query: 253 TLDFS----KHSQNLFAAAGTDSLVYLYDLRNTADALH------TMSGHEDSVTSLEFSP 302
            L  +    + S+ L A  GT+S V++Y     A AL       T+ GHED + +++F  
Sbjct: 152 PLCMALKSVEDSKVLLAVGGTNSNVFIYSFTREAAALENFQLAATLEGHEDWIKAMDFYE 211

Query: 303 HKDG--ILCSSGSDRRVLLWDL 322
              G  +L +   DR + LW +
Sbjct: 212 EGPGNMLLATGSQDRYIRLWRI 233

>ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 482

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 59/129 (45%), Gaps = 8/129 (6%)

Query: 186 IALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNEN---LFGSVSEDKTLQIHDKRTNSTV 242
           I LW+     TS SK+ +      ++ T  +FN+N   +  S   D ++ ++D RTNS  
Sbjct: 194 IQLWD-----TSRSKSTSNLSWGADNITSVKFNQNDSNILASTGSDNSIVLYDLRTNSPT 248

Query: 243 HRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSP 302
            ++      N+L ++      F     D   Y YD+R    AL+    H  +V  ++F+P
Sbjct: 249 QKIVQQMRTNSLCWNPMEPFNFVTGNEDHNAYYYDMRKMNRALNVFKDHVSAVMDVDFAP 308

Query: 303 HKDGILCSS 311
             D I+  S
Sbjct: 309 TGDEIVTGS 317

 Score = 37.7 bits (86), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 63/146 (43%), Gaps = 35/146 (23%)

Query: 177 LLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDK 236
           +LSC DD T+ LW+V                          + + +  V +D+ L     
Sbjct: 132 MLSCGDDKTVKLWSV--------------------------DTDDYADVKDDQNLN---- 161

Query: 237 RTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVT 296
            T   +        F  +D  + S + F   G  + + L+D  + + +   +S   D++T
Sbjct: 162 -TRGLLKTFYGDHSFQGIDHHR-SNSAFVTGG--AQIQLWDT-SRSKSTSNLSWGADNIT 216

Query: 297 SLEFSPHKDGILCSSGSDRRVLLWDL 322
           S++F+ +   IL S+GSD  ++L+DL
Sbjct: 217 SVKFNQNDSNILASTGSDNSIVLYDL 242

>CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa]
           {ON} highly similar to uniprot|P42841 Saccharomyces
           cerevisiae YNL317w PFS2 polyadenylation factor I
          Length = 455

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/209 (21%), Positives = 85/209 (40%), Gaps = 17/209 (8%)

Query: 176 ELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHD 235
           + ++CSDD  + +WN   +N    + ++ H   V  C WH     L  S S+D  +++ D
Sbjct: 180 KFVTCSDDNILKIWNF--SNGQQERVLSGHHWDVRSCDWHP-ELGLIVSGSKDNLVKLWD 236

Query: 236 KRTNSTVHR-LTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDS 294
            R+   V   L          F     NL AA   D    ++DLR + + L  +    D 
Sbjct: 237 PRSGQCVSTLLKFKHTVLKTRFQPTKGNLLAAISKDKSCRVFDLRASMNELMCVRDEVD- 295

Query: 295 VTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVND 354
              LE+S   + +      D  +  +DL Q           D    + ++   H+  ++ 
Sbjct: 296 FMELEWSTINESMFTVGCYDGSLKHFDLGQ-----------DTEKPIHIIPFAHEKCISA 344

Query: 355 FSFNWNIPWLMASVEEDNIVHVWKVSKKL 383
            ++N  +  ++A+  +D  +  W  ++ +
Sbjct: 345 IAYN-PVGHILATAAKDRTIRFWTRARPV 372

>TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {ON}
           Anc_8.316 YDR142C
          Length = 367

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 61/297 (20%), Positives = 111/297 (37%), Gaps = 46/297 (15%)

Query: 129 NFIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIAL 188
           N +    G G + LFD    +    + +   H+   +  ++N   K   +S S DGT+ +
Sbjct: 74  NQVLVAQGDGSLRLFDTKLAQYPIAIFKE--HQKEVFSCNWNLLNKNTFVSSSWDGTVKI 131

Query: 189 W--------------------------NVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLF 222
           W                          N+  +N      +T +++ +    +   + NL 
Sbjct: 132 WSPTRKDSLLTLTPQPLKTVNRVDHSMNIPMSNQRNHADITRNKNCIYQAQFSPHDPNLV 191

Query: 223 GSVSEDKTLQIHDKRT--NSTVHRLTLSSP---FNTLDFSKHSQNLFAAAGTDSLVYLYD 277
              S +  + I D R   + T  R  L        T DF+K+  +  A  G D+++ ++D
Sbjct: 192 MCCSGNSYITIFDLRQPPSPTNQRNFLGHSGLEALTCDFNKYRPHTIATGGVDNVIRIWD 251

Query: 278 LRNTAD--------ALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQ 329
           LR T+             + GHE +V  + +SPH   I  S+  D    +W  +     +
Sbjct: 252 LRMTSKNNSSPSICVNEVVGGHELAVRKVCWSPHHSNIFLSTSYDMTCCVWQDVSYTDRR 311

Query: 330 A--QEDAADGVPELMMMHAGHKSAV--NDFSFNWNIPWLMASVEEDNIVHVWKVSKK 382
           +  + ++ D           H   V   D+S  W  P  +AS   D  V +W   ++
Sbjct: 312 STGKTNSIDPNRGCRFKFTQHSEFVYGADWSL-WGQPGYIASTAWDGNVFIWNAFQR 367

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 65/161 (40%), Gaps = 15/161 (9%)

Query: 120 RARFMPQDPNFIATINGVGKVFLFDRSKDKNEALVSEHAFHKD-NGYGLSFNPRTKGELL 178
           +A+F P DPN +   +G   + +FD  +  +         H         FN      + 
Sbjct: 180 QAQFSPHDPNLVMCCSGNSYITIFDLRQPPSPTNQRNFLGHSGLEALTCDFNKYRPHTIA 239

Query: 179 SCSDDGTIALWNVMGT---NTSPS----KAVTTHEDIVNDCTWHEFNENLFGSVSEDKTL 231
           +   D  I +W++  T   N+SPS    + V  HE  V    W   + N+F S S D T 
Sbjct: 240 TGGVDNVIRIWDLRMTSKNNSSPSICVNEVVGGHELAVRKVCWSPHHSNIFLSTSYDMTC 299

Query: 232 QI------HDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAA 266
            +       D+R+    + +  +       F++HS+ ++ A
Sbjct: 300 CVWQDVSYTDRRSTGKTNSIDPNRGCR-FKFTQHSEFVYGA 339

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 56/273 (20%), Positives = 107/273 (39%), Gaps = 65/273 (23%)

Query: 164 GYGLSFNPRTKGEL--LSCSDDGTIALWNVMGTNTSPSKAVTTHE-------DIVNDCTW 214
           GYG+ ++P     L  +S S+ G +    +   +  P   +  HE       D + D  W
Sbjct: 11  GYGVQYSPFFDNRLAVVSGSNFGLVGNGKLFILDIDPQGKI--HESNSFLTQDCLFDVAW 68

Query: 215 HEFNENLFGSVSEDKTLQIHDKRTNSTV-------HRLTLSSPFNTLDFSKHSQNLFAAA 267
           +E +EN       D +L++ D +             +   S  +N L+     +N F ++
Sbjct: 69  NELHENQVLVAQGDGSLRLFDTKLAQYPIAIFKEHQKEVFSCNWNLLN-----KNTFVSS 123

Query: 268 GTDSLVYLYD--------------LRNTADALHTM-------------SGHEDSVTSLEF 300
             D  V ++               L+      H+M             + +++ +   +F
Sbjct: 124 SWDGTVKIWSPTRKDSLLTLTPQPLKTVNRVDHSMNIPMSNQRNHADITRNKNCIYQAQF 183

Query: 301 SPHKDG-ILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNW 359
           SPH    ++C SG +  + ++DL Q  S   Q +         + H+G ++   D  FN 
Sbjct: 184 SPHDPNLVMCCSG-NSYITIFDLRQPPSPTNQRN--------FLGHSGLEALTCD--FNK 232

Query: 360 NIPWLMASVEEDNIVHVWKV---SKKLTSPGLI 389
             P  +A+   DN++ +W +   SK  +SP + 
Sbjct: 233 YRPHTIATGGVDNVIRIWDLRMTSKNNSSPSIC 265

>Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON}
           YCR057C (REAL)
          Length = 924

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 53/246 (21%), Positives = 109/246 (44%), Gaps = 28/246 (11%)

Query: 124 MPQDPNFIATINGVGKVFLFDRSKD--------KNEALVSEHAFHKDNGYGLSFNPRTKG 175
           M Q+P    ++N  G+   F  SK         ++E+ + +   H D+   L+++P    
Sbjct: 298 MGQNPVNTVSVNNTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNSLAYSP-DGS 356

Query: 176 ELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEF--------NENLFGSVSE 227
            +++ SDDG I +W++     +    + T E+  +  T  +F        + +L G+V  
Sbjct: 357 RVVTASDDGKIKVWDI-----TSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRA 411

Query: 228 DKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHT 287
              ++  + RT +   R+     FN L      + + A +  +  ++++ ++ T   L  
Sbjct: 412 WDLIRYRNFRTFTGTERI----QFNCLAVDPSGEVVCAGSLDNFDIHVWSVQ-TGQLLDA 466

Query: 288 MSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAG 347
           +SGHE  V+ L FS  ++ +L S+  D+ + +W +     +    +    V  L M   G
Sbjct: 467 LSGHEGPVSCLSFS-QENSVLASASWDKTIRIWSIFGRSQQVEPLEVYSDVLALSMRPDG 525

Query: 348 HKSAVN 353
            + AV+
Sbjct: 526 KEVAVS 531

>KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON}
           similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1133

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 75/158 (47%), Gaps = 11/158 (6%)

Query: 177 LLSCSDDGTIALWNVMGTNTSPSKAVT----THEDIVNDCTWHEFNENLFGSVSEDKTLQ 232
           ++S S+   I +WN+   + S SKAV      H   + D  +H     +  + S D    
Sbjct: 85  VISTSNQKAI-VWNL---SRSSSKAVEHVLHGHFRAITDINFHPLQPEILATSSIDTYAL 140

Query: 233 IHDKRTNSTVHRLTLS--SPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSG 290
             D R+    +  T +  S    + ++  + N+ A + ++ +VY++D+R     L  + G
Sbjct: 141 AWDMRSPKKPYFRTSNWRSGAAQVKWNHKNSNVLATSHSN-IVYVWDVRKGTSPLSVLEG 199

Query: 291 HEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSE 328
           H  SV S++F+P  +  + SSG+D  V  WD  ++  E
Sbjct: 200 HSGSVNSIDFNPFNETEIMSSGNDGTVKFWDYNKVEDE 237

>Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}
           similar to Ashbya gossypii AFL157C
          Length = 435

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/191 (22%), Positives = 76/191 (39%), Gaps = 45/191 (23%)

Query: 177 LLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDK 236
           +LS S D T  +W++  +N   ++ +  H+  V D  +   + NLF S   D ++++ D 
Sbjct: 182 ILSSSIDTTCTVWDLQASNYVKTQLIA-HDSEVFDAKFLTQSSNLFASCGGDGSVRVFDL 240

Query: 237 RT---------------------------------------NSTVHRLTLSS----PFNT 253
           R                                        N+    L +SS        
Sbjct: 241 RCLAHSTIIYEPQSQIQTHTPSQIQLSAQGHDDGHARKNNQNAAETSLAVSSLESQALLR 300

Query: 254 LDFSKHSQNLFAAAGTDS-LVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSG 312
           L+ S    N+ A    DS +V + D+R     + T++GH  ++  L + P K  +L + G
Sbjct: 301 LEPSPFDPNILATIQQDSNVVIILDMRYPGSPILTLNGHYCALNQLRWHPSKPNVLATCG 360

Query: 313 SDRRVLLWDLM 323
            D ++L WDL+
Sbjct: 361 DDCQILYWDLL 371

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 42/101 (41%), Gaps = 8/101 (7%)

Query: 214 WHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLD--FSKHSQNLFAAAGTDS 271
           W+  + N+  S S D T  + D + ++ V    ++      D  F   S NLFA+ G D 
Sbjct: 174 WNSIDTNIILSSSIDTTCTVWDLQASNYVKTQLIAHDSEVFDAKFLTQSSNLFASCGGDG 233

Query: 272 LVYLYDLRNTA------DALHTMSGHEDSVTSLEFSPHKDG 306
            V ++DLR  A      +    +  H  S   L    H DG
Sbjct: 234 SVRVFDLRCLAHSTIIYEPQSQIQTHTPSQIQLSAQGHDDG 274

>Ecym_2093 Chr2 (165578..168349) [2772 bp, 923 aa] {ON} similar to
           Ashbya gossypii AAR057W
          Length = 923

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 99/216 (45%), Gaps = 28/216 (12%)

Query: 124 MPQDPNFIATINGVGKVFLFDRSKD--------KNEALVSEHAFHKDNGYGLSFNPRTKG 175
           M Q+P    ++N  G+   F  SK         ++E+ + +   H D    L+++P    
Sbjct: 312 MGQNPVNTVSVNKSGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDTMNDLAYSP-DGS 370

Query: 176 ELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNEN--------LFGSVSE 227
            +++ S DG I +W+++         + T E+ V+  T  +F +         L G+V  
Sbjct: 371 RIVTASSDGKIKIWDIVS-----GFCLATFEEHVSAVTAVQFAKKGQIMFSACLDGTVKA 425

Query: 228 DKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHT 287
              ++  + RT +   R+     FN L      + + A +  D  ++++ ++ T   L T
Sbjct: 426 WDLIRYRNFRTFTATERI----QFNCLAVDPSGEIVCAGSLDDFNIHVWSVQ-TGQLLDT 480

Query: 288 MSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLM 323
           +SGHE  V+ L FS +++ +L S+  D+ + +W + 
Sbjct: 481 LSGHEGPVSCLSFS-NENSVLASASWDKTIRIWSIF 515

>NDAI0E01330 Chr5 complement(266071..267363) [1293 bp, 430 aa] {ON} 
          Length = 430

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 83/211 (39%), Gaps = 41/211 (19%)

Query: 217 FNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFN----TLDFSKHSQNLFAAAGTDSL 272
           F+ +LF S S+D  L+  D RT      + LS P N    + D S+ +  LF    +  +
Sbjct: 220 FDNHLFASCSDDNVLRFWDTRTAEKPMWI-LSDPQNGRMTSFDTSQVTNELFVTGFSTGI 278

Query: 273 VYLYDLRNTA----DALHTMSGHE--------------DSVTSLEFSPHKDGILCSSGSD 314
           + L+D+R       D  H  +G E              DSV  ++FSP       + G  
Sbjct: 279 IKLWDVRAVETASNDLTHRQNGEEPIQNELINLYHSGGDSVVDIQFSPTSSSDFLTVGGT 338

Query: 315 RRVLLWDLMQIGS--EQAQEDAADGVPE------LMMMH-AGHKSAVNDFSFNWNIPW-- 363
             V  WD+    S  +   ED  +  PE      L   H  G K     F     + W  
Sbjct: 339 GNVYHWDMEYFFSRNDDDNEDVTNVAPEELQGQCLKFFHTGGSKRTSGLFGKRNTVAWHP 398

Query: 364 ----LMASVEEDNIVHVWKVSKKLTSPGLIQ 390
               L+ +V+ D++V V+   K  T   LIQ
Sbjct: 399 IIDNLVGTVDADSLVTVY---KPFTGRDLIQ 426

>KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]
           {ON} similar to uniprot|P21304 Saccharomyces cerevisiae
           YLR196W PWP1
          Length = 572

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 75/168 (44%), Gaps = 8/168 (4%)

Query: 160 HKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDI-VNDCTWHEFN 218
           H D    L+ N + +  L S S D T+ LW+ + T T+    +  H +  V+   WH  N
Sbjct: 287 HTDAILSLAHNKQFRAVLASTSADHTVKLWD-LNTATAARSLINIHSNTNVSASQWHPSN 345

Query: 219 ENLFGSVSEDKTLQIHDKRT---NSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYL 275
            ++  +   D    + D R    N       +SS           +N+F     +  VY 
Sbjct: 346 GSVLLTAGYDSRAALSDVRIENDNDMSKYWNVSSGEEIECVRFADENIFICGTDNGNVYS 405

Query: 276 YDLRNTADA--LHTMSGHEDSVTSLEFSPHKDGILCSSG-SDRRVLLW 320
           +D+RN A++  + T+  H+  V+S+E + H   +L +S   ++ V LW
Sbjct: 406 FDIRNGAESKPVWTLKAHDAGVSSVEINRHIPNMLLTSAMGEKPVKLW 453

>Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON}
           YCR057C (REAL)
          Length = 916

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 53/246 (21%), Positives = 109/246 (44%), Gaps = 28/246 (11%)

Query: 124 MPQDPNFIATINGVGKVFLFDRSKD--------KNEALVSEHAFHKDNGYGLSFNPRTKG 175
           M Q+P    ++N  G+   F  SK         ++E+ + +   H D+   L+++P    
Sbjct: 295 MGQNPVNTVSVNSTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNCLAYSP-DGS 353

Query: 176 ELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEF--------NENLFGSVSE 227
            +++ SDDG I +W++     +    + T E+  +  T  +F        + +L G+V  
Sbjct: 354 RVVTASDDGKIKVWDI-----TSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRA 408

Query: 228 DKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHT 287
              ++  + RT +   R+     FN L      + + A +  +  ++++ ++ T   L  
Sbjct: 409 WDLIRYRNFRTFTGTERIQ----FNCLAVDPSGEVVCAGSLDNFDIHVWSVQ-TGQLLDA 463

Query: 288 MSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAG 347
           +SGHE  V+ L FS  ++ +L S+  D+ + +W +     +    +    V  L M   G
Sbjct: 464 LSGHEGPVSCLSFS-QENSVLASASWDKTIRIWSIFGRSQQVEPLEVYSDVLALSMRPDG 522

Query: 348 HKSAVN 353
            + AV+
Sbjct: 523 KEVAVS 528

>AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR196W (PWP1)
          Length = 562

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 80/182 (43%), Gaps = 13/182 (7%)

Query: 160 HKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNE 219
           H D    L+ N   +  L S S D T+ LW++     + S         V+   WH  + 
Sbjct: 270 HTDAVLSLAHNRHFRAVLASTSADHTVKLWDLNHGRAARSLDAVHSATAVSSSQWHPSDG 329

Query: 220 NLFGSVSEDKTLQIHDKRTN-----STVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSL-V 273
           ++  +   D  + + D R       S   ++       +  F   S+ +F  AGTDS  V
Sbjct: 330 SILLTAGYDSRVALSDVRIANDAGMSKYWKVMKGEEIESATFV--SETVF-LAGTDSGNV 386

Query: 274 YLYDLRNTADA--LHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVL-LWDLMQIGSEQA 330
           Y +DLRN  D+  L T++ H+  ++SL  SP    +L +S    +V+ LW     G+  A
Sbjct: 387 YSFDLRNGEDSAPLWTLNAHDSGISSLSVSPSIPNMLVTSAMGEKVIKLWKTPAEGA-SA 445

Query: 331 QE 332
           QE
Sbjct: 446 QE 447

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 21/37 (56%)

Query: 286 HTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL 322
           H  + H D+V SL  + H   +L S+ +D  V LWDL
Sbjct: 265 HVATHHTDAVLSLAHNRHFRAVLASTSADHTVKLWDL 301

>ZYRO0F09922g Chr6 complement(805666..807033) [1368 bp, 455 aa] {ON}
           similar to uniprot|P40968 Saccharomyces cerevisiae
           YDR364C CDC40 Pre-mRNA splicing factor important for
           catalytic step II of pre-mRNA splicing and plays a role
           in cell cycle progression required for DNA synthesis
           during mitosis and meiosis has WD repeats
          Length = 455

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/198 (25%), Positives = 84/198 (42%), Gaps = 11/198 (5%)

Query: 157 HAF--HKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTW 214
           H+F  H      L F P+T    LS  +D  + +W+           +  H   +    +
Sbjct: 156 HSFTGHTRGTSALQFLPKTGHLFLSGGNDNILKIWDFYHERICLRDYIG-HSKPIKTVNF 214

Query: 215 HEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVY 274
           +E + N F S S D+ +++ D  T     R   ++  N L +     N F    ++S + 
Sbjct: 215 NE-DGNSFLSASFDQNVKLWDTETGQVKSRYRYNATPNDLKYRPGHLNEFVVGLSNSKIN 273

Query: 275 LYDLRNTADA--LHTMSGHEDSVTSLEFSPHKDG-ILCSSGSDRRVLLWD-LMQIGSEQA 330
            YD R  A+   +     H  S+ SLEF P  DG  L SS  D+ V +W+  + I  +Q 
Sbjct: 274 HYDDRVAANQGLVQVYDHHLSSILSLEFFP--DGSKLISSSEDKTVRIWENQVNIPIKQI 331

Query: 331 QEDAADGVPELMMMHAGH 348
            + A   +P  + +H  H
Sbjct: 332 SDTAQHSMP-FLRVHPEH 348

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 11/40 (27%), Positives = 21/40 (52%)

Query: 285 LHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQ 324
           +H+ +GH    ++L+F P    +  S G+D  + +WD   
Sbjct: 155 IHSFTGHTRGTSALQFLPKTGHLFLSGGNDNILKIWDFYH 194

>NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283
          Length = 389

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 60/123 (48%), Gaps = 13/123 (10%)

Query: 229 KTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAA----GTDSLVYLYDLRNTADA 284
           K   IH  +  +T+H    + PF +LD S+H   L A      G D+ +Y+YD+R     
Sbjct: 87  KIFDIHSTKEVATIHSQG-NVPFPSLD-SRHG--LLACGTELKGVDAAIYIYDIRKWDQP 142

Query: 285 LHTM-SGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMM 343
           + ++   H D VT L++ P+   IL S  +D    ++DL    SE  +ED+   V     
Sbjct: 143 VRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDL----SEAEEEDSLHQVINFAS 198

Query: 344 MHA 346
           +H+
Sbjct: 199 IHS 201

>KNAG0B02800 Chr2 (537056..540979) [3924 bp, 1307 aa] {ON} Anc_7.310
           YDL195W gene spans a gap in the genome sequence
          Length = 1307

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 61/132 (46%), Gaps = 11/132 (8%)

Query: 204 THEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFS------ 257
           + E+ V    W++   ++F S +      I D +    V  L+ +SP   L         
Sbjct: 166 SSEEPVQCLAWNKKQAHIFASTNSTSFASIWDLKAKKDVLHLSYTSPLTGLKPQLSVVEW 225

Query: 258 KHSQNLFAAAGTDS----LVYLYDLRNTADALHTMSG-HEDSVTSLEFSPHKDGILCSSG 312
              Q+ + A GT +    +V ++DLRN    L  ++G H   + SL++    + +L SSG
Sbjct: 226 HPDQSTYVATGTGNDTGPVVVVWDLRNANTPLQELTGGHSKGILSLDWCQQDETLLLSSG 285

Query: 313 SDRRVLLWDLMQ 324
            D  V+LW+ ++
Sbjct: 286 RDNSVVLWNPIE 297

>SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {ON}
           highly similar to uniprot|Q75BY3 Ashbya gossypii ACR137W
           PRP46 Pre-mRNA-splicing factor PRP46 and similar to
           YPL151C uniprot|Q12417 Saccharomyces cerevisiae YPL151C
           PRP46 Splicing factor that is found in the Cef1p
           subcomplex of the spliceosome
          Length = 441

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 86/186 (46%), Gaps = 11/186 (5%)

Query: 181 SDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNS 240
           S+D TI +W++       +  ++ H   V D    + +  +F S SEDK ++  D   N 
Sbjct: 149 SNDTTIKIWDLATGKLKLT--LSGHIMTVKDICISKRHPYMF-SASEDKLVKCWDLEKNR 205

Query: 241 TVHRLTLS-SPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLE 299
            +       S  +T+D    + NL A AG DS+V L+D+R T   + TM+GH+  +  ++
Sbjct: 206 VIRDYHGHLSGVHTVDIHP-TLNLIATAGRDSVVRLWDIR-TKLPVMTMAGHKSPINRVK 263

Query: 300 FSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGH---KSAVNDFS 356
             P  D  + S  +D  V LWD+    + +        V ++  +H G     SA  D  
Sbjct: 264 CLP-VDPQVVSCSADATVRLWDITAGKTLKVLTHHKRSVRDI-GIHPGEFSISSACTDDI 321

Query: 357 FNWNIP 362
            +W +P
Sbjct: 322 RSWKLP 327

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 24/108 (22%), Positives = 43/108 (39%), Gaps = 19/108 (17%)

Query: 285 LHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMM 344
           +  ++GH   V ++   P  +    +  +D  + +WDL                 +L + 
Sbjct: 122 MRVINGHNGWVRTVAVDPIDNEWFATGSNDTTIKIWDL--------------ATGKLKLT 167

Query: 345 HAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKLTSPGLIQDY 392
            +GH   V D   +   P+ M S  ED +V  W + K      +I+DY
Sbjct: 168 LSGHIMTVKDICISKRHPY-MFSASEDKLVKCWDLEKNR----VIRDY 210

>NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8.316
           YDR142C
          Length = 398

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 56/244 (22%), Positives = 93/244 (38%), Gaps = 56/244 (22%)

Query: 136 GVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTN 195
           G GK+ + D   D      S     +D  + +++N   + + L    DG++ L+++    
Sbjct: 36  GNGKLVILDILPD-GTIKESNSFLTQDCLFDVAWNESHESQCLVAQGDGSLRLFDI-NLQ 93

Query: 196 TSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQ---------------IHDKRT-- 238
             P      H+  V  C W+  N+NLF S S D  ++               IH   T  
Sbjct: 94  KYPIAIFKEHKKEVLSCNWNLINKNLFLSSSWDGDVKVWSTARQASLITLSPIHTDPTAI 153

Query: 239 ---------------------NSTVHRLTLSSP----------FNTLDFSKHSQNLFAAA 267
                                 ST  R  ++S                FS H  N+ A  
Sbjct: 154 VNTKSNINPSLNNVSQPILHPRSTAIRQPVTSASMQGNDNKNCIYQAQFSPHDPNIVACC 213

Query: 268 GTDSLVYLYDLR----NTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLM 323
              S + L+DLR    N    + T SG+E    +L+F+ ++  I+ +SG D+ + +WD+ 
Sbjct: 214 SGTSYLTLFDLRQPTPNVQRGILTQSGYE--TLTLDFNKYRSHIIATSGVDKAIKMWDMR 271

Query: 324 QIGS 327
            I S
Sbjct: 272 FIPS 275

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 64/152 (42%), Gaps = 29/152 (19%)

Query: 253 TLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMS--------------------GHE 292
           TLDF+K+  ++ A +G D  + ++D+R         S                     H+
Sbjct: 245 TLDFNKYRSHIIATSGVDKAIKMWDMRFIPSTFSPQSTSTTPILSRRQQEPINEIINAHD 304

Query: 293 DSVTSLEFSPHKDGILCSSGSDRRVLLW-DL-MQIGSEQAQEDAAD-----GVPELMMMH 345
            +V ++++SPH   ++ S+  D     W D+  Q G+   + ++ D     G   +M  H
Sbjct: 305 LAVKTIKWSPHHSNLMVSTSYDMTCKTWMDISYQNGTSNGRTNSLDPQRRNGCLAIMDKH 364

Query: 346 AGHKSAVNDFSFNWNIPWLMASVEEDNIVHVW 377
           +     V D+S  W  P  +AS   D  V +W
Sbjct: 365 SEFAFGV-DWSL-WGQPGFIASTGWDGNVFIW 394

 Score = 36.6 bits (83), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 48/212 (22%), Positives = 88/212 (41%), Gaps = 19/212 (8%)

Query: 120 RARFMPQDPNFIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGY---GLSFNPRTKGE 176
           +A+F P DPN +A  +G   + LFD  +        +      +GY    L FN      
Sbjct: 199 QAQFSPHDPNIVACCSGTSYLTLFDLRQPTPNV---QRGILTQSGYETLTLDFNKYRSHI 255

Query: 177 LLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDK 236
           + +   D  I +W++    ++ S   T+   I++       NE +       KT++    
Sbjct: 256 IATSGVDKAIKMWDMRFIPSTFSPQSTSTTPILSRRQQEPINEIINAHDLAVKTIKWSPH 315

Query: 237 RTN---STVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHED 293
            +N   ST + +T  +    +D S   QN  +   T+SL    D +     L  M  H +
Sbjct: 316 HSNLMVSTSYDMTCKT---WMDISY--QNGTSNGRTNSL----DPQRRNGCLAIMDKHSE 366

Query: 294 SVTSLEFSP-HKDGILCSSGSDRRVLLWDLMQ 324
               +++S   + G + S+G D  V +W+ ++
Sbjct: 367 FAFGVDWSLWGQPGFIASTGWDGNVFIWNTLR 398

>AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR178W
           (PRP4)
          Length = 455

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 53/221 (23%), Positives = 98/221 (44%), Gaps = 23/221 (10%)

Query: 158 AFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEF 217
           A H+    GL ++P     LLS   D  + LW++    ++  + +  H   V+    H  
Sbjct: 212 AAHEGKIGGLDWHP-DGNHLLSGGGDNLVKLWDM---TSNSFEELRGHAGRVSRVKVHP- 266

Query: 218 NENLFGSVSEDKTLQIHD-KRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLY 276
           +  L  S S D T  + D +R      +   S    T+ F      L A+AG D++  ++
Sbjct: 267 SGRLAASASFDLTWILWDLERKVELQLQEGHSKAVYTIAFQSDGA-LLASAGLDAVCAIW 325

Query: 277 DLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAAD 336
           DLR + + +  + GH  +++ +++SP+    L ++G+D  V +WD+  +G+E A      
Sbjct: 326 DLR-SGEPIMKLEGHAGAISGVDWSPNGYQ-LATAGADGTVRVWDIRNVGTESAL----- 378

Query: 337 GVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVW 377
                      H+ A  D  F  N    + S   D +V+++
Sbjct: 379 ---------LAHQVAALDVKFKKNNGTFLVSCGHDRLVNIF 410

>Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W
           (REAL)
          Length = 391

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 63/150 (42%), Gaps = 23/150 (15%)

Query: 235 DKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDS 294
           D R   T  R  ++S    L F     N       D ++ +YD  N    L  +SGH+  
Sbjct: 14  DFRPGRTTLRGHMTSVITCLQFE---DNYVITGADDKMIRVYDAINKKFLLQ-LSGHDGG 69

Query: 295 VTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVN- 353
           V +L++S   DGIL S  +D  V +WD+ +       E              GHKS V  
Sbjct: 70  VWALKYS--HDGILVSGSADSTVRVWDIKKGYCTHVFE--------------GHKSTVRC 113

Query: 354 -DFSFNWNIPWLMASVEEDNIVHVWKVSKK 382
            D     N  +++     DN +HVWK+ KK
Sbjct: 114 LDIVEYENTNYIVTG-SRDNTLHVWKLPKK 142

>Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {ON}
           complement(85833..86999) [1167 nt, 389 aa]
          Length = 388

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 78/180 (43%), Gaps = 26/180 (14%)

Query: 167 LSFNPRTKGELLSCSDDGTIAL--WN-------VMGTNTSPSKAVTTHEDIVNDCTWHEF 217
           L   P  +  LLS   +G + L  WN       V   NTS ++      D  N   +   
Sbjct: 19  LELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRMRVLDSDYDNGSVF--- 75

Query: 218 NENLFGSVSEDKTLQIHDKRT--NSTVHRLT--LSSPFNTLDFSKHSQNLFAA--AGTDS 271
                 SV+ +  +++ D R   NS V  L     +PF +LD S+H         +G D+
Sbjct: 76  ------SVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLD-SRHGMLACGTELSGVDA 128

Query: 272 LVYLYDLRNTADALHTM-SGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQA 330
            +++YD+RN    +  +   H D VT ++F P    +L S  +D    ++DL Q+  E A
Sbjct: 129 EIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEEDA 188

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 67/180 (37%), Gaps = 21/180 (11%)

Query: 160 HKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNE 219
           H D+   + F+P     LLS S DG   ++++       +     + + V+ C W   + 
Sbjct: 149 HHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEEDALHQVINYESVHSCGW--LSP 206

Query: 220 NLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFN--------TLDFSKHSQNLFAAAGTDS 271
               ++S  +T  IH+   N+    LT   P +          D+       + A G   
Sbjct: 207 KRIYTLSHMETFAIHE--LNNKSDELTEPKPLDFGDIRGTWDCDYVVDVYPGYIAVGKSE 264

Query: 272 --------LVYLYDLRNTADALHTMSGHEDSVTSLEF-SPHKDGILCSSGSDRRVLLWDL 322
                   + +  +L N  D++   + H D V    F SP    I+ S G D  V  W +
Sbjct: 265 ENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDVFISPKSQNIMYSCGEDGSVKTWKI 324

>Ecym_4644 Chr4 (1256560..1257447) [888 bp, 295 aa] {ON} similar to
           Ashbya gossypii ACR199C
          Length = 295

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 50/210 (23%), Positives = 87/210 (41%), Gaps = 21/210 (10%)

Query: 131 IATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSF-NPRTKGELLSCSDDGTIALW 189
           +AT +    + +F+   D ++ + + H  H+   + + + +P+    L SCS DG + +W
Sbjct: 24  LATCSSDKTIQIFEVEGDSHKLVETLHG-HEGPVWQVDWAHPKFGVILASCSYDGKVLIW 82

Query: 190 NVMGTNTSPSKAVTTHEDIVNDCTW--HEFNENLFGSVSEDKTLQIHDKRTNST------ 241
                  S       H   VN   W  HE+   L  + S+ K   +  K   +T      
Sbjct: 83  KEENGRWSQIATSEVHSASVNSIKWAPHEYGPLLLCASSDGKFSVVEFKENGTTSPIIID 142

Query: 242 VHRLTLS----SPFNTLDFSKHSQNL--FAAAGTDSLVYLYDLR---NTADALHTMSGHE 292
            H + ++    +P    +  +H Q L   A  G D+LV ++      NT     T+SGH 
Sbjct: 143 AHAIGVNAACWAPATIEEDGQHPQQLRRIATGGADNLVKIWKFNSESNTYLLEDTLSGHS 202

Query: 293 DSVTSLEFSPH--KDGILCSSGSDRRVLLW 320
           D V  + +SP       L +   DR  ++W
Sbjct: 203 DWVRDVAWSPSVLPRAYLATVSQDRTCIIW 232

>NCAS0B01440 Chr2 (236104..237390) [1287 bp, 428 aa] {ON} 
          Length = 428

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 52/201 (25%), Positives = 84/201 (41%), Gaps = 41/201 (20%)

Query: 217 FNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFN----TLDFSKHSQNLFAAAGTDSL 272
           F+ ++F S S+D  L+  D RTN       L+ P N    + D S  S +LF    +  L
Sbjct: 223 FDNHMFASCSDDNVLRFWDTRTNDK-PLWVLADPQNGRLTSFDASSVSSDLFVTGFSTGL 281

Query: 273 VYLYDLR----NTADALHTMSGHE--------------DSVTSLEFSPHKDGILCSSGSD 314
           + L+D R     T D  +  +G E              DSV  ++FSP     + + G  
Sbjct: 282 IKLWDARAVEAATLDFTNRQNGEEPIQKEIANFYHSGGDSVVDVQFSPTSPTEVLTVGGS 341

Query: 315 RRVLLWDLMQIGSEQAQEDAADGVPE----------LMMMHAG-------HKSAVNDFSF 357
             V  WD M+        D  + VP+          L  +H G        +   N  ++
Sbjct: 342 GNVYHWD-MEYALSNYDADDKNRVPQDACEKLQTESLKFLHTGGSRRSSKQRGKRNTVAW 400

Query: 358 NWNIPWLMASVEEDNIVHVWK 378
           +  I  L+A+V++D++V V+K
Sbjct: 401 HPVIDELVATVDDDSLVSVYK 421

>KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON}
           uniprot|P56094 Kluyveromyces lactis KLLA0F10263g TUP1
           Transcriptional repressor TUP1
          Length = 682

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 61/255 (23%), Positives = 109/255 (42%), Gaps = 39/255 (15%)

Query: 160 HKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNE 219
           H+ + Y L + P +  +L+S S D T+ +W++     S + ++   ED V          
Sbjct: 447 HEQDIYSLDYFP-SGNKLVSGSGDRTVRIWDLTTGTCSLTLSI---EDGVTTVAVSPGEG 502

Query: 220 NLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNT--------LDFSKHSQNLFAAAGTDS 271
               + S D+T+++ D  T   V RL   +   T        + F++  + + + +  D 
Sbjct: 503 KFIAAGSLDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGS-LDR 561

Query: 272 LVYLYDL------RNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQI 325
            V L++L      ++ A+   T +GH+D V S+  + + + IL  S  DR VL W     
Sbjct: 562 SVKLWNLNGLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGS-KDRGVLFW----- 615

Query: 326 GSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPW-----LMASVEEDNIVHVWKVS 380
                  D   G P LM+   GH+++V   +     P      + A+   D    +WK S
Sbjct: 616 -------DTKSGNPLLMLQ--GHRNSVISVTVANGHPLGPEYGVFATGSGDCKARIWKYS 666

Query: 381 KKLTSPGLIQDYDIR 395
           KK +     Q  +I+
Sbjct: 667 KKNSQQNSTQIKEIK 681

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 96/218 (44%), Gaps = 26/218 (11%)

Query: 167 LSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTT---HEDIVNDCTWHEFNENLFG 223
           + F+P  K  L + ++D  I +W++        K V T   HE  +    +      L  
Sbjct: 412 VCFSPDGK-FLATGAEDKLIRIWDL-----ETKKIVMTLKGHEQDIYSLDYFPSGNKLV- 464

Query: 224 SVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYD-----L 278
           S S D+T++I D  T +    L++     T+  S       AA   D  V ++D     L
Sbjct: 465 SGSGDRTVRIWDLTTGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWDSDTGFL 524

Query: 279 RNTADALHTM-SGHEDSVTSLEFSPHKDGILCSSGS-DRRVLLWDLMQIGSEQAQEDAAD 336
               D+ + + +GH DSV S+ F+  +DG    SGS DR V LW+L  +  +++      
Sbjct: 525 VERLDSENELGTGHRDSVYSVVFT--RDGKGVVSGSLDRSVKLWNLNGLSGQKSHA---- 578

Query: 337 GVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIV 374
              E  + + GHK  V   +   N  ++++  ++  ++
Sbjct: 579 ---ECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVL 613

 Score = 37.7 bits (86), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 56/130 (43%), Gaps = 4/130 (3%)

Query: 193 GTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTL-SSPF 251
           GT    S A T   D+         +     + +EDK ++I D  T   V  L       
Sbjct: 392 GTGNQNSAASTASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDI 451

Query: 252 NTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSS 311
            +LD+      L + +G D  V ++DL     +L T+S  ED VT++  SP +   + + 
Sbjct: 452 YSLDYFPSGNKLVSGSG-DRTVRIWDLTTGTCSL-TLS-IEDGVTTVAVSPGEGKFIAAG 508

Query: 312 GSDRRVLLWD 321
             DR V +WD
Sbjct: 509 SLDRTVRVWD 518

>NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {ON}
           Anc_6.325
          Length = 915

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 53/243 (21%), Positives = 105/243 (43%), Gaps = 22/243 (9%)

Query: 124 MPQDPNFIATINGVGKVFLFDRSKD--------KNEALVSEHAFHKDNGYGLSFNPRTKG 175
           M Q+P     +N  G+   F  SK         ++E+ + +   H D    L+++P    
Sbjct: 298 MGQNPINTVAVNSSGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDATNSLTYSP-DGS 356

Query: 176 ELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLF-----GSVSEDKT 230
            +++ ++DG I +W+V+      +     H   V    + +  + LF     G+V     
Sbjct: 357 RVVTAAEDGKIKVWDVVSGFCLAT--FQEHTSSVTQVQFAKRGQVLFSSSLDGTVRAWDL 414

Query: 231 LQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSG 290
           ++  + RT +   R+     FN L      + + A +  +  ++++ ++ T   L T+SG
Sbjct: 415 IRYRNFRTFTAAERI----QFNCLAVDPSGEVVCAGSLDNFDIHVWSVQ-TGQLLDTLSG 469

Query: 291 HEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKS 350
           HE  V+ L FS  ++ +L S+  D+ V +W +     +    D    V  L +   G + 
Sbjct: 470 HEGPVSCLAFS-QENSVLASASWDKTVRVWSIFGRSQQVEPFDVYSDVLALTIRPDGKQV 528

Query: 351 AVN 353
           AV+
Sbjct: 529 AVS 531

>Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON}
           YDL145C (COP1) - alpha subunit of the coatamer complex;
           gamma-alpha-COP [contig 161] FULL
          Length = 1210

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 93/223 (41%), Gaps = 41/223 (18%)

Query: 177 LLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHD- 235
           ++S SDD TI +WN    N      +T H   V    +H   E+L  S S D+T+++ D 
Sbjct: 110 IISASDDQTIRIWN--WQNRKEIACLTGHNHFVMCADFHP-TEDLVVSASLDETVRVWDI 166

Query: 236 ---KRTNSTVHRLTL----SSPFNTLD-----------FSKHSQN-----------LFAA 266
              ++ +S     TL    ++  N LD              HS+            L  +
Sbjct: 167 SGLRKRHSAPSTYTLEDQIAAQQNLLDGGFGDCVVKFILEGHSRGVNWASFHPTLPLIVS 226

Query: 267 AGTDSLVYLYDLRNT-ADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL--- 322
            G D  V L+ + +T A  + T  GH ++V S+ F PH++ ++ S G D+ V +WDL   
Sbjct: 227 GGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPHQN-LIISVGEDKTVRVWDLDKR 285

Query: 323 ---MQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIP 362
               Q   E  +       P + +  A H S +  F  +   P
Sbjct: 286 TPVKQFKRENDRFWLVRAHPNINLFGAAHDSGIMVFKLDRERP 328

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 43/107 (40%), Gaps = 17/107 (15%)

Query: 271 SLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQA 330
           S + L+D R     LH    HE  V  ++F P +  +  S+G D  + +W L        
Sbjct: 33  SSIQLWDYR-MGTLLHKFEDHEGPVRGIDFHPTQP-LFVSAGDDYTIKVWSL-------- 82

Query: 331 QEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVW 377
                    + +    GH   V    F+  +PW++ S  +D  + +W
Sbjct: 83  ------DTKKCLFTLNGHLDYVRTVFFHRELPWII-SASDDQTIRIW 122

>SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly
           similar to uniprot|P25636 Saccharomyces cerevisiae
           YCR057C PWP2 part of small (ribosomal) subunit (SSU)
           processosome (contains U3 snoRNA) Eight WD-repeats with
           homology with G protein beta subunits flanked by
           nonhomologous N-terminal and C-terminal extensions
           regulatory protein
          Length = 909

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 56/245 (22%), Positives = 109/245 (44%), Gaps = 30/245 (12%)

Query: 124 MPQDPNFIATINGVGKVFLFDRSKD--------KNEALVSEHAFHKDNGYGLSFNPRTKG 175
           M Q+     +IN  G+   F  SK         ++E+ + +   H D+   L+++P    
Sbjct: 297 MGQNAVNTVSINNSGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSMNSLTYSP-DGS 355

Query: 176 ELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHE--------FNENLFGSVSE 227
            +++ SDDG I +W+V+         + T +D  +  T  +        F+ +L G+V  
Sbjct: 356 RVVTSSDDGKIKIWDVVS-----GFCLATFDDHTSSVTAVQFAKKGQVLFSASLDGTVKA 410

Query: 228 DKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSL-VYLYDLRNTADALH 286
              ++  + RT +   R+     FN L     S  +  A   DS  ++++ ++ T + L 
Sbjct: 411 WDLIRYRNFRTFTAAERI----QFNCLAVDP-SGEVVCAGSVDSFEIHVWSVQ-TGNLLD 464

Query: 287 TMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHA 346
           T++GHE  V+ L FS +++ +L S+  D+ + +W +     +    D    V  + M   
Sbjct: 465 TLAGHEGPVSCLSFS-NENSVLASASWDKTIRIWSIFGRSQQVEPFDVYSDVLAISMRPD 523

Query: 347 GHKSA 351
           G + A
Sbjct: 524 GKQVA 528

>TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON}
           Anc_8.672 YPL151C
          Length = 434

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 101/231 (43%), Gaps = 48/231 (20%)

Query: 181 SDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTN- 239
           S+D +I +W++       +  ++ H   V D    E +  +F S SEDKT++  D   N 
Sbjct: 142 SNDTSIKVWDLASGKLKLT--LSGHIMTVRDLAISERHPYMF-SASEDKTIKCWDLEKNM 198

Query: 240 ---------STVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSG 290
                    S VH ++L     TLD       L  +AG DS+V L+D+R     ++ + G
Sbjct: 199 VIRNYHGHLSGVHTVSLHP---TLD-------LVVSAGRDSVVKLWDMRTRVPVMNLI-G 247

Query: 291 HEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKS 350
           H+  +  +   P  D  + S  +D  + LWD+              G    ++ H  HK 
Sbjct: 248 HKSPINKVRCLP-VDPQIISCSTDANIRLWDITA------------GKSAKILTH--HKR 292

Query: 351 AVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKL-------TSPGLIQDYDI 394
           +V DF+ + +  + MAS   D+I   WK+ + +       TS G+I    I
Sbjct: 293 SVRDFALHPS-EFSMASACTDDI-RSWKLPEGILLTNFQSTSTGIINSLSI 341

 Score = 33.9 bits (76), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 74/179 (41%), Gaps = 32/179 (17%)

Query: 176 ELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHD 235
           +++SCS D  I LW++  T    +K +T H+  V D   H    ++  + ++D       
Sbjct: 263 QIISCSTDANIRLWDI--TAGKSAKILTHHKRSVRDFALHPSEFSMASACTDDIRSWKLP 320

Query: 236 KRTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHE-DS 294
           +    T  + T +   N+L  + H   LF A G D  +  YD +         SGH+  S
Sbjct: 321 EGILLTNFQSTSTGIINSLSIN-HDDVLF-AGGDDGTLSFYDYK---------SGHKYQS 369

Query: 295 VTSLEFS---PHKDGILCSSGS-----------DRRVLLWDLMQIGSEQAQEDAADGVP 339
           + + E       + GILCSS             D+ + +W       E A  D+  G+P
Sbjct: 370 LLTTEIPGSLESERGILCSSFDQTGLRLITGEIDKSIKIWK----QEESATPDSNPGLP 424

 Score = 30.8 bits (68), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 46/108 (42%), Gaps = 19/108 (17%)

Query: 285 LHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMM 344
           +  ++GH   V  +E  P  +    +  +D  + +WDL            A G  +L + 
Sbjct: 115 IRVINGHIGWVRCVEVDPVDNAWYATGSNDTSIKVWDL------------ASG--KLKLT 160

Query: 345 HAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKLTSPGLIQDY 392
            +GH   V D + +   P+ M S  ED  +  W + K +    +I++Y
Sbjct: 161 LSGHIMTVRDLAISERHPY-MFSASEDKTIKCWDLEKNM----VIRNY 203

>Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C
           (PRP46) - pre-mRNA splicing factor [contig 67] FULL
          Length = 433

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 71/143 (49%), Gaps = 7/143 (4%)

Query: 181 SDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNS 240
           S+D TI +W++       +  +T H   V      + +  +F S SEDK ++  D   N+
Sbjct: 141 SNDTTIKVWDMASGKLKLT--LTGHVMTVRSVAVSQRHPLMF-SASEDKMVKCWDLERNA 197

Query: 241 TVHRLTLS-SPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLE 299
            +       S  NT+D    + +L A+AG D++V L+D+R     + T++GH+  +  ++
Sbjct: 198 AIRDYHGHFSGVNTVDVHP-TLDLIASAGRDAVVRLWDIRTRLPVM-TLAGHKSPINQVK 255

Query: 300 FSPHKDGILCSSGSDRRVLLWDL 322
             P  D  + S  SD  V LWD+
Sbjct: 256 CFP-VDPQIMSCSSDATVRLWDI 277

>KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa]
           {ON} highly similar to uniprot|P53622 Saccharomyces
           cerevisiae YDL145C COP1 Alpha subunit of COPI vesicle
           coatomer complex which surrounds transport vesicles in
           the early secretory pathway
          Length = 1209

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 58/239 (24%), Positives = 102/239 (42%), Gaps = 43/239 (17%)

Query: 177 LLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHD- 235
           ++S SDD TI +WN    N      +T H   V    +H   E+L  S S D+T+++ D 
Sbjct: 110 IISASDDQTIRIWN--WQNRKEIACLTGHNHFVMCADFHP-TEDLVVSASLDETVRVWDI 166

Query: 236 ---KRTNSTVHRLTL----SSPFNTLD-----------FSKHSQN-----------LFAA 266
              ++ +S     TL    ++  N LD              H++            L  +
Sbjct: 167 SGLRKRHSAPSTYTLEDQIAAQQNLLDGGFGDCVVKFILEGHARGVNWASFHPTLPLIVS 226

Query: 267 AGTDSLVYLYDLRNT-ADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDL--- 322
            G D  V L+ + +T A  + T  GH ++V S+ F PH++ ++ S G D+ + +WDL   
Sbjct: 227 GGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPHQN-LIISVGEDKTIRVWDLDKR 285

Query: 323 ---MQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVWK 378
               Q   E  +       P + +  A H S +  F  +   P   +++ ++ ++ V K
Sbjct: 286 TPVKQFKRENDRFWLVRAHPNINLFGAAHDSGIMVFKLDRERP--CSAINQNQLIFVNK 342

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 43/107 (40%), Gaps = 17/107 (15%)

Query: 271 SLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQA 330
           S + L+D R     LH    HE  V  ++F P +  +  S+G D  + +W L        
Sbjct: 33  SSIQLWDYR-MGTLLHKFEDHEGPVRGIDFHPTQP-LFVSAGDDYTIKVWSL-------- 82

Query: 331 QEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNIVHVW 377
                    + +    GH   V    F+  +PW++ S  +D  + +W
Sbjct: 83  ------DTKKCLFTLNGHLDYVRTVFFHRELPWII-SASDDQTIRIW 122

>TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa]
           {ON} Anc_6.340 YCR072C
          Length = 514

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 59/252 (23%), Positives = 103/252 (40%), Gaps = 61/252 (24%)

Query: 174 KGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQI 233
           K  L S S DGTI +W+  G        ++ H   V+   W    +N+  + S DKT+++
Sbjct: 247 KPRLASASKDGTIKVWDTTGRVCL--YTLSGHTSSVSCVRWG--GQNMLYTGSHDKTIRV 302

Query: 234 HDKRTNST-----------VHRLTLSS-------PFN----------------------T 253
            D  +N             V+ L+LS+       PF+                       
Sbjct: 303 WDMNSNGRCINILKSHAHWVNHLSLSTDYALRIGPFDHSGAKPAIAEEARDKALKNYEKI 362

Query: 254 LDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILCSSGS 313
           +  + H++ L   A  D  ++L++   +   L  M+GH+  V  + FSP    I+ S+  
Sbjct: 363 VKKNGHTEELMVTASDDFTMFLWNPLKSTKPLARMTGHQKLVNHVAFSPDGRHIV-SASF 421

Query: 314 DRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEEDNI 373
           D  + LW            D  DG  + +    GH ++V   +++ +   L+ S  +D  
Sbjct: 422 DNSIKLW------------DGRDG--KFISTFRGHVASVYQVAWSSDCR-LLVSCSKDTT 466

Query: 374 VHVWKV-SKKLT 384
           + VW V +KKL+
Sbjct: 467 LKVWDVRTKKLS 478

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 90/175 (51%), Gaps = 17/175 (9%)

Query: 149 KNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDI 208
           +++AL +     K NG+       T+  +++ SDD T+ LWN +  +T P   +T H+ +
Sbjct: 352 RDKALKNYEKIVKKNGH-------TEELMVTASDDFTMFLWNPL-KSTKPLARMTGHQKL 403

Query: 209 VNDCTWHEFNENLFGSVSEDKTLQIHDKRTNS--TVHRLTLSSPFNTLDFSKHSQNLFAA 266
           VN   +     ++  S S D ++++ D R     +  R  ++S +  + +S   + L  +
Sbjct: 404 VNHVAFSPDGRHIV-SASFDNSIKLWDGRDGKFISTFRGHVASVYQ-VAWSSDCR-LLVS 460

Query: 267 AGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGI-LCSSGSDRRVLLW 320
              D+ + ++D+R    ++  + GH+D V ++++S   DG  +CS G D+ V LW
Sbjct: 461 CSKDTTLKVWDVRTKKLSVD-LPGHQDEVFTVDWS--VDGKRVCSGGKDKMVRLW 512

>KNAG0H01290 Chr8 (227947..229341) [1395 bp, 464 aa] {ON} Anc_3.259
           YDR030C
          Length = 464

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 76/187 (40%), Gaps = 18/187 (9%)

Query: 199 SKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSK 258
           + A + H+  V    W+  +  +F S   D+T++I D  T   V  L L    N LD + 
Sbjct: 148 ADAQSAHQFRVTSVKWYGSDNGMFFSGGNDRTVKIWDTNTFECVQDLALGYVVNQLDCTN 207

Query: 259 HSQNLFAAAGTDSLVYLYDLRNTADALHTMSGH--------EDSVTSLEFSPHKDGILCS 310
           +S N    A  D    + DLRN    + T+ G         +  + + +  P ++ I+ S
Sbjct: 208 NSLNSVLVASDDYYPRMIDLRNMNMGV-TIFGKGSQRGVPMKHEILTCKMDPAREYIVAS 266

Query: 311 SGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVEE 370
             S   V +WDL Q  +   Q              + H+++  D  +N     L ASV  
Sbjct: 267 GDSSGSVKVWDLRQTNNLLVQLSRGG--------DSAHRASCVDICWNHEGTKL-ASVSL 317

Query: 371 DNIVHVW 377
           D  + +W
Sbjct: 318 DGTIVLW 324

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.130    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 40,221,988
Number of extensions: 1706775
Number of successful extensions: 9437
Number of sequences better than 10.0: 1079
Number of HSP's gapped: 8010
Number of HSP's successfully gapped: 1936
Length of query: 398
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 286
Effective length of database: 40,638,807
Effective search space: 11622698802
Effective search space used: 11622698802
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)