Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E00792g6.8ON51151127390.0
TDEL0G046306.8ON50350614980.0
Kpol_1045.796.8ON50850712801e-172
NDAI0G00860singletonON52352912511e-168
TPHA0J002606.8ON51551211711e-156
TPHA0M001806.8ON50351311361e-151
KNAG0E027706.8ON50852011091e-146
Skud_16.56.8ON51551911001e-145
CAGL0A01089g6.8ON53554810991e-144
Smik_6.4806.8ON51652210871e-143
Suva_16.336.8ON51852410781e-142
YPL272C6.8ON51752010751e-141
KAFR0B065106.8ON50852310251e-134
Ecym_30116.8ON5095149971e-130
KLTH0C11572g6.8ON5185139701e-125
TBLA0A072206.8ON5095319031e-115
ACR018C6.8ON4784888831e-113
Kwal_56.223416.8ON5195188771e-111
NCAS0D021806.8ON5155228391e-106
Kpol_1032.1singletonON2462423161e-32
CAGL0K00737g5.119ON4574581651e-11
TDEL0E051105.119ON4694491402e-08
KLTH0C02178g5.119ON4644531402e-08
Kwal_27.98985.119ON4604601107e-05
Kpol_1010.495.119ON4814411109e-05
Kpol_191.16.8ON1391391012e-04
TPHA0H009605.119ON4765271053e-04
SAKL0G15004g5.119ON4562871028e-04
NDAI0D023605.119ON470461960.004
KNAG0G007005.119ON456465960.004
Skud_7.5485.119ON47564960.004
Smik_16.945.119ON466399930.009
ZYRO0F01540g5.119ON470132870.042
YGR212W (SLI1)5.119ON46856760.99
TDEL0A031102.536ON20088721.8
Ecym_42068.368ON1877104742.1
Ecym_24835.119ON461120732.5
TDEL0E054106.232ON35968705.2
KAFR0G03810singletonON36454705.4
KAFR0B049802.373ON36455705.6
KAFR0B041105.119ON474230688.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E00792g
         (511 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar ...  1059   0.0  
TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {O...   581   0.0  
Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa] ...   497   e-172
NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON}              486   e-168
TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8 ...   455   e-156
TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8 ...   442   e-151
KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8...   431   e-146
Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON} YP...   428   e-145
CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {...   427   e-144
Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C ...   423   e-143
Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}...   419   e-142
YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON} Pu...   418   e-141
KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa] ...   399   e-134
Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to ...   388   e-130
KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {...   378   e-125
TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6...   352   e-115
ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON} S...   344   e-113
Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C ...   342   e-111
NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8      327   e-106
Kpol_1032.1 s1032 (25..765) [741 bp, 246 aa] {ON} (25..765) [741...   126   1e-32
CAGL0K00737g Chr11 complement(81263..82636) [1374 bp, 457 aa] {O...    68   1e-11
TDEL0E05110 Chr5 (941876..943285) [1410 bp, 469 aa] {ON} Anc_5.1...    59   2e-08
KLTH0C02178g Chr3 complement(196605..197999) [1395 bp, 464 aa] {...    59   2e-08
Kwal_27.9898 s27 (112396..113778) [1383 bp, 460 aa] {ON} YGR212W...    47   7e-05
Kpol_1010.49 s1010 (113037..114482) [1446 bp, 481 aa] {ON} (1130...    47   9e-05
Kpol_191.1 s191 complement(429..848) [420 bp, 139 aa] {ON} compl...    44   2e-04
TPHA0H00960 Chr8 (201187..202617) [1431 bp, 476 aa] {ON} Anc_5.1...    45   3e-04
SAKL0G15004g Chr7 (1288241..1289611) [1371 bp, 456 aa] {ON} simi...    44   8e-04
NDAI0D02360 Chr4 (545485..546897) [1413 bp, 470 aa] {ON} Anc_5.1...    42   0.004
KNAG0G00700 Chr7 complement(132337..133707) [1371 bp, 456 aa] {O...    42   0.004
Skud_7.548 Chr7 (891732..893159) [1428 bp, 475 aa] {ON} YGR212W ...    42   0.004
Smik_16.94 Chr16 complement(178129..179529) [1401 bp, 466 aa] {O...    40   0.009
ZYRO0F01540g Chr6 complement(124663..126075) [1413 bp, 470 aa] {...    38   0.042
YGR212W Chr7 (917040..918446) [1407 bp, 468 aa] {ON}  SLI1N-acet...    34   0.99 
TDEL0A03110 Chr1 complement(554890..555492) [603 bp, 200 aa] {ON...    32   1.8  
Ecym_4206 Chr4 (426316..431949) [5634 bp, 1877 aa] {ON} similar ...    33   2.1  
Ecym_2483 Chr2 (946645..948030) [1386 bp, 461 aa] {ON} similar t...    33   2.5  
TDEL0E05410 Chr5 complement(989327..990406) [1080 bp, 359 aa] {O...    32   5.2  
KAFR0G03810 Chr7 complement(786690..787784) [1095 bp, 364 aa] {O...    32   5.4  
KAFR0B04980 Chr2 complement(1034527..1035621) [1095 bp, 364 aa] ...    32   5.6  
KAFR0B04110 Chr2 (850702..852126) [1425 bp, 474 aa] {ON} Anc_5.1...    31   8.1  

>SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar to
           uniprot|Q08984 Saccharomyces cerevisiae YPL272C
           Hypothetical ORF
          Length = 511

 Score = 1059 bits (2739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/511 (100%), Positives = 511/511 (100%)

Query: 1   MSRNKSFRSLSSVEKKLFSQNLNNKRNGLMFAAVYSTCFDKEETWSDNATLLTVKDQRLS 60
           MSRNKSFRSLSSVEKKLFSQNLNNKRNGLMFAAVYSTCFDKEETWSDNATLLTVKDQRLS
Sbjct: 1   MSRNKSFRSLSSVEKKLFSQNLNNKRNGLMFAAVYSTCFDKEETWSDNATLLTVKDQRLS 60

Query: 61  NSLVSRALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVNCHDGVP 120
           NSLVSRALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVNCHDGVP
Sbjct: 61  NSLVSRALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVNCHDGVP 120

Query: 121 PYLLRHIFDKNKFETAKHKPLWQILIVDETMVIFHGHDVLFDIFAAANFHKLFQQALNQL 180
           PYLLRHIFDKNKFETAKHKPLWQILIVDETMVIFHGHDVLFDIFAAANFHKLFQQALNQL
Sbjct: 121 PYLLRHIFDKNKFETAKHKPLWQILIVDETMVIFHGHDVLFDIFAAANFHKLFQQALNQL 180

Query: 181 PKDGPTLECLFKNDSKASFFPKSIYENHKLRLPAIATDLFQLQTQSFFKSVYNWTIKKPL 240
           PKDGPTLECLFKNDSKASFFPKSIYENHKLRLPAIATDLFQLQTQSFFKSVYNWTIKKPL
Sbjct: 181 PKDGPTLECLFKNDSKASFFPKSIYENHKLRLPAIATDLFQLQTQSFFKSVYNWTIKKPL 240

Query: 241 DFINTNPNSGLKYYQSCYTDILLGANNLCGTTVFGNISAERVCALKKIMKQENICLSSFV 300
           DFINTNPNSGLKYYQSCYTDILLGANNLCGTTVFGNISAERVCALKKIMKQENICLSSFV
Sbjct: 241 DFINTNPNSGLKYYQSCYTDILLGANNLCGTTVFGNISAERVCALKKIMKQENICLSSFV 300

Query: 301 CAIALLCLKPLVNNFGSSVTFSIPVDLRSTIPQASRFGLCYKNVLVECPLTLIDDKVFQG 360
           CAIALLCLKPLVNNFGSSVTFSIPVDLRSTIPQASRFGLCYKNVLVECPLTLIDDKVFQG
Sbjct: 301 CAIALLCLKPLVNNFGSSVTFSIPVDLRSTIPQASRFGLCYKNVLVECPLTLIDDKVFQG 360

Query: 361 LNVYNGYDIRNTKPTNKDPNYEESLLEYQFREACTHVDNTLKQRWRAWERSGFNDDDIKR 420
           LNVYNGYDIRNTKPTNKDPNYEESLLEYQFREACTHVDNTLKQRWRAWERSGFNDDDIKR
Sbjct: 361 LNVYNGYDIRNTKPTNKDPNYEESLLEYQFREACTHVDNTLKQRWRAWERSGFNDDDIKR 420

Query: 421 MKFGKTEQGKSKRIIEVNNVTEFQFHVDDNATFNIKDVCFTKSQNLETFMSLSCAFSERS 480
           MKFGKTEQGKSKRIIEVNNVTEFQFHVDDNATFNIKDVCFTKSQNLETFMSLSCAFSERS
Sbjct: 421 MKFGKTEQGKSKRIIEVNNVTEFQFHVDDNATFNIKDVCFTKSQNLETFMSLSCAFSERS 480

Query: 481 GLNVCIHYPDGYNMDVFVECFQSFMEELSQI 511
           GLNVCIHYPDGYNMDVFVECFQSFMEELSQI
Sbjct: 481 GLNVCIHYPDGYNMDVFVECFQSFMEELSQI 511

>TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {ON}
           Anc_6.8 YPL272C
          Length = 503

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/506 (56%), Positives = 366/506 (72%), Gaps = 9/506 (1%)

Query: 6   SFRSLSSVEKKLFSQNLNNKRNGLMFAAVYSTCFDKEETWSDNATLLTVKDQRLSNSLVS 65
           SFRSL   EKK+ SQ+L   RNG++F A+YST     E WSD+ATLLT KD RL+ SL+S
Sbjct: 2   SFRSLGGFEKKILSQSLEGHRNGVVFGAMYSTT---PEEWSDDATLLTYKDSRLNLSLLS 58

Query: 66  RALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVNCHDGVPPYLLR 125
           R L K+I+++VEL+TTIN+ LEF PVK I  ++V+  V F SYKDE VNC  G PPYLLR
Sbjct: 59  RTLAKMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGAPPYLLR 118

Query: 126 HIFDKNKFETAKHKPLWQILIVDETMVIFHGHDVLFDIFAAANFHKLFQQALNQLPKDGP 185
           HIF++  F+      LWQI +VDET+V+FHGHDVLFDIF+AANFHK+F Q LN + K G 
Sbjct: 119 HIFNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIFLQTLNSISKSGS 178

Query: 186 TLECLFKNDSKASF--FPKSIYENHKLRLPAIATDLFQLQTQSFFKSVYNWTIKKPLDFI 243
            L  +FK + KA    FPKSIY+N KLRLPA A DLF LQTQSFFKS+Y   +KKPLD+I
Sbjct: 179 KLSTIFKLE-KAVLPPFPKSIYDNAKLRLPAKAADLFNLQTQSFFKSLYFNAVKKPLDYI 237

Query: 244 NTNPNSGLKYYQSCYTDILLGANNLCGTTVFGNISAERVCALKKIMKQENICLSSFVCAI 303
           N+NP   LK Y++ Y DIL   NNLCGTT+FG I  +R+ +L  I KQ+NICL SFVC I
Sbjct: 238 NSNPPQQLKEYRTRYADILRTDNNLCGTTIFGRILPKRLESLDCIFKQQNICLKSFVCGI 297

Query: 304 ALLCLKPLVNNFGSSVTFSIPVDLRSTIPQASRFGLCYKNVLVECPLTLIDDKVFQGLNV 363
            +LCLKP+V N+  S+TF +PVDLRS++  +S FG+ YK++ VECPL+LIDDK F  L V
Sbjct: 298 TMLCLKPIVKNYTGSITFCVPVDLRSSLEASSEFGMFYKDIRVECPLSLIDDKNFNSLTV 357

Query: 364 YNGYDIRNTKPTNKDPNYEESLLEYQFREACTHVDNTLKQRWRAWERSGFNDDDIKRMKF 423
           YNGYD    K   KDP Y+E LLEYQF++   HV   L+QR +AWE+ GFNDDDIKRMKF
Sbjct: 358 YNGYDSSAVKMPEKDPGYKEQLLEYQFKQVTDHVVAALRQRMKAWEKFGFNDDDIKRMKF 417

Query: 424 GKTEQGKSKRIIEVNNVTEFQF--HVDDNATFNIKDVCFTKSQNLETFMSLSCAFSERSG 481
           G  +   + ++I++N+V++     H D +  F+++++  T+S      MSLS   SE+ G
Sbjct: 418 GSDDTATNTKLIQINDVSDIPVDAHEDISGKFHMRELNMTQSLKPGQLMSLSYTHSEK-G 476

Query: 482 LNVCIHYPDGYNMDVFVECFQSFMEE 507
           L++CIHYPDGYNM+ FVECFQSF+E+
Sbjct: 477 LDICIHYPDGYNMESFVECFQSFIED 502

>Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa]
           {ON} complement(184350..185876) [1527 nt, 509 aa]
          Length = 508

 Score =  497 bits (1280), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 251/507 (49%), Positives = 349/507 (68%), Gaps = 8/507 (1%)

Query: 6   SFRSLSSVEKKLFSQNLNNKRNGLMFAAVYSTCFDKEETWSDNATLLTVKDQRLSNSLVS 65
           SFR L + EKKL  Q L  + NG++F+A Y +  + ++  +D+ATLLT  +  L +S + 
Sbjct: 3   SFRQLGTYEKKLVGQALAGQSNGIIFSAKYIS--NAQDGLTDDATLLTNSEPLLLDSRLV 60

Query: 66  RALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVNCHDGVPPYLLR 125
            AL+K++  + EL TT+N+ LEF+ VK I   D++  V+FDS KDE VNCH G PPYLLR
Sbjct: 61  NALQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNCHLGAPPYLLR 120

Query: 126 HIFDKNKFETAKHKPLWQILIVDETMVIFHGHDVLFDIFAAANFHKLFQQALNQLPKDGP 185
           HIF++NKF     KPLW++ ++D+++V+FHG DVLFDIFAAANFHKLF + LN +  +  
Sbjct: 121 HIFNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLFDIFAAANFHKLFLETLNSMDDEHI 180

Query: 186 T-LECLFKNDSKAS----FFPKSIYENHKLRLPAIATDLFQLQTQSFFKSVYNWTIKKPL 240
           T LE +++ D+  S     FP++IYEN KLR+P    DL  LQTQSFFKS Y   IKKPL
Sbjct: 181 TDLEYIYRYDATKSNRSISFPRTIYENPKLRIPGKTIDLVNLQTQSFFKSFYVNAIKKPL 240

Query: 241 DFINTNPNSGLKYYQSCYTDILLGANNLCGTTVFGNISAERVCALKKIMKQENICLSSFV 300
           D I  N +  +KY +    D +  A+ LCGTTVFG+I+ +R   L  I + EN+C+ SF+
Sbjct: 241 DIITFN-SEPMKYIKPNEIDFMNEASALCGTTVFGHITTDRFEYLNSIARHENVCIRSFI 299

Query: 301 CAIALLCLKPLVNNFGSSVTFSIPVDLRSTIPQASRFGLCYKNVLVECPLTLIDDKVFQG 360
           C IALLCLK ++ +F  S+TFSIPV+LR +I   S FGL YK +LVECPL+LIDD+V+  
Sbjct: 300 CGIALLCLKSMIKDFTGSITFSIPVNLRESIEGPSDFGLFYKTILVECPLSLIDDQVYNN 359

Query: 361 LNVYNGYDIRNTKPTNKDPNYEESLLEYQFREACTHVDNTLKQRWRAWERSGFNDDDIKR 420
           +NVYNGYD  N K    DP +EE  LEYQF++    V  T+K+R RAW R+GFNDDDIK+
Sbjct: 360 INVYNGYDNSNVKVPETDPTFEEKKLEYQFKQISDLVSTTMKERMRAWRRNGFNDDDIKK 419

Query: 421 MKFGKTEQGKSKRIIEVNNVTEFQFHVDDNATFNIKDVCFTKSQNLETFMSLSCAFSERS 480
           MKF   ++  + +II++N+V+EF+ +   ++  +IK++ FT S +   FMSLS  + + +
Sbjct: 420 MKFTSDDKASNTKIIQINDVSEFKINSSKSSKVSIKELNFTHSISNSDFMSLSYTYCKET 479

Query: 481 GLNVCIHYPDGYNMDVFVECFQSFMEE 507
           G N+CIHYPD Y+M+ FVE FQSF+ +
Sbjct: 480 GSNICIHYPDAYDMEKFVERFQSFVAD 506

>NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON} 
          Length = 523

 Score =  486 bits (1251), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 256/529 (48%), Positives = 354/529 (66%), Gaps = 34/529 (6%)

Query: 6   SFRSLSSVEKKLFSQNLNNKRNGLMFAAVYSTCF--DKEETWSDNATLLTVKDQRLSNSL 63
           S R+LSS EKK+ SQ L++KRNG+ + A Y +      + T SD ATLL  KD RL+  +
Sbjct: 2   SIRALSSFEKKVLSQTLDSKRNGISYTARYVSKVGSSSDSTLSDAATLLATKDIRLNIGI 61

Query: 64  VSRALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVNCHDGVPPYL 123
           V+R L+++I  ++ELY+TIN+N EFQ +  I  +DV+  + FD+YKDE +NCH G PPYL
Sbjct: 62  VTRVLERLIKKHIELYSTINENYEFQILTKIKPEDVISVITFDTYKDEQINCHSGAPPYL 121

Query: 124 LRHIFDKNKFETAKHKPLWQILIVDETMVIFHGHDVLFDIFAAANFHKLFQQALNQL--- 180
           LRHIF+K KFE   +KPLW++ I+DETM+IFHG D+LFDIF+AANFHKLF   LN     
Sbjct: 122 LRHIFNKEKFEL--NKPLWKLYIIDETMIIFHGFDMLFDIFSAANFHKLFFDELNDYFLT 179

Query: 181 ----PKDGPTLECLFK-NDSKASF------FPKSIYENHKLRLPAIATDLFQLQTQSFFK 229
                 +   L+ +FK N S  +F      FP+SI++N KL LPA+  DLF LQT+SFFK
Sbjct: 180 NTFSKSNSKPLDVVFKINVSDKNFVPNFEEFPRSIFDNPKLHLPAMTPDLFNLQTKSFFK 239

Query: 230 SVYNWTIKKPLDFIN-------TNPNSGLKYYQSC-YTDILLGANNLCGTTVFGNISAER 281
           ++Y+ TIKKP+D  N        +  S LK YQ+  Y D+L   ++LCGTTVFG +S  R
Sbjct: 240 TIYSNTIKKPIDLFNGSNSHTKNDITSQLKEYQTHNYLDMLGITSSLCGTTVFGTVSPTR 299

Query: 282 VCALKKIMKQENICLSSFVCAIALLCLKPLVNNFGSSVTFSIPVDLRSTIPQASRFGLCY 341
              LK +MKQ+ ICL SF+C I ++CLKP + N+  ++ FSIP++LR+ I  A  FGL Y
Sbjct: 300 YNYLKGMMKQDEICLRSFICGIVMICLKPSIKNYSGNIIFSIPINLRNYIDGAKNFGLFY 359

Query: 342 KNVLVECPLTLIDDKVFQGLNVYNGYDIRNTKPTNKDPNYEESLLEYQFREACTHVDNTL 401
           K+V ++CPL+LIDD+ F+    YNGY   ++ P   D  + E LLEYQF++    ++N +
Sbjct: 360 KDVKIDCPLSLIDDRNFK----YNGYK-DSSIPDENDLEFNEKLLEYQFKQVTEFIENVI 414

Query: 402 KQRWRAWERSGFNDDDIKRMKFGKTE-QGKSKRIIEVNNVTEFQFHVDD--NATFNIKDV 458
            +R + WE+  FNDDDIKRMKF   E  G++ +II++N+ TE     +D  N  F + + 
Sbjct: 415 LERLKIWEKFNFNDDDIKRMKFDHDEVLGQNSKIIQINDTTEIMLGENDNNNKAFTLTNP 474

Query: 459 CFTKSQNLETFMSLSCAFSERSGLNVCIHYPDGYNMDVFVECFQSFMEE 507
            FT++ +   FMS+S A  E +GLNVCIHYPDGY+M+ FVECFQ+F+EE
Sbjct: 475 NFTRTLSGNEFMSVSFAICEETGLNVCIHYPDGYSMETFVECFQTFIEE 523

>TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8
           YPL272C
          Length = 515

 Score =  455 bits (1171), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 239/512 (46%), Positives = 330/512 (64%), Gaps = 15/512 (2%)

Query: 7   FRSLSSVEKKLFSQNLNNKRNGLMFAAVYSTCFDKEETWSDNATLLTVKDQRLSNSLVSR 66
           FR L+S E+ +  ++  N+ NG +F+A Y+          D ATLLT   Q   N++ SR
Sbjct: 3   FRPLASYERNVLIESYENQTNGTIFSAKYTDMQTNSTINDDAATLLT---QNEENNMFSR 59

Query: 67  ---ALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVNCHDGVPPYL 123
              AL  VI  N ELYTTIN  LEF+P+  I  DDV+  ++F+S KDE VNC +G PPYL
Sbjct: 60  FINALATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVNCKNGAPPYL 119

Query: 124 LRHIFDKNKFETAKHKPLWQILIVDETMVIFHGHDVLFDIFAAANFHKLFQQALNQLPKD 183
           LRHIF+K+KF     KPLW + IVD+++VIFHG DVLFDI++AA+FH+ F  AL      
Sbjct: 120 LRHIFNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSAASFHRKFFAALEGATPT 179

Query: 184 GPTLECLFK--NDSKASF---FPKSIYENHKLRLPAIATDLFQLQTQSFFKSVYNWTIKK 238
              L  +F+  + SK++    FPKSIY++  L LPA   DL  LQT+ F KSV + TI K
Sbjct: 180 SEKLTTIFRLSDLSKSALTYPFPKSIYDSPLLMLPAKTIDLVSLQTRFFLKSVVSKTIVK 239

Query: 239 PLDFINTNPNSGLKYYQSCYTDILLGANNLCGTTVFGNISAERVCALKKIMKQENICLSS 298
           PL+ I  N      +  S   DIL   ++LCGTTVFGNIS ER   L+ I ++EN+C  S
Sbjct: 240 PLNIIMFNDEPMKSFTNSDPMDILEKTSSLCGTTVFGNISNERFDYLQSIAEEENVCTKS 299

Query: 299 FVCAIALLCLKPLVNNFGSSVTFSIPVDLRSTIPQASRFGLCYKNVLVECPLTLIDDKVF 358
            VC I +LCLKPL+ +F S++TFSI ++LR +I +++ FGL YKNV +E PL+ IDD VF
Sbjct: 300 LVCGITMLCLKPLIKDFSSNITFSIAMNLRDSIEESTEFGLFYKNVRIEVPLSFIDDNVF 359

Query: 359 QGLNVYNGYDIRNTKPTNKDPNYEESLLEYQFREACTHVDNTLKQRWRAWERSGFNDDDI 418
           +    YNGYD  N+     +PNYEE L+ YQF +  T +   LKQR RAW R+GFNDDDI
Sbjct: 360 KLKTSYNGYDASNSNIKETNPNYEEQLIAYQFNQIATFISRNLKQRMRAWRRNGFNDDDI 419

Query: 419 KRMKFGKTEQGKSKRIIEVNNVTEFQF-HVDDNATFN---IKDVCFTKSQNLETFMSLSC 474
           K MKFG  ++  S +II++N++++  F  ++ N   N   +KD+ FT S   + FMSLS 
Sbjct: 420 KMMKFGSKDKNTSAKIIQINDISDLSFCPMNKNGELNSVSLKDLSFTHSLVPDQFMSLSY 479

Query: 475 AFSERSGLNVCIHYPDGYNMDVFVECFQSFME 506
              + +G N+CIH+P+ Y++++FVE FQ+F++
Sbjct: 480 THCKSTGSNICIHFPEVYDLELFVEKFQNFID 511

>TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8
           YPL272C
          Length = 503

 Score =  442 bits (1136), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 241/513 (46%), Positives = 334/513 (65%), Gaps = 26/513 (5%)

Query: 7   FRSLSSVEKKLFSQNLNNKRNGLMFAAVYSTCFDKEETWSDNATLLTVK--DQRLSNSLV 64
           FR+L   EKK+ +Q +  +RNG++F++  +     +E   DNATL T +  ++    S++
Sbjct: 3   FRALGGYEKKVLAQTIEGRRNGVVFSSQITFNKKSDEFADDNATLYTGRSVNEVSLKSVL 62

Query: 65  SRALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVNCHDGVPPYLL 124
             AL+ +I N+VELYTTIND L F PV  I  +DV++ + +D  KD+ +   D +   LL
Sbjct: 63  CAALQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKAL-MKDQISDKLL 121

Query: 125 RHIFDKNKFETAKHKPLWQILIVDETMVIFHGHDVLFDIFAAANFHKLFQQALNQLPKDG 184
           RHIF+K  F+    KPLWQ  I +++ +IFHGHDVLFDIF+ ANF K   + +N +    
Sbjct: 122 RHIFNKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYLLKEMNDVLNSN 181

Query: 185 ---PTLECLFKNDSKASF--FPKSIYENHKLRLPAIATDLFQLQTQSFFKSVYNWTIKKP 239
               T++ LFK D++ S   +P+SIYEN KL LPA+ +DL  LQTQSFFK++Y  T+KKP
Sbjct: 182 QKLKTVKTLFKFDAERSLTNYPRSIYENPKLHLPALTSDLLNLQTQSFFKTIYQNTLKKP 241

Query: 240 LDFI---NTNPNSGLKYYQSCYTDILLGANNLCGTTVFGNISAERVCALKKIMKQENICL 296
           +D I   N+N N+ L  Y++  TDIL GAN+LCG TV G IS ER   LK +++QENI L
Sbjct: 242 IDLITSANSNNNNQLSEYRTRNTDILSGANSLCGRTVLGEISLERYQHLKMLVEQENISL 301

Query: 297 SSFVCAIALLCLKPLVNNFGSSVTFSIPVDLRSTIPQASRFGLCYKNVLVECPLTLIDDK 356
            SF+ AI ++CLKP+V NF  S+ FSIPV+LRS I  +S FGL YKN+ VECPL LI+D+
Sbjct: 302 RSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSLIADSSDFGLFYKNIKVECPLELINDE 361

Query: 357 VFQGLNVYNGYDIRNTKPTNKDPNYEESLLEYQFREACTHVDNTLKQRWRAWERSGFNDD 416
            +     Y   ++ ++   N       SLLE QF     HV + + QR +AWE+ GFNDD
Sbjct: 362 KY-----YTNPEVLHSMQNN-------SLLEIQFERISRHVSDVISQRMKAWEKFGFNDD 409

Query: 417 DIKRMKFGKTEQGKSKRIIEVNNVTEFQFHV-DDNA--TFNIKDVCFTKSQNLETFMSLS 473
           DIKRMKF   E+     II++N+VTE  F   +DN   +F++ ++ FTKS +   FMSL 
Sbjct: 410 DIKRMKFSNDEKTGIAPIIQINDVTEISFDFGNDNISYSFSVNNLNFTKSLSCNEFMSLF 469

Query: 474 CAFSERSGLNVCIHYPDGYNMDVFVECFQSFME 506
            + + + GLN+CIHYPDGYNM+ FVECFQSF+E
Sbjct: 470 YSHNAQGGLNICIHYPDGYNMEAFVECFQSFIE 502

>KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8
           YPL272C
          Length = 508

 Score =  431 bits (1109), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 237/520 (45%), Positives = 328/520 (63%), Gaps = 34/520 (6%)

Query: 6   SFRSLSSVEKKLFSQNLNNKRNGLMFAAVYSTCFDKEETWSDN-ATLLTVKDQRLSNSLV 64
           S R+LSS EKKL  Q+++  +NG  F A YST    +E WSD  ATLLTVKD RL   L+
Sbjct: 3   SVRALSSFEKKLLLQSVDGLKNGTTFGAEYSTF---KEGWSDEEATLLTVKDSRLCLGLL 59

Query: 65  SRALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVNCHDGVPPYLL 124
           ++AL+ +I  ++EL+ TIN+  EF+ +K I   DV+  ++FDS+KDE +NC  G PPYLL
Sbjct: 60  TKALENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQLGAPPYLL 119

Query: 125 RHIFDKNKFETAKHKPLWQILIVDETMVIFHGHDVLFDIFAAANFHKLFQQALNQL---P 181
           RHIF+ ++F     KPLW++ ++D+++  FHG D LFD+F+ ANFH+L  + +N L   P
Sbjct: 120 RHIFNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLLLKEVNLLSSRP 179

Query: 182 KDGPTLECLFK----NDSKASFFPKSIYENHKLRLPAIATDLFQLQTQSFFKSVYNWTIK 237
           +    L+ +FK    + S+    PKSIY+N KL +P +  DLF LQTQSFFKS+Y  T+K
Sbjct: 180 QKWKKLDYVFKFGPDSMSEVKQLPKSIYDNPKLYIPTLNPDLFNLQTQSFFKSIYVNTVK 239

Query: 238 KPLDFINTNPNSGLKYYQSC-YTDILLGANNLCGTTVFGNISAERVCALKKIMKQENICL 296
           KP++F+     S L    +  Y DIL   + LCG TVFG +S ER   L  I+ QE +CL
Sbjct: 240 KPIEFLTNTDVSFLSLNSNMKYNDILDINSKLCGNTVFGCVSNERFKYLNTIINQEGLCL 299

Query: 297 SSFVCAIALLCLKPLVNNFGSSVTFSIPVDLRSTIPQASRFGLCYKNVLVECPLTLIDDK 356
            SF+  IA+LCLKP+V N   +VTFSIPVDLRS + +   FGL YK++ VECPL+LIDD 
Sbjct: 300 KSFIVGIAMLCLKPMVKNLSGTVTFSIPVDLRSFVDEPRDFGLYYKDIRVECPLSLIDDD 359

Query: 357 VFQGLNVYNGYDIRNTKPTNKDPNYEESLLEYQFREACTHVDNTLKQRWRAWERSGFNDD 416
             +  +   G  +        + +++E L+EYQF+     V N L+QR   + ++GFNDD
Sbjct: 360 --KSKDCMKGASV-------SEEDFDEKLMEYQFKNITGFVRNHLEQRLTRFSKTGFNDD 410

Query: 417 DIKRMKF-------GKTEQGKSKRIIEVN--NVTEFQFHVDDNATFNIKDVCFTKSQNLE 467
           DI+RMKF       G +  G   +I + +  NV EF     +  +F I+    TKS N E
Sbjct: 411 DIRRMKFDDKNTLGGSSNNGTFIQIYDTSLINVNEF----GEPNSFMIRACNLTKSLNSE 466

Query: 468 TFMSLSCAFSERSGLNVCIHYPDGYNMDVFVECFQSFMEE 507
             MSLS  + E +GLN+CIHYP+ Y M+ FVECFQSF+EE
Sbjct: 467 ELMSLSYTYCEENGLNICIHYPENYKMESFVECFQSFLEE 506

>Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON}
           YPL272C (REAL)
          Length = 515

 Score =  428 bits (1100), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 223/519 (42%), Positives = 331/519 (63%), Gaps = 24/519 (4%)

Query: 6   SFRSLSSVEKKLFSQNLNNKRNGLMFAAVYSTCFDK--EETW-SDNATLLT---VKDQRL 59
           +FR LSS EKKL +Q+LN++RNG +F++ YS   ++  +  W SD  TL T     D RL
Sbjct: 3   TFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSPNRGNDADWNSDEVTLGTNSSKDDSRL 62

Query: 60  SNSLVSRALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVNCHDGV 119
           +   ++  LK++I +   L+ T+N+  EF+P+K +   D+V  +EF++ KD+ VNCH GV
Sbjct: 63  TLPSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGV 122

Query: 120 PP-YLLRHIFDKNKFETAKHKPLWQILIVDETMVIFHGHDVLFDIFAAANFHKLFQQALN 178
           PP YLLRH F+K +F    +KPLW + ++DE +++FHGHDVLFDIF+AANFHKLF + LN
Sbjct: 123 PPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKELN 182

Query: 179 QLPKDGPTLECLFKNDSKASF----FPKSIYENHKLRLPAIATDLFQLQTQSFFKSVYNW 234
            +  +  + + +  + S  +     FPKSIY++ KL LPA+   +F  QTQSFFKS++  
Sbjct: 183 NISLEAHSDDRVLFDISDVNISNLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIFYN 242

Query: 235 TIKKPLDFINTNPNSGLKYYQSC---YTDILLGANNLCGTTVFGNISAERVCALKKIMKQ 291
           T+K+P  ++    + G     +    Y DIL   ++LCGTTVFG ++ +R   LK I+ Q
Sbjct: 243 TLKRPFGYLTNQTSLGPSTSTTQLKKYNDILNAHSSLCGTTVFGIVNNQRFNYLKSIVNQ 302

Query: 292 ENICLSSFVCAIALLCLKPLVNNFGSSVTFSIPVDLRSTIPQASRFGLCYKNVLVECPLT 351
           E+ICL SF+C IA++CLKPLV +F  ++ FSIP+DLR  +      GL +K + +ECPL+
Sbjct: 303 EHICLRSFICGIAMICLKPLVKDFTGAIVFSIPIDLRKNLDLGESLGLFFKELRIECPLS 362

Query: 352 LIDDKVFQGLNVYNGYDIRNTKPTNKDPNYEESLLEYQFREACTHVDNTLKQRWRAWERS 411
           LIDD++     + N    RN K    D  + E L+EYQF +   HV + +  + ++WE++
Sbjct: 363 LIDDELSADEFLAN----RNDK--EDDDEFNEKLMEYQFNKVTKHVSDFIMAKLKSWEKN 416

Query: 412 GFNDDDIKRMKFGKTE---QGKSKRIIEVNNVTEFQFHV-DDNATFNIKDVCFTKSQNLE 467
           GFNDDDI+RMK+   +   Q    ++I++N+V++    + +D   F I    FT S N  
Sbjct: 417 GFNDDDIRRMKYDNDDCHIQNSKTKLIQINDVSDISLSMNNDEKAFKIISSGFTSSINRP 476

Query: 468 TFMSLSCAFSERSGLNVCIHYPDGYNMDVFVECFQSFME 506
           T MSLS  + E  GLN+CIHYPD YN++ FVECF+SF+E
Sbjct: 477 TLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 515

>CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272c
          Length = 535

 Score =  427 bits (1099), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 242/548 (44%), Positives = 331/548 (60%), Gaps = 64/548 (11%)

Query: 8   RSLSSVEKKLFSQNLNNKRNGLMFAAVY---STCFDKEETWSD-NATLLTVKDQR----- 58
           RSLSS E+KL S+ L N +NG +F A Y    +    E  W D N TL   + +      
Sbjct: 3   RSLSSYERKLLSEILENNKNGTVFGASYIFDDSVTADEHIWDDDNDTLAATRVESRSTKK 62

Query: 59  ----LSNSLVSRALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVN 114
               L+  LV+RALK +I  N E+YTT+ND LEF P+K I   DV+  V FD+ KDE VN
Sbjct: 63  PALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEKVN 122

Query: 115 CHDG-VPPYLLRHIFDKNKFETAKHKPLWQILIVDETMVIFHGHDVLFDIFAAANFHKLF 173
           CH G  PPYL+RHI   + F+   +KPLW + ++DE+ ++FH  D+LFDIF+AANFHKLF
Sbjct: 123 CHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHKLF 182

Query: 174 QQAL-----NQLPKDGPTLECLFKNDSKASF-----FPKSIYENHKLRLPAIATDLFQLQ 223
            + L      Q   + P LE LFK   + SF      PKSIY+N KL LPA   +L  LQ
Sbjct: 183 LKELIAVCRPQQSYEKP-LEYLFK--LQKSFENNYSVPKSIYDNLKLHLPATRPELLNLQ 239

Query: 224 TQSFFKSVYNWTIKKPLDFIN--------------------TNPNSGLKYYQSCYTDILL 263
           TQSFFKS++   +KKPLDFI                     +   + LK +++ YT+IL 
Sbjct: 240 TQSFFKSIFCNAVKKPLDFIQMPITSITNSSSNSDNSTTVISQEGNQLKLFRTRYTNILT 299

Query: 264 GANNLCGTTVFGNISAERVCALKKIMKQENICLSSFVCAIALLCLKPLVNNFGSSVTFSI 323
            A + CG T+FG++S ER   L  ++K E ICL SF+ AI +LCLKP+V +F  ++ FS+
Sbjct: 300 SATSNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNGTLIFSM 359

Query: 324 PVDLRSTIPQASRFGLCYKNVLVECPLTLIDDK--VFQGLNVYNGYDIRNTKPTNKDPNY 381
           P++LR ++ +   FGL YK++ VECPL++IDDK     GLN               DP Y
Sbjct: 360 PMNLRDSMNEKRDFGLVYKDIRVECPLSMIDDKQCSVPGLN-------------ESDPEY 406

Query: 382 EESLLEYQFREACTHVDNTLKQRWRAWERSGFNDDDIKRMKFGKTEQ--GKSKRIIEVNN 439
            E LLE QF++  T+V  +++QR   W++ G+ND+D+KRMKF K ++    + R+I++N+
Sbjct: 407 NEKLLEIQFQQIATYVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEKFAPNTRLIKIND 466

Query: 440 VTEFQFHVDDNATFNIKDVCFTKSQNLETFMSLSCAFSERSGLNVCIHYPDGYNMDVFVE 499
           V+E  F  +D    +IK   FT S +  T MSLS    E  GLN+CIHYPDGYNM+ FV+
Sbjct: 467 VSEVSFDDNDIRFPHIKSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENFVD 526

Query: 500 CFQSFMEE 507
           CF+SFMEE
Sbjct: 527 CFESFMEE 534

>Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C
           (REAL)
          Length = 516

 Score =  423 bits (1087), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 222/522 (42%), Positives = 336/522 (64%), Gaps = 29/522 (5%)

Query: 6   SFRSLSSVEKKLFSQNLNNKRNGLMFAAVYSTCFDKE--ETW-SDNATLLT---VKDQRL 59
           +FR LSS EKKL +Q+LN++RNG +F++ YS    KE    W SD  TL T     D RL
Sbjct: 3   TFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDADWHSDEVTLGTNSSKDDSRL 62

Query: 60  SNSLVSRALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVNCHDGV 119
           +  L++  LK++I +   L+ TIN+  EF+P++ +   D+V  +EF++ KD+ VNCH GV
Sbjct: 63  TLPLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNCHWGV 122

Query: 120 PP-YLLRHIFDKNKFETAKHKPLWQILIVDETMVIFHGHDVLFDIFAAANFHKLFQQALN 178
           PP YLLRH F+K +F    ++PLW + ++DET+++FHGHDVLFDIF+AANFHKLF + LN
Sbjct: 123 PPPYLLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKELN 182

Query: 179 QLPKDGPTLECLFKNDSKASF----FPKSIYENHKLRLPAIATDLFQLQTQSFFKSVYNW 234
            +       + +  + +  S     FPKSIY++ KL LPA+   +F  QTQSFFKS++  
Sbjct: 183 NISSVTHYEDRILFDINNVSISDLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIFYN 242

Query: 235 TIKKPLDFIN-----TNPNSGLKYYQSCYTDILLGANNLCGTTVFGNISAERVCALKKIM 289
           T+K+P  ++      ++P S  +  +  Y DIL   ++LCGTTVFG +S +R   LK I+
Sbjct: 243 TLKRPFGYLTNQTSISSPASATQLKK--YNDILNAHSSLCGTTVFGIVSNQRFNYLKSIV 300

Query: 290 KQENICLSSFVCAIALLCLKPLVNNFGSSVTFSIPVDLRSTIPQASRFGLCYKNVLVECP 349
            QE+ICL SF+C IA++CLKPLV +F  ++ FSIP+DLR  +      GL +K + + CP
Sbjct: 301 NQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLGLGESLGLFFKELRIACP 360

Query: 350 LTLIDDKVFQGLNVYNGYDIRNTKPTNKDPNYEESLLEYQFREACTHVDNTLKQRWRAWE 409
           L+LIDD++   +N +    + N+    +D  ++E L+EYQF     HV + +  + ++WE
Sbjct: 361 LSLIDDEL--SVNEF----LANSNDNEEDEEFDEKLMEYQFNNVTKHVSSFIMAKLKSWE 414

Query: 410 RSGFNDDDIKRMKFGKTE----QGKSKRIIEVNNVTEFQFHV-DDNATFNIKDVCFTKSQ 464
           ++GFNDDDI+RMK+   +    Q    +++++N+V++    + +D+ +F I    FT S 
Sbjct: 415 KNGFNDDDIRRMKYDNDDEFHIQNSKTKLVQINDVSDISLSMNNDDKSFKIVSSGFTSSI 474

Query: 465 NLETFMSLSCAFSERSGLNVCIHYPDGYNMDVFVECFQSFME 506
           N  T +SLS  + +  GLN+CIHYPD YN++ FVECF+SF+E
Sbjct: 475 NRPTLLSLSYTYCQEMGLNICIHYPDSYNLESFVECFESFIE 516

>Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}
           YPL272C (REAL)
          Length = 518

 Score =  419 bits (1078), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 230/524 (43%), Positives = 334/524 (63%), Gaps = 31/524 (5%)

Query: 6   SFRSLSSVEKKLFSQNLNNKRNGLMFAAVYSTCFDKEET--W-SDNATLLT---VKDQRL 59
           +FR LSS EKKL +Q+LN++RNG +F++ YS    KE    W SD  TL T     D RL
Sbjct: 3   TFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSSSKEADADWHSDEVTLGTNSSKDDSRL 62

Query: 60  SNSLVSRALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVNCHDGV 119
           +  L++  LKK+I +   L+ T+N++ E+ P+K +   D+V  +EF++ KD+ VNCH GV
Sbjct: 63  TLPLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNCHWGV 122

Query: 120 PP-YLLRHIFDKNKFETAKHKPLWQILIVDETMVIFHGHDVLFDIFAAANFHKLFQQALN 178
           PP YLLRH F+K +F    +KPLW + ++DET+++FHGHDVLFDIF+AANFHKLF + LN
Sbjct: 123 PPPYLLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKELN 182

Query: 179 QLPKDGPTLECLFKNDSKASF----FPKSIYENHKLRLPAIATDLFQLQTQSFFKSVYNW 234
            +     + + +  + +  +F    FPKSIY++ KLRLPA+   +   QTQSFFKS++  
Sbjct: 183 SITSVSRSDDRVLFDINDVNFAELSFPKSIYDSAKLRLPAMTPQILHKQTQSFFKSIFYN 242

Query: 235 TIKKPLDFINTN-------PNSGLKYYQSCYTDILLGANNLCGTTVFGNISAERVCALKK 287
           T+K+P  ++          P S LK Y     DIL   ++LCGTTVFG ++ +R   LK 
Sbjct: 243 TLKRPFGYLTNQTSFSSPAPTSQLKRYN----DILNTNSSLCGTTVFGIVNNQRFSYLKS 298

Query: 288 IMKQENICLSSFVCAIALLCLKPLVNNFGSSVTFSIPVDLRSTIPQASRFGLCYKNVLVE 347
           I+ QE+ICL SF+C IA++CLKPLV +F  ++ FSIP+DLR  +      GL +K + +E
Sbjct: 299 IVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLNLGESLGLFFKELRIE 358

Query: 348 CPLTLIDDKVFQGLNVYNGYDIRNTKPTNKDPNYEESLLEYQFREACTHVDNTLKQRWRA 407
           CPL+LIDD+    L++       N    N +  + E L+EYQF +   HV N +  + ++
Sbjct: 359 CPLSLIDDE----LSINEFLVNSNDNENNDNDEFNEKLMEYQFNKVTKHVSNYIMTKLKS 414

Query: 408 WERSGFNDDDIKRMKFGKTE----QGKSKRIIEVNNVTEFQFHV-DDNATFNIKDVCFTK 462
           WER+GFNDDDI+RMK+   +    Q    ++I++N+V++    + +D+ +F I    FT 
Sbjct: 415 WERNGFNDDDIRRMKYDNDDDFHVQNSKTKLIQINDVSDISLSMSNDDKSFKIVSSGFTN 474

Query: 463 SQNLETFMSLSCAFSERSGLNVCIHYPDGYNMDVFVECFQSFME 506
           S N  T MSLS  + E  GLN+CIHYPD YN++ FVECF+SF+E
Sbjct: 475 SINRPTLMSLSYTYCEDMGLNICIHYPDSYNLESFVECFESFIE 518

>YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON}
           Putative protein of unknown function; gene expression
           induced in response to ketoconazole; YPL272C is not an
           essential gene
          Length = 517

 Score =  418 bits (1075), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 228/520 (43%), Positives = 335/520 (64%), Gaps = 24/520 (4%)

Query: 6   SFRSLSSVEKKLFSQNLNNKRNGLMFAAVYSTCFDKE--ETW-SDNATLLT---VKDQRL 59
           +FR LSS EKK+ +Q+LN++RNG +F++ YS    +E    W SD  TL T     D RL
Sbjct: 3   TFRPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKDDSRL 62

Query: 60  SNSLVSRALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVNCHDGV 119
           +  L++  LK++I +   L+ T+N+  EF+P+K +   D+V  +EF++ KD+ VNCH GV
Sbjct: 63  TLPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGV 122

Query: 120 PP-YLLRHIFDKNKFETAKHKPLWQILIVDETMVIFHGHDVLFDIFAAANFHKLFQQALN 178
           PP YLLRH F+K +F    +KPLW + ++DE +++FHGHDVLFDIF+AANFHKLF + LN
Sbjct: 123 PPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKELN 182

Query: 179 QLPKDGPTLE-CLFK-NDSKASF--FPKSIYENHKLRLPAIATDLFQLQTQSFFKSVYNW 234
           ++     + +  LF  ND   S   FPKSIY++ KL LPA+   +F  QTQSFFKS+Y  
Sbjct: 183 EISTVTHSEDRILFDVNDINLSELKFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIYYN 242

Query: 235 TIKKPLDFIN--TNPNSGLKYYQ-SCYTDILLGANNLCGTTVFGNISAERVCALKKIMKQ 291
           T+K+P  ++   T+ +S +   Q   Y DIL    +LCGTTVFG ++ +R   LK I+ Q
Sbjct: 243 TLKRPFGYLTNQTSLSSSVSATQLKKYNDILNAHTSLCGTTVFGIVNNQRFNYLKSIVNQ 302

Query: 292 ENICLSSFVCAIALLCLKPLVNNFGSSVTFSIPVDLRSTIPQASRFGLCYKNVLVECPLT 351
           E+ICL SF+C IA++CLKPLV +F  ++ F+IP++LR+ +      GL +K + VECPL+
Sbjct: 303 EHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRNHLGLGGSLGLFFKELRVECPLS 362

Query: 352 LIDDKVFQGLNVYNGYDIRNTKPTNKDPNYEESLLEYQFREACTHVDNTLKQRWRAWERS 411
           LIDD++       N +   +    + D  + E L+EYQF +   HV   +  + R+WE++
Sbjct: 363 LIDDEL-----SANEFLTNSNDNEDNDDEFNERLMEYQFNKVTKHVSGFIMAKLRSWEKN 417

Query: 412 GFNDDDIKRMKFGKTE----QGKSKRIIEVNNVTEFQFHVD-DNATFNIKDVCFTKSQNL 466
           GFNDDDI+RMK+   +    Q    ++I++N+V++    ++ D+ +F I    FT S N 
Sbjct: 418 GFNDDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMNGDDKSFKIVSTGFTSSINR 477

Query: 467 ETFMSLSCAFSERSGLNVCIHYPDGYNMDVFVECFQSFME 506
            T MSLS  + E  GLN+CIHYPD YN++ FVECF+SF+E
Sbjct: 478 PTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 517

>KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa]
           {ON} Anc_6.8 YPL272C
          Length = 508

 Score =  399 bits (1025), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 217/523 (41%), Positives = 326/523 (62%), Gaps = 38/523 (7%)

Query: 6   SFRSLSSVEKKLFSQNLNNKRNGLMFAAVYSTCFDKEETWSDNATLLTVKDQRLSNSLVS 65
           + R+LSS E+K+  + +  +RNG++F A YS      E W D+ TLLT+KD R + ++++
Sbjct: 2   TLRTLSSYERKILDETIRRERNGVIFTASYSAS---SEEWGDDTTLLTLKDSRPTIAILT 58

Query: 66  RALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVNCHDGVPPYLLR 125
           +A++++I+ +VEL+TTIN+N EF+ +K+I  DD++  +EFDSYKDE +NCH+G PPYLLR
Sbjct: 59  KAIQRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKINCHNGCPPYLLR 118

Query: 126 HIFDKNKFETAKHKPLWQILIVDETMVIFHGHDVLFDIFAAANFHKLFQQALNQL---PK 182
           HIFD N+F     KPLW + I+DE++VIFHG D+LFDIF+AANFHKL  +  N +   P 
Sbjct: 119 HIFDNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFDIFSAANFHKLLLKETNIVANEPL 178

Query: 183 DGPTLECLFK--------NDSKASFFPKSIYENHKLRLPAIATDLFQLQTQSFFKSVYNW 234
           D    + +F         N+ K S   KSIY+N ++ LPA + DLF LQTQSFFKSV++ 
Sbjct: 179 DSSESDIIFSLENSIKKINNLKLS---KSIYDNPRIHLPATSPDLFNLQTQSFFKSVFHS 235

Query: 235 TIKKPLDFINTN-------PNSGLKYYQSC--YTDILLGANNLCGTTVFGNISAERVCAL 285
           T+KKP+ ++  N        ++ L    +   YTDI      L  TTVFG I+ +R   L
Sbjct: 236 TVKKPIHYLVANVRTKEVTSDNTLSRVTTVQKYTDIFDYNTTLNNTTVFGKITRQRYEYL 295

Query: 286 KKIMKQENICLSSFVCAIALLCLKPLVNNFGSSVTFSIPVDLRSTIPQAS-RFGLCYKNV 344
             ++  + IC  SF+  I +LCLKP + NF  S+ FSI ++LR  + +++  FGL YK+V
Sbjct: 296 NSLITNQRICFKSFMVGIIMLCLKPSIENFEGSMKFSIVINLRPFLKESNIEFGLFYKDV 355

Query: 345 LVECPLTLIDDKVFQGLNVYNGYDIRNTKPTNKDPNYEESLLEYQFREACTHVDNTLKQR 404
           L++ PL+LIDD     L+ Y  +       ++ DP+  E +LE+QF+   + V + +++R
Sbjct: 356 LIDVPLSLIDDNAVM-LSGYRDF-------SDNDPDLTEKILEFQFKRVTSLVKDLIERR 407

Query: 405 WRAWERSGFNDDDIKRMKFGK-TEQGKSKRIIEVNNVTEFQFHVDDNATFNIKDVCFTKS 463
              +   GFNDDDI++MK+GK  E  K  R+ + + V+      D    + + +  FTKS
Sbjct: 408 ISKFSTMGFNDDDIRQMKYGKPAEDTKIIRLFDTSEVSLGSGKRD--GKYILHNTNFTKS 465

Query: 464 QNLETFMSLSCAFSERSGLNVCIHYPDGYNMDVFVECFQSFME 506
                F S+S    + SGLN+C+ +PD  +M+ FVECFQSF+E
Sbjct: 466 LRKNDFFSVSYTLCDNSGLNLCLQFPDDCDMEAFVECFQSFIE 508

>Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to
           Ashbya gossypii ACR018C
          Length = 509

 Score =  388 bits (997), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 208/514 (40%), Positives = 316/514 (61%), Gaps = 21/514 (4%)

Query: 6   SFRSLSSVEKKLFSQNLNNKRNGLMFAAVYSTCFDKEETWSDNATLLTVKDQRLSNSLVS 65
           S R LSSVEK    +   ++RNG++FA  YS+   + E WSD+ TL  ++D RL +  +S
Sbjct: 7   SIRDLSSVEKIFHKEVYTSRRNGIVFAVNYSSNKCESERWSDDITLSNLRDSRLFDGQIS 66

Query: 66  RALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVNCHDGVPPYLLR 125
            AL+ +I  NVEL  TI D+ +F P + I +DDVV  +EF +YKDEL+ C +G+PPY+LR
Sbjct: 67  NALEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIECQNGIPPYILR 126

Query: 126 HIFDKNKFETAKHKPLWQILIVDETMVIFHGHDVLFDIFAAANFHKLFQQALNQLPKDGP 185
           +I + NKFE    +PLW+++IVD TMVI H H+V+FD+FAAANFH  FQ+AL+Q PKD  
Sbjct: 127 NILENNKFEFG--RPLWELIIVDYTMVILHCHEVMFDLFAAANFHLKFQKALSQFPKDTH 184

Query: 186 TLECLFKNDSKASFFPKSIYENHKLRLPAIATDLFQLQTQSFFKSVYNWTIKKPLDFINT 245
            L+ LF  +       K+ ++    ++         LQ  S  K  Y  T+KK L+ I  
Sbjct: 185 ALDILFVYEGNELQLSKTNFDGMS-QISVSPVQSLPLQCISVLKGAYRTTVKKSLNVIRR 243

Query: 246 N--PNSGLKYYQSCYTDI---LLGANNLCGTTVFGNISAERVCALKKIMKQENICLSSFV 300
           N   N+ +  Y+S  +D+   +   N LCGTTV G+++AER+ +L ++   EN+C++S +
Sbjct: 244 NFVANNQITTYESSKSDVFKSMFNPNTLCGTTVSGSLNAERLASLLELTSSENVCMTSVL 303

Query: 301 CAIALLCLKPLVNNFGSSVTFSIPVDLRSTIPQASRFGLCYKNVLVECPLTLIDDKVFQG 360
           CAI LL LKPL+  F  S+TF +P+D+R  + +    G+ Y N++VECPL+ I+DK FQ 
Sbjct: 304 CAITLLSLKPLIRKFNGSITFVVPIDIREKL-EIFDLGVSYTNLMVECPLSFINDKDFQH 362

Query: 361 LNVYNGYDIRNTKPTNK----DPNYEESLLEYQFREACTHVDNTLKQRWRAWERSGFNDD 416
             V +G    N K  +K     P+Y E LLEYQF++  +HV N+LK++ +AW++  F+  
Sbjct: 363 -TVSDG----NIKSLHKIDPNSPDYPEMLLEYQFKQLTSHVMNSLKEKKQAWQKRRFDMS 417

Query: 417 DIKRMKFGKTEQGKSKRIIEVNNVTEFQFHVDDNATFNIKDVCFTKSQNLETFMSLSCAF 476
            +K  K  ++ +    + IE+N V   +     +  F+ K+V FT S   +  +S+SCA 
Sbjct: 418 SLKGKKLRRSNKIIRGKFIEINLVDMGEAQ---DGQFHTKNVNFTSSLGSKCLISVSCAI 474

Query: 477 SERSGLNVCIHYPDGYNMDVFVECFQSFMEELSQ 510
               G+N+ +HYP+  +MD FVECFQ  +E+L++
Sbjct: 475 LRGVGMNIFMHYPESNDMDAFVECFQILLEDLAK 508

>KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272C Hypothetical ORF
          Length = 518

 Score =  378 bits (970), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 206/513 (40%), Positives = 303/513 (59%), Gaps = 18/513 (3%)

Query: 5   KSFRSLSSVEKKLFSQNLNNKRNGLMFAAVYSTCFDKEETWSDNATLLTVKDQRLSNSLV 64
           + +R+L+  EK +  +     +NG++F+A Y   F  ++  SDN TL +  +QRLS+S++
Sbjct: 6   RVYRNLTPTEKTILCETATGVKNGVLFSATYYKNFPNKD-LSDNETLRSDMNQRLSDSMI 64

Query: 65  SRALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVNCHDGVPPYLL 124
            +AL KVI  + EL   ++ NLEF+PV  I F+DVV+K+EFD Y DE VNC++GVPPYLL
Sbjct: 65  WKALLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVNCYNGVPPYLL 124

Query: 125 RHIFDKNKFETAKHKPLWQILIVDETMVIFHGHDVLFDIFAAANFHKLFQQALNQLPKDG 184
           RHIFDK  F   + +PLWQ+ ++D TMV+FHGHDVLFD FAAANFHKLF QALN L +  
Sbjct: 125 RHIFDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFAAANFHKLFLQALNSLSESC 184

Query: 185 PTLECLFKNDSKASFFPKSIYENHKLRLPAIATDLFQLQTQSFFKSVYNWTIKKPLDFIN 244
            +   +FK        P+++++  + +  +  TD F  Q+Q+  +S+YN  IKKPL FI 
Sbjct: 185 TSPRPVFKGGKILPTLPRALFQKQEPQAASSITDAFYSQSQAILRSLYNLAIKKPLRFIE 244

Query: 245 TNPNSGLKYYQSCYTDILLGANNLCGTTVFGNISAERVCALKKIMKQENICLSSFVCAIA 304
           +          S   + L   N+LCGT VFG IS  R   LK I+    I + +F+ +  
Sbjct: 245 SGRIEHSTEQHSGTPEPLNYPNHLCGTVVFGTISTPRFKILKGILNDHKISMKTFIISAT 304

Query: 305 LLCLKPLVNNFGSSVTFSIPVDLRSTIPQASRFGLCYKNVLVECPLTLI--DDKVFQGLN 362
           L CL+P++++    +TFS+P++LR  IP +S  G+ ++NVL+ECPL     +     G  
Sbjct: 305 LFCLQPVLDSSEDKITFSLPINLRDLIPWSSPLGIYHRNVLIECPLGTAGRNSNCSAGSY 364

Query: 363 VYN-----GYDIRNTKPTNKDPNYEESLLEYQFREACTHVDNTLKQRWRAWERSGFNDDD 417
           V N     G  + +   TN D    ESL    F    THV N LK+  +  E   F D D
Sbjct: 365 VSNPELLEGMTLSDANQTNADQADPESL----FERTVTHVSNELKKALQDLETGKFKDMD 420

Query: 418 IKRM----KFGKTEQGKSKRIIEVNNVTEFQFHVDDNATFNIKDVCFTKSQNLETFMSLS 473
           + +M    KF     G   +IIE+N+++E      + + + ++D+C TKS+   TFMS+S
Sbjct: 421 MMKMEQEAKFYAAASG--SKIIEINDLSEIDLSNVNPSQYVVEDICATKSRCNNTFMSIS 478

Query: 474 CAFSERSGLNVCIHYPDGYNMDVFVECFQSFME 506
            +FS   GLN+ IHY +   M+ FVE F++F+E
Sbjct: 479 YSFSSTCGLNLGIHYSEDCEMNYFVESFEAFLE 511

>TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6.8
           YPL272C
          Length = 509

 Score =  352 bits (903), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 214/531 (40%), Positives = 313/531 (58%), Gaps = 61/531 (11%)

Query: 5   KSFRSLSSVEKKLFSQNLNNK-RNGLMFAAVY-STCFDKEETWSDNATLLTVKDQRLSNS 62
           K  R LSSVEK+    +L ++ R+G + +  + S   D     SD+ATLL+ KD+ L+ S
Sbjct: 10  KVLRPLSSVEKRFLGNSLESETRHGSVCSGKWVSNSLD----ISDDATLLSSKDKPLTIS 65

Query: 63  LVSRALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVNCHDGVPPY 122
           LVSRALK +I+N++E++TTIN N EFQ +  I   DV+  + F++ KDELVNCH G PPY
Sbjct: 66  LVSRALKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNCHSGAPPY 125

Query: 123 LLRHIFDKNKFETAKHKPLWQILIVDETMVIFHGHDVLFDIFAAANFHKLFQQALNQLPK 182
           L+ +IF    F+    KPLWQ+ IV+ ++V+F+G D LFDIFA ANF KL  + +N LP 
Sbjct: 126 LINYIFSLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFAVANFIKLLFEIINSLPY 185

Query: 183 DGPTLE--CLFK-----NDSKASFFPKSIYENHKLRLPAIATDLFQLQTQSFFKSVYNWT 235
           +   ++   +FK     N SK + FPKSIY+N  L LPA   +LF LQTQSFFKS+Y  T
Sbjct: 186 ENKEIQDDIIFKLPNIRNISKIN-FPKSIYDNPMLHLPATKPELFNLQTQSFFKSIYLNT 244

Query: 236 IKKPLDFINTNPNSGLKYYQSC-----YTDILLGANNLCGTTVFGNISAERVCALKKIMK 290
            KK  D++N    + +   ++      Y +IL   + +    V GN+S ER   L K++ 
Sbjct: 245 FKKSFDYLNFTQQTPIILARNHNISKNYNEILHLNSIVKSELVTGNVSMERYLQLLKLID 304

Query: 291 QENICLSSFVCAIALLCLKPLVNNFGSSVTFSIPVDLR-------------STIPQ--AS 335
            E I L SF C+I ++CLK ++  F  S+ F IP +LR             S+ P+  A+
Sbjct: 305 AEKIDLKSFFCSIIIMCLKFMITCFDGSIIFKIPYNLRSMQNLRDKENHNSSSGPEDSAN 364

Query: 336 RFGLCYKNVLVECPLTLIDDKVFQGLNVYNGYDIRNTKPTNKDPNYEESLLEYQFREACT 395
             G+ YK++ VE PL LI+                  K  N+D      ++E QF+  C 
Sbjct: 365 ELGIIYKDIYVEVPLKLIE------------------KIGNED------VVEEQFKIVCN 400

Query: 396 HVDNTLKQRWRAWERSGFNDDDIKRMKFGKTEQGKSKRIIEVNNVTEFQFHVDDNATFNI 455
           +++ ++++R +AWE++GFNDDDIKRMKFG  + G    IIEVN++T        ++ F+I
Sbjct: 401 YINESIQKRIKAWEKNGFNDDDIKRMKFGYEQVG---NIIEVNDLTSLDLSCSKDSLFHI 457

Query: 456 KDVCFTKSQNLETFMSLSCAFSERSGLNVCIHYPDGYNMDVFVECFQSFME 506
           +D+  T++      +SLS A +  +GLN+CI+Y   Y M  F++CFQSFME
Sbjct: 458 EDLSLTRNLKKNQILSLSFASNNYNGLNLCINYSTEYKMKDFIDCFQSFME 508

>ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL272C
          Length = 478

 Score =  344 bits (883), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 201/488 (41%), Positives = 286/488 (58%), Gaps = 46/488 (9%)

Query: 39  FDK--EETWSDNATLLTVKDQRLSNSLVSRALKKVINNNVELYTTINDNLEFQPVKTIMF 96
           FD+  +ETWSD++TL++ +   L    +S AL+ +I  NVE+  T+ D  +F PV  I +
Sbjct: 20  FDRREQETWSDSSTLMSSRCGCLREHQISSALRSMIRENVEMCVTVTDGPKFAPVSRIEY 79

Query: 97  DDVVQKVEFDSYKDELVNCHDGVPPYLLRHIFDKNKFETAKHKPLWQILIVDETMVIFHG 156
           DDVV+ +EF +YKDE + CHDG+PPY+ RHI +K+KFE    KPLW++ I D +MVIFH 
Sbjct: 80  DDVVRVIEFQTYKDEAIACHDGIPPYVARHILNKSKFEAG--KPLWEVYIADGSMVIFHC 137

Query: 157 HDVLFDIFAAANFHKLFQQALNQLPKDGPTLECLFKNDSKASFFPKSIYENHKLRLPAIA 216
           H+VLFD+FAA NFH  FQQAL +  K+ P  E LF            +YE   L+LP I 
Sbjct: 138 HNVLFDLFAAGNFHVRFQQALQRCEKNEPHNETLF------------VYEGGPLQLP-ID 184

Query: 217 TDLFQLQT-----------QSFFKSVYNWTIKKPLDFINTNPNSGLKYYQSCYTD----I 261
            D   L              SF K+V  + + KP   + +     L+  +S        +
Sbjct: 185 PDACSLPGVDVPYPASSPFVSFVKNVCRYAL-KPFGALASAVTPSLRLNRSSLGRKPFLL 243

Query: 262 LLGANNLCGTTVFGNISAERVCALKKIMKQENICLSSFVCAIALLCLKPLVNNFGSSVTF 321
            L   +L GTTV G ++++++ +L K++ +E +C+ SF+CAI LL LKPL+ NF  S+ F
Sbjct: 244 TLDKESLYGTTVSGYLNSKKLDSLLKLISKEEVCVRSFLCAITLLSLKPLIRNFDGSIAF 303

Query: 322 SIPVDLRSTIPQASRFGLCYKNVLVECPLTLIDDKVFQGLNVYNGYDIRNTKPTNKDPNY 381
           SIP+DLR+   + + FG   K +LV+CPL LIDD+VF+ L        R TK     P +
Sbjct: 304 SIPLDLRTESHKTTPFGFQSKRILVDCPLALIDDRVFESL-FNRPSKQRKTKLDKNSPKF 362

Query: 382 EESLLEYQFREACTHVDNTLKQRWRAWERSGFNDDDIKRMKFGKTEQGKSKRIIEVNNVT 441
            E LLEYQF+   THV  +L       + SG   D   + K+ K  Q + K+IIE+N V 
Sbjct: 363 SEGLLEYQFKRVTTHVMKSLTA-----QTSG---DWTGKRKYSKC-QLRKKKIIEINVV- 412

Query: 442 EFQFHVDDNATFNIKDVCFTKSQNLETFMSLSCAFSERSGLNVCIHYPDGYNMDVFVECF 501
                   +A F IK++ FT S   ETFMSLSCA     G+N+C+HY +  +MD+FV+CF
Sbjct: 413 --DMGTSPSARFQIKNMNFTDSLGSETFMSLSCALMRGVGMNMCMHYLERDSMDMFVDCF 470

Query: 502 QSFMEELS 509
           Q+F++ELS
Sbjct: 471 QTFLDELS 478

>Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C -
           Hypothetical ORF [contig 186] FULL
          Length = 519

 Score =  342 bits (877), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 190/518 (36%), Positives = 303/518 (58%), Gaps = 19/518 (3%)

Query: 5   KSFRSLSSVEKKLFSQNLNNKRNGLMFAAVYSTCFDKEETWSDNATLLTVKDQRLSNSLV 64
           K +R+L++ EK +  +     +NG++F++ Y    D  +  S + + + +  + L ++++
Sbjct: 6   KVYRNLTATEKTIICETAAGIKNGVLFSSTYFEGPDNVDNTSPSVSCMKM-GKGLPDAIM 64

Query: 65  SRALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVNCHDGVPPYLL 124
            +AL ++I  N EL ++IN  ++F+ + TI FDDVV+K+EFD+  DE V+C++GVPPYLL
Sbjct: 65  WQALSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGVPPYLL 124

Query: 125 RHIFDKNKFETAKHKPLWQILIVDETMVIFHGHDVLFDIFAAANFHKLFQQALNQLPK-D 183
           RHIFDK  F   + KPLWQ+ ++D++MV+FHGHDVLFD FAAA FHKLF +ALN      
Sbjct: 125 RHIFDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFLEALNSFRNVK 184

Query: 184 GPTLECLFKNDSKASFFPKSIYENHKLRLPAIATDLFQLQTQSFFKSVYNWTIKKPLDFI 243
           G   + +FK         +S+   H + L +   D     +Q+  K++Y+  IKKPL FI
Sbjct: 185 GQKSDLIFKTREDLIPLCQSLAAEHNVSLISSVKDQVLTYSQTALKNLYSLAIKKPLRFI 244

Query: 244 NTN--PNSGLKYYQSCYTDILLGANNLCGTTVFGNISAERVCALKKIMKQENICLSSFVC 301
            +    +SG+    S   D+   A +LCGT VFGN++ ERV  L+ +M +  I   SF+ 
Sbjct: 245 ESGRLEHSGIP--ASNPYDLASYAGDLCGTVVFGNVNPERVRGLRALMNESKISFRSFII 302

Query: 302 AIALLCLKPLVNNFGSSVTFSIPVDLRSTIPQASRFGLCYKNVLVECPLTLI--DDKVFQ 359
           ++ + CL P++      + FS+P++LR +IP AS  G+   NVL ECPL LI  D +   
Sbjct: 303 SVTMFCLLPVLEPSEEKIIFSVPINLRESIPWASDLGVFQNNVLFECPLDLIKHDIEPCS 362

Query: 360 GLNVYN-----GYDIRNTKPTNKDPNYEESLLEYQFREACTHVDNTLKQRWRAWERSGFN 414
           G++ +N     G  + +    N+D N  +++    FR   THV   L+      E+S  +
Sbjct: 363 GISTFNQEFLEGSTLTDVGGVNEDQNDPQTV----FRRILTHVTTELELAAMRLEKSHSS 418

Query: 415 DDD-IKRMKFGKTEQGKSK-RIIEVNNVTEFQFHVDDNATFNIKDVCFTKSQNLETFMSL 472
            +D IK  +  +     S+ +I+E+N++ E       ++ + I DVC T S+  +TFMS+
Sbjct: 419 GEDLIKAEREARYFAASSRSKIVEINDLLEVDLSSKIHSRYKIGDVCSTSSRKSDTFMSI 478

Query: 473 SCAFSERSGLNVCIHYPDGYNMDVFVECFQSFMEELSQ 510
           S   SE SGLN+ IHY +G+NM+ FVE F+ F++   +
Sbjct: 479 SYCSSEISGLNLGIHYSEGFNMEYFVESFEGFLDSFPE 516

>NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8
          Length = 515

 Score =  327 bits (839), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 193/522 (36%), Positives = 297/522 (56%), Gaps = 32/522 (6%)

Query: 8   RSLSSVEKKLFSQNLNNKRNGLMFAAVYSTCFDKEETWSDNA-TLLTVKDQRLSNSLVSR 66
           R LS  E KL  Q L  KRNG+ FAA Y   +D     S +  TL+++KD+RL+ S+++R
Sbjct: 4   RQLSEYEVKLLEQTLQGKRNGVAFAAKYGRNYDDSSLSSSDESTLVSLKDRRLTLSVITR 63

Query: 67  ALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVNCHDGVPPYLLRH 126
            L+ +I  ++ELYT I+++  +  V  I   DV+  + FDS KDE +NCH G PPYLLRH
Sbjct: 64  VLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLGPPPYLLRH 123

Query: 127 IFDKNKFETAKHKPLWQILIVDETMVIFHGHDVLFDIFAAANFHKLFQQALNQL------ 180
           IF+K+ F+  + KPLW++ I+DET +IFHG D+LFD F+AA FHK F   +N        
Sbjct: 124 IFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSYMSSIVS 183

Query: 181 PKDGPTLECLFKNDSKASF------FPKSIYENHKLRLPAIATDLFQLQTQSFFKSVYNW 234
            K    L+ LF+  S A         P+SIY+        +   +F  QT+SFFKS+Y  
Sbjct: 184 SKQKKPLDYLFQLSSSADLIKIYDEIPRSIYDYDSSPFAPLTAVMFNDQTKSFFKSLYLN 243

Query: 235 TIKKPLDFINTNPNSGLKYYQSC-------YTDILLGANNLCGTTVFGNISAERVCALKK 287
            +KKP++FI TN +S +K YQ         Y + +    +LCG T+FG IS+ R   L +
Sbjct: 244 AVKKPIEFI-TNTSSQVKTYQQIKEAETEGYLNPMGIHRSLCGNTIFGTISSCRFNELTE 302

Query: 288 IMKQENICLSSFVCAIALLCLKPLVNNFGSSVTFSIPVDLRSTIPQASRFGLCYKNVLVE 347
              +E I L S +C + ++ LKP +N+F  ++ FSI V+LR  + ++  FGL Y+++++E
Sbjct: 303 KATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRVNLRDDVSKSKTFGLYYRDIIIE 362

Query: 348 CPLTLIDDKVFQGLNVYNGYDIRNTKPTNKDPNYEESLLEYQFREACTHVDNTLKQRWRA 407
           CPL+LIDD+  Q    ++GY   +   T ++    E + E QF++  T++ N + ++   
Sbjct: 363 CPLSLIDDRAIQ----FSGYR-DHVGITAQELETYEKVYEQQFKDVTTYIQNVMNEKIGY 417

Query: 408 WERSGFNDDDIKRMKFGKTEQGKSKRIIEVNNVTEFQF--HVDDNATFNIKDVCFTKSQN 465
           W+     D+DIK MK           II++N++TE     ++  N  + +K      S +
Sbjct: 418 WK----TDNDIKMMKMMDDMHQSKDEIIQINDLTEIDINENLSQNDPYCVKSSSMVTSLS 473

Query: 466 LETFMSLSCAFSERSGLNVCIHYPDGYNMDVFVECFQSFMEE 507
            +   S+S    E SGL + IH P   +M+ FVE FQ+F++E
Sbjct: 474 KKEMFSVSYTHCEASGLTISIHIPKMRSMESFVENFQAFLDE 515

>Kpol_1032.1 s1032 (25..765) [741 bp, 246 aa] {ON} (25..765) [741
           nt, 247 aa]
          Length = 246

 Score =  126 bits (316), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 77/242 (31%), Positives = 128/242 (52%), Gaps = 29/242 (11%)

Query: 273 VFGNISAERVCALKKIMKQENICLSSFVCAIALLCLKPLVNNFGSSVTFSIPVDLRSTIP 332
           +FG I+AER   LK ++++  ICL S +C I +LC KP + NF  ++ FSI VD++  + 
Sbjct: 25  LFGTIAAERFNRLKALIRKGRICLRSVICGIVMLCTKPNIQNFDGNIRFSIGVDMKPIVD 84

Query: 333 QASRFGLCYKNVLVECPLTLIDDKVFQGLNVYNGYDIRNTKPTNKDPNYEESLLEYQFRE 392
            +S+FG+  KN++V+CPL LIDDK +              K T+ +      +LE QFR+
Sbjct: 85  DSSQFGILKKNIIVDCPLKLIDDKHY--------------KDTDSESIKNGDILEIQFRK 130

Query: 393 ACTHV----DNTLKQRWRAWERSG--FNDDDIKRMKFGKTEQGKSKRIIEVNNVTEFQFH 446
               V     N L+   + ++R+   FN   I         Q    ++I++N++T+  F 
Sbjct: 131 VTDFVTEELSNKLQSMAKHFKRNNCPFNFSSI-------NSQISDSKVIQINDLTDIPFT 183

Query: 447 VDDN--ATFNIKDVCFTKSQNLETFMSLSCAFSERSGLNVCIHYPDGYNMDVFVECFQSF 504
             +     ++  D+  T+  +    MSLS   +  S +++ IHY +   MD FVECF++F
Sbjct: 184 TTEQNPNGYSFHDLKVTEGLSPNESMSLSYITNSNSAMSISIHYTETKYMDSFVECFRTF 243

Query: 505 ME 506
           +E
Sbjct: 244 IE 245

>CAGL0K00737g Chr11 complement(81263..82636) [1374 bp, 457 aa] {ON}
           similar to uniprot|P53304 Saccharomyces cerevisiae
           YGR212w
          Length = 457

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 101/458 (22%), Positives = 188/458 (41%), Gaps = 77/458 (16%)

Query: 61  NSLVSR-----ALKKVINNNVELYTTI---NDNLEFQPV-KTIMFDDVVQKVEFDSYKDE 111
           NSL +R     AL++V+N++ +LY      N+ +   P+ + I FDDVV  +++D+Y +E
Sbjct: 31  NSLPNRSDFICALRRVVNSHFQLYCNAYKSNNEVVVNPIGEPIKFDDVVDYMDWDTYGEE 90

Query: 112 LVNCHDGVPPYLLRHIFDKNKFETAKHKPLWQILIVDET-MVIFHGHDVLFDIFAAANFH 170
            +N            +F K  FE    KPLW++++V +   +IF    + FD  A   F 
Sbjct: 91  EINS-----------VFRKYNFEYGVDKPLWKVIVVPKANKMIFATDHLFFDGIATVLFW 139

Query: 171 KLFQQALNQLPKDG--PTLECLFKNDSKASFFPKSIYENH---KLRLP-------AIATD 218
               ++L +L +D      E +++          SI + H   KL +P        I   
Sbjct: 140 TELLKSLEELKQDNDLDVDEIIYRPGGSTD----SIDQCHPYEKLPIPFSWKVKRPIVKA 195

Query: 219 LFQLQTQSFFK---SVYNW-TIKKPLDFINTNPNSGLKYYQSCYTDILLGANNLCGTTVF 274
           LF +   +      S+  +   K P D++  N N        CY   +   N        
Sbjct: 196 LFTIAPGAVVSQDASIIQFDEYKIPEDYLKKNSND-----DGCYQ--IKNTNRQISL--- 245

Query: 275 GNISAERVCALKKIMKQENICLSSFVCAIALLCLK--PLVNNFGSSVTFSIPVDLRSTIP 332
             +S+ ++  + K  KQ ++  ++++ A+  L L   P     GS++ + +P++ R+ I 
Sbjct: 246 -KMSSNKLKVIMKDCKQHHVSFTAYLTAVLYLALGKIPKEKYSGSTIKYEVPMNTRNRIS 304

Query: 333 QASRFGLCYKNVLVECPLTLIDDKVFQGLNVYNGYDIRNTKPTNKDPNYEESLLEYQFRE 392
            +  +   Y                  G  V  G  I        +    +S+ +    +
Sbjct: 305 NSGEYSNSY------------------GTFVAGGEFIETLDFERDEWELAQSIHKKIVEK 346

Query: 393 ACTHVDNTLKQRWRAWERSGFNDDDIKRMKFGKTEQGKSKRIIEVNNVTEFQFHVDDNAT 452
           + T V + + +  R  E    +     +MKF +T  G S    EV N+    F  ++++ 
Sbjct: 347 STTGVMDAINEA-RLLEL--VDAKKFMKMKF-ETTTGPSS-TFEVTNLGFQNFSQNEHSK 401

Query: 453 FNIKDVCFTKSQNLETFMSLSCAFSERSGLNVCIHYPD 490
           + + D  F + Q     ++ S   +   GLN  + YP+
Sbjct: 402 YTVTDAFFNEPQLFTNLITYSVISTPSGGLNCSMAYPE 439

>TDEL0E05110 Chr5 (941876..943285) [1410 bp, 469 aa] {ON} Anc_5.119
           YGR212W
          Length = 469

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 105/449 (23%), Positives = 172/449 (38%), Gaps = 71/449 (15%)

Query: 64  VSRALKKVINNNVELYTTI----NDNLEF-QPVKTIMFDDVVQKVEFDSYKDELVNCHDG 118
           ++ AL+  I N+ +L+  +     DN+ + + V TI FDDVV+ V +D + D  + C   
Sbjct: 41  IAHALRSTIANHPKLHQNVAIDPEDNIPYIKNVDTIKFDDVVEYVSWDGFDDNTI-C--- 96

Query: 119 VPPYLLRHIFDKNKFETAKHKPLWQILI-VDETMVIFHGHDVLFDIFAAANFHKLFQQAL 177
                  HIF    F     KPLW++L+   E  ++      LFD  +A  F K F  +L
Sbjct: 97  -------HIFQTYNFPYNIEKPLWKVLVYAKENRLLLLLDHALFDGMSAVIFWKSFMSSL 149

Query: 178 NQLPKDGPTLECLFKNDSKASFFPKSIYENHKLRLPAIATDLFQLQTQSFFKSVYNWTIK 237
           +   +D   L      D         +YEN      +  T         F  SV     K
Sbjct: 150 SSDARDDFDLLYELTGDPMVQ-EDSHVYENWPTSWSSTLTKAIAGVIFKFMPSVITSVGK 208

Query: 238 KPLDFINTN-PNSGLKYYQSCYTDILLGANNLCGTTVFGNISAERVCALKKIMKQENICL 296
             L F   + P+S L +     +   +  NN     +   +  + +  +    K   + L
Sbjct: 209 DQLRFNGYSFPDSLLTHKPDDDSSYEIRNNN---RQLNLQVQPDHLNGIISACKSHQVSL 265

Query: 297 SSFVCAIALLCLKPLVNNF---GSSVTFSIPVDLRSTIPQASRFGLCYKNVLVECPLTLI 353
           +SF+ A+  + L+  + +    GS +   IP++ R         G C    +++ P T +
Sbjct: 266 TSFITALISMSLQLKIEDGDYSGSKIMIDIPMNTR---------GACAD--VLDIPDTSV 314

Query: 354 DDKVF-QGLNV-YN------GYDIRNTKPTNKDPNYEESLLEYQFREACTHVDNT---LK 402
               F  GLNV YN       + I  T     +   +  +LE   +     V +T   ++
Sbjct: 315 TMGNFVAGLNVEYNLGESEELWQIARTVQAALNKQTKTDILETVNKVRLLDVADTTEFIR 374

Query: 403 QRWRAWERSGFNDDDIKRMKFGKTEQGKSKRIIEVNNVTEFQFHVD--DNATFNIKDVCF 460
           Q+ +A   SG                       EV N+  FQ   D   N  + ++D  F
Sbjct: 375 QKVKATGPSG---------------------TFEVTNLG-FQEFADAQSNHGYLVEDAVF 412

Query: 461 TKSQNLETFMSLSCAFSERSGLNVCIHYP 489
            + Q L    +     + R GLN  I YP
Sbjct: 413 NEPQGLSDIFTCCIISTPRGGLNCSISYP 441

>KLTH0C02178g Chr3 complement(196605..197999) [1395 bp, 464 aa] {ON}
           weakly similar to uniprot|P53304 Saccharomyces
           cerevisiae YGR212W SLI1 N-acetyltransferase confers
           resistance to the sphingolipid biosynthesis inhibitor
           myriocin (ISP-1) by inactivating it co-operates with
           Ypk1p in mediating resistance to myriocin converts
           myriocin into N-acetyl-myriocin
          Length = 464

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 98/453 (21%), Positives = 178/453 (39%), Gaps = 72/453 (15%)

Query: 60  SNSLVSRALKKVINNNVELYT---TINDNLEFQPVK-TIMFDDVVQKVEFDSYKDELVNC 115
           + S + +A++ V+    +LY+   T N +L  +P++ T++  DVV+  E +S  +E  N 
Sbjct: 34  TRSEIVQAVRAVVPEYPQLYSDVVTRNGSLVLEPLQSTLVLSDVVEFTEMESLDEEHSN- 92

Query: 116 HDGVPPYLLRHIFDKNKFETAKHKPLWQILIV-DETMVIFHGHDVLFDIFAAANFHKLFQ 174
                      IF +  F     KPLW++LI+ D+   +     ++ D  +A  F   F 
Sbjct: 93  ----------KIFKEVTFVYGAEKPLWKVLILKDQRTFVLCSDHLILDGLSATVFWGSFM 142

Query: 175 QALNQLPKDG--PTLECLFKNDSKASFFPKSIYENHKLRLP-AIATDLFQLQTQSF-FKS 230
           ++LN    D   P  E +FK     +  P+  Y     R+P +I+  L ++  +     S
Sbjct: 143 RSLNASHADSTFPD-EVVFKPSPNIAHVPQHPYS----RIPVSISGLLLRIVVRILVLIS 197

Query: 231 VYNWTIKKPLDFINTNPNSGLKYYQSCYTDILLGA-----NNLCGTTVFGNISAERVCAL 285
           +    +  P+ F+    +   K+    + D LL +     N+ C   +   +    + AL
Sbjct: 198 LLGIDLIGPV-FVPELGSEDFKFLHYRFPDGLLTSDGSVRNDNCQLKI--KVPPNNLRAL 254

Query: 286 KKIMKQENICLSSFVCAIALLCLKPLVNNF--GSSVTFSIPVDLRSTI-------PQASR 336
            +  K++ + LS F+ A+    LK +  +   GS +  S+P++ R  I       P+A  
Sbjct: 255 LRRCKEKKVSLSVFLLAVIAHSLKLVGTDCVEGSRIKASVPMNARPLIQEILSMKPEAVE 314

Query: 337 FGLCYKNVLVECPLTLIDDKVFQGLNVYNGYDIRNTKPTNKDPNYEESLLEYQFREACTH 396
            G       +E   T             +G DI  T        + E LL  +   +   
Sbjct: 315 IGNFITGATLEYDRT-------------SGGDIWQTA-----TKFREDLLSQKNSRSSIE 356

Query: 397 VDNTLKQRWRAWERSGFNDDDIKRMKFGKTEQGKSKRIIEVNNVTEFQFHVDDNATFNIK 456
               L+              D++     K          EV N+    F   ++  + ++
Sbjct: 357 SAKLLELV------------DVEAFVERKKNARYPDSTFEVTNLGFQSFDCGEDDRYYVQ 404

Query: 457 DVCFTKSQNLETFMSLSCAFSERSGLNVCIHYP 489
           D  F   Q L   +S  C  +   GLN  I++P
Sbjct: 405 DSIFNNPQGLGDVLSCGCVATPVGGLNCSINFP 437

>Kwal_27.9898 s27 (112396..113778) [1383 bp, 460 aa] {ON} YGR212W -
           Hypothetical ORF [contig 43] FULL
          Length = 460

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 95/460 (20%), Positives = 172/460 (37%), Gaps = 65/460 (14%)

Query: 56  DQRLSNSLVSRALKKVINNNVELYTTINDNLEF---QPV-KTIMFDDVVQKVEFDSYKDE 111
           +Q  S S +  A+K  +     LY+ +    E    +P+ + I+ + V++  ++    ++
Sbjct: 30  NQSPSRSEICGAIKATVEECPHLYSDVVTKGELPSLEPINEQILLEQVLEYTDYGLLDED 89

Query: 112 LVNCHDGVPPYLLRHIFDKNKFETAKHKPLWQILIVDE--TMVIFHGHDVLFDIFAAANF 169
           + N            IF + +F     KPLW++L++++  T+V+   H V+ D  +   F
Sbjct: 90  ICN-----------KIFREVEFTYGSGKPLWKVLVLNDRRTLVLCTDH-VILDGLSTVAF 137

Query: 170 HKLFQQALNQLPKDGPTLECLFKNDSKASFFPKSIYENHKLRLPAIATDLFQLQTQSFFK 229
            K F  +LN         E +F+     S  P+  Y+    R+P      F+   ++  +
Sbjct: 138 WKKFLGSLNATASTSLVSEVVFEPSVHNSVVPQHPYD----RIPVT---FFETMARALVQ 190

Query: 230 SVYNWTIKKPLDFINT---NP--NSGLKYYQSCYTDILLGANNLCGTTVFGN------IS 278
            +      K +D I T    P     LK+    +T   L A+   G+    N      I 
Sbjct: 191 VLVFLAFLK-IDLITTLFVPPLQKQYLKFKNYQFTRDYLAAD---GSVRNDNRLLKIVIP 246

Query: 279 AERVCALKKIMKQENICLSSFVCAIALLCLKPLVNNF--GSSVTFSIPVDLRSTIPQASR 336
            +++  L  + K  N+ LSS + AI    LK + ++   G+    SIP++ R  I     
Sbjct: 247 PQKLQNLLALCKGHNVSLSSLILAIMANSLKHVDSSQFDGTRAKISIPMNTRPFIE---- 302

Query: 337 FGLCYKNVLVECPLTLIDDKVFQGLNVYNGYDIRNTKPTNKDPNYEESLLEYQFREACTH 396
                K +L E       + +  G   Y+  D  +   T              FR     
Sbjct: 303 -----KTLLAEPKSIEFGNFIVGGELEYDLSDAGDLWQTAA-----------HFRHDLAV 346

Query: 397 VDNTLKQRWRAWERSGFNDDDIKRMKFGKTEQGKSKRIIEVNNVTEFQFHVDDNATFNIK 456
             N    R         +  ++  +   K  +       E+ N+    F   +N  + + 
Sbjct: 347 QRNV---RGSIMSTRLLDLVEVDHLMSVKASERYPSSTFELTNLGLQSFGCSENDKYFVV 403

Query: 457 DVCFTKSQNLETFMSLSCAFSERSGLNVCIHYPDGYNMDV 496
           D  F   Q L    S +   +   GLN  I YP   + D+
Sbjct: 404 DSSFHNPQGLSEVFSCAAVATPVGGLNCSISYPKSLSSDL 443

>Kpol_1010.49 s1010 (113037..114482) [1446 bp, 481 aa] {ON}
           (113037..114482) [1446 nt, 482 aa]
          Length = 481

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 93/441 (21%), Positives = 184/441 (41%), Gaps = 68/441 (15%)

Query: 94  IMFDDVVQKVEFDSYKDELVNCHDGVPPYLLRHIFDKNKFETAKHKPLWQILIVD-ETMV 152
           I F D+V+   +DS  +  +N            IF +  FE    KP+W+IL+++ +  +
Sbjct: 78  IYFADIVEYKNWDSVSESNINS-----------IFQEYSFEYFTDKPVWKILVLENQNQL 126

Query: 153 IFHGHDVLFDIFAAANFHKLFQQAL---NQLPKDGPTLECLFKNDSKASFFPKSIYENHK 209
           +     VLFD  +  NF   F  +L   + + +D    E +F  +  +      + +NH 
Sbjct: 127 LMLLDHVLFDGMSGINFWNSFISSLPSIDSISEDANANELIFPFEEPSQI--AVLGDNHP 184

Query: 210 LRLPAIATDLFQLQTQSFFKSVYNWTIKKPLDFINTNPNSGLKYYQSCYTDILLGANNLC 269
                I+T     +T    K ++ W    P   ++ +P   +K+    Y   LL  N++ 
Sbjct: 185 YENWPISTTWHIKRT--LLKHIFKWY---PGKIMSHDPQL-IKFNSYSYPSGLLDNNSVP 238

Query: 270 GTTVFG----------NISAERVCALKKIMKQENICLSSFVCAIALLCLKPLVNNF--GS 317
             + +            I  + +  + +  + +   L+S++ ++ +  L+ + +++  GS
Sbjct: 239 SKSQYTIKNNNKQYELRILPDELKFVLQYCRTKGFSLTSYLSSLFVNELRTVDSSYYNGS 298

Query: 318 SVTFSIPVDLRSTIPQASRFGLCYKNVLVECPLTLIDDKVFQGLNVYNGYDIRNTKPTNK 377
            +   IP++ RS         +C K + +  P  +       GL +    D       + 
Sbjct: 299 KIKIEIPMNTRS---------ICEKELNL-SPEQMELGNFITGLGLETEIDGEKISVEDL 348

Query: 378 DPNYEESLLEYQFREACTHVDNTLK-------QRWRAWERSGFNDDDIKRMKFGKTEQGK 430
             +++ S L+ Q +E+ T   NT K       + +  ++ +  +D DI     G T    
Sbjct: 349 ARSFQNS-LKKQSQESITESMNTTKSLDVVNTKDFVEYKINPLDDSDISYP--GAT---- 401

Query: 431 SKRIIEVNNVTEFQFHVDDNATFNIKDVCFTKSQNLETFMSLSCAFSERSGLNVCIHYPD 490
                E+ N+  +Q  V +NA F + D  F + Q +      S   ++  GLN  I YP 
Sbjct: 402 ----FEITNLG-YQNFV-ENAGFCVVDAVFGQPQGISDNFFCSIVSTKLGGLNCLISYPT 455

Query: 491 GYNMDVFVE-CFQSFMEELSQ 510
             +++V +E CF S  ++L +
Sbjct: 456 --SLEVPLERCFDSVRDQLKE 474

>Kpol_191.1 s191 complement(429..848) [420 bp, 139 aa] {ON}
           complement(429..848) [420 nt, 140 aa]
          Length = 139

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 65/139 (46%), Gaps = 4/139 (2%)

Query: 7   FRSLSSVEKKLFSQNLNNKRNGLMFAA-VYSTCFDKEETWSDNATLLTVKDQRLSNSLVS 65
            R L+  EK    Q      NG++F+  +   C   E+  SD+ATL T  +      L+ 
Sbjct: 2   LRILNESEKSALKQTSEGSMNGIIFSVKISKKC---EDNLSDDATLHTTGESGNLQLLLL 58

Query: 66  RALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVNCHDGVPPYLLR 125
           ++LK +I    EL TT+++NL F  +  +   DVV+ + +   K ++     G    L+ 
Sbjct: 59  KSLKLLIPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRKFDINEGLSGPSSSLIN 118

Query: 126 HIFDKNKFETAKHKPLWQI 144
            I+  + F+    KP  ++
Sbjct: 119 SIYYHSNFQPGSGKPYGKL 137

>TPHA0H00960 Chr8 (201187..202617) [1431 bp, 476 aa] {ON} Anc_5.119
           YGR212W
          Length = 476

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 119/527 (22%), Positives = 204/527 (38%), Gaps = 114/527 (21%)

Query: 7   FRSLSSVEKKLFSQNLNNKRNGLMFAAVYSTCFDKEETWSDNATLLTVKDQRL--SNSLV 64
            R LS  EK  FS+++ N            TCF            +TVK  +L   N L 
Sbjct: 3   LRELSGTEKFFFSRSVLN----------LHTCF-----------YVTVKLNKLPTENELC 41

Query: 65  SRALKKVINNNVELYTTINDNLEFQPVKTIM-------FDDVVQKVEFDSYKDELVNCHD 117
           S +L+KVI  N  L   IN N +   +  I+         DV++  +++ ++++  N   
Sbjct: 42  S-SLRKVIAKNRILRCNINKNGDSAYINDIIENDNEFTVQDVIEYRDWNKFEEDEQN--- 97

Query: 118 GVPPYLLRHIFDKNKFETAKHKPLWQILIVDE--TMVIFHGHDVLFDIFAAANFHKLFQQ 175
                    +F +  F+  + KPLW+++I  +  T+V+   H   FD  +A  F K    
Sbjct: 98  --------SVFQEINFKYGELKPLWKLIIASKINTIVLAMDH-TFFDGSSATLFWKALLL 148

Query: 176 ALNQLPKDGPTLECLFKNDSKASFFPKSIYENHKLRLPAIATDLFQLQTQSFFKSVYNWT 235
            L+ + +D   LE     D+   F   +I +N+   L   + +L      SF   +  + 
Sbjct: 149 ELSSIDRD--QLE-----DTDVVFSKANIDDNYITALDISSNNLLDDCPISFASKIKRFI 201

Query: 236 IKKPLDFIN---TNPNSGL------KYYQSCYTDILLGANNLCGTTV-------FGNISA 279
             K   +       PNS L       +  S + D   G +      +         NI  
Sbjct: 202 ASKIFQYFPYTIIAPNSELLQFDDYSFPSSIFED---GCDKPASYKLKNNSRRAIINIKP 258

Query: 280 ERVCALKKIMKQENICLSSFVCAIA---LLCLKPLVNNFGSSVTFSIPVDLRSTIPQ--- 333
            ++  + K  + +NI L+S++ A+    +   K    N GS++   IP++LR  + +   
Sbjct: 259 AQISNVLKYCRSKNIALTSYLSALISYYVNIYKDKSVNHGSAIKVEIPINLRGILKEKLE 318

Query: 334 ---ASRFGLCYKNVLVECPLTLIDDKVFQGLNVYNGYDIRNTKPTNKDPNYEESLLEYQF 390
              A  FG CY    +     +ID ++       NG  I     T           + Q 
Sbjct: 319 MDIAPDFG-CY----ISSTDLVIDSQL-------NGSTIDKLAST----------FQKQI 356

Query: 391 REACT-HVDNTLKQRWRAWERSGFNDDDIKRMKFGKTEQGKSKRI-----IEVNNVTEFQ 444
             +   +VD T+ +  +  E      D  K  ++  T +    +I      EV N+    
Sbjct: 357 SNSVKENVDETI-ENIKITEVI----DSFKFFEYKVTPKPSEDKIFPGATFEVTNLGRVS 411

Query: 445 FHVDDNATFNIKDVCFTKSQNLETFMSLSCAFSERSGLNVCIHYPDG 491
           F    N  F ++D  F  SQ+L T  +     ++  G+N+ I Y D 
Sbjct: 412 FET-KNDNFFVEDALFGGSQSLTTIFTCYVISTDFGGMNLAITYSDS 457

>SAKL0G15004g Chr7 (1288241..1289611) [1371 bp, 456 aa] {ON} similar
           to uniprot|P53304 Saccharomyces cerevisiae YGR212W SLI1
           N-acetyltransferase confers resistance to the
           sphingolipid biosynthesis inhibitor myriocin (ISP-1) by
           inactivating it co-operates with Ypk1p in mediating
           resistance to myriocin converts myriocin into N-acetyl-
           myriocin
          Length = 456

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 67/287 (23%), Positives = 129/287 (44%), Gaps = 35/287 (12%)

Query: 60  SNSLVSRALKKVINNNVELYTTI---NDNLEFQPVKT-IMFDDVVQKVEFDSYKDELVNC 115
           S  L+S  + KVI    +LY+ +   ++    +P+++ I F+DVV+ ++ +   +EL+N 
Sbjct: 34  SRELLSHVITKVIPRYPQLYSNVFLQDEKPIVKPIESFIYFNDVVEYMQEEQLTEELIN- 92

Query: 116 HDGVPPYLLRHIFDKNKFETAKHKPLWQILIVD--ETMVIFHGHDVLFDIFAAANFHKLF 173
                      IF   KF+     P+W+IL ++   ++V+   H + FD  +   F +  
Sbjct: 93  ----------QIFRTVKFKYHDDVPIWKILALNGGRSLVLCLEH-LFFDGLSGVKFLENI 141

Query: 174 QQALNQLPKDGPTLECLFKNDSKASFFPKSIYEN----HKLRLPAIATDLFQLQTQSFFK 229
            + LN +       + ++K + K    PK  Y N     K ++      LF         
Sbjct: 142 MEELNTIECFSNYQDIVYKCEGK-ELVPKHPYSNWPIPWKWKMIRSLAPLFVKLDSYIGP 200

Query: 230 SVYNWTIKKPLDFINTNPNSGLKYYQSCYTDILLG---ANNLCGTTVFGNISAERVCALK 286
            V N+T    +  +N N     ++ +  + D++      N+ C   +  +I AE +  L 
Sbjct: 201 WVANFTHGSSM--LNFN---RYEFPKGIFRDVVKRDEIRNDNC--QLIFSIPAENLEQLV 253

Query: 287 KIMKQENICLSSFVCAIALLCLKPLVNNF--GSSVTFSIPVDLRSTI 331
              K+ N+ L+S + ++ +  LK +  +   GS VT  +PV+ R+ I
Sbjct: 254 VKCKKHNVSLTSILISVFIASLKEVDPSMIHGSQVTVDVPVNTRNLI 300

>NDAI0D02360 Chr4 (545485..546897) [1413 bp, 470 aa] {ON} Anc_5.119
           YGR212W
          Length = 470

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 97/461 (21%), Positives = 182/461 (39%), Gaps = 88/461 (19%)

Query: 66  RALKKVINNNVELYTTINDNLE-----FQPVK--TIMFDDVVQKVEFDSYKDELVNCHDG 118
           +AL+  I    +L+  I  N E      + +K   I F+DVV+ V ++ ++++ +N    
Sbjct: 43  KALQDTIATYPQLHQNITKNKEDEYLYVEDIKKTPIEFEDVVEFVAWEKFEEKEINS--- 99

Query: 119 VPPYLLRHIFDKNKFETAKHKPLWQILIVDE--TMVIFHGHDVLFDIFAAANFHKLFQQA 176
                   IF    F     +PLW+IL+V    T ++   H  LFD  +A    + F + 
Sbjct: 100 --------IFQTYNFHYRNDRPLWKILVVPSLNTFILLLDH-ALFDGISAVKIWETFMEK 150

Query: 177 LNQLPKDGPTLECLFKNDSKASFFPKSIYENHKLRLPA------IATDLFQLQTQSFFKS 230
           LN+      + E    + +   + P+   ENH+  L A      I       + +SF  +
Sbjct: 151 LNK------SSEIENIDVTVPLYIPE---ENHEGTLVASQHPYDIWPVPIAWKVKSFIAT 201

Query: 231 -VYNWTIKKPLDFINTNPNSGLKYYQSC-YTDILLGANNLCGTTVFG----------NIS 278
            ++NW    P   I  +PNS L  ++   + +  L      G T F            ++
Sbjct: 202 KLFNWY---PQAII--SPNSNLFEFKGYKFPEGFLSQYPKDGVTSFKVRNDNTQKLIKMA 256

Query: 279 AERVCALKKIMKQENICLSSFVCAIALLCLKPLVNN--FGSSVTFSIPVDLRSTIPQASR 336
             ++  + K  K   + L+S++ AI ++ L+ +      G+ +  SIP++ R+       
Sbjct: 257 PGKLETILKNCKTNAVSLTSYIVAIIIIALRNVTQESYTGNLLKVSIPINTRN------- 309

Query: 337 FGLCYKNVLVECPLTLIDDKVFQGLNVYNGYDIRNTKPTNKDPNYEESLLEYQ------F 390
             +C     V  P     +++ Q  N     D  +  P N D    +   + Q       
Sbjct: 310 --ICANQ--VNTP-----EEMLQLGNFVGSMDFEH--PINSDSGIWDIARDVQQFITKNT 358

Query: 391 REACTHVDNTLKQRWRAWERSGFNDDDIKRMKFGKTEQGKSKRIIEVNNV--TEFQFHVD 448
               + + N +K         G N ++  + K   +  G +    EV N+    F+    
Sbjct: 359 TVGISDIINNIKL------LDGINCEEFVKKKIEFSSNGPAST-FEVTNLGFQSFKGSCM 411

Query: 449 DNATFNIKDVCFTKSQNLETFMSLSCAFSERSGLNVCIHYP 489
           +++++ IKD  F + Q +    + S   +   GL   + YP
Sbjct: 412 ESSSYFIKDAVFNEPQGMSDIFTCSVISTPIGGLRCSLSYP 452

>KNAG0G00700 Chr7 complement(132337..133707) [1371 bp, 456 aa] {ON}
           Anc_5.119 YGR212W
          Length = 456

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 94/465 (20%), Positives = 170/465 (36%), Gaps = 94/465 (20%)

Query: 56  DQRLSNSLVSRALKKVINNNVELYTTINDNLEFQPV-----KTIMFDDVVQKVEFDSYKD 110
           D+  S +  + A+ + +    +L TT+ +  +  P        + +DD V+  ++  +  
Sbjct: 31  DRTPSQAQFAHAIHECLVKFPQLTTTVVELEQGTPTFANITVPLRYDDFVEVKQWGQWDA 90

Query: 111 ELVNCHDGVPPYLLRHIFDKNKFETAKHKPLWQILIVDE--TMVIFHGHDVLFDIFAAAN 168
           +L N            IF +  F+    KPLW+IL + +  T V+   H VLFD  +  N
Sbjct: 91  QLAN-----------EIFKEYNFQYTVEKPLWRILAMPKSSTFVLLVDH-VLFDGMSTVN 138

Query: 169 FHKLFQQALNQLPKDGPTLECLFKNDSKASFFPKSIYENHKLRLPAIATDLFQLQTQSF- 227
             +                 CL +N       P+S   +  L  P+   D    +   + 
Sbjct: 139 LWR-----------------CLLEN-----LGPEST--SDVLYEPSNEADQLGQRPHPYD 174

Query: 228 -FKSVYNWTIKKPL--------DFINTNPNSGLKYY-QSCYTDILLGANNLCGTTVFG-- 275
            +   ++W +K+ L            T  N  L ++ Q    D LL  N      ++   
Sbjct: 175 SWPVGWSWRLKRALVPWIFYYAPRTVTGVNEQLVHFSQYTLQDNLLQRNKPEEYKIYNDN 234

Query: 276 -----NISAERVCALKKIMKQENICLSSFVCAIALLCLKPLVNNFGSSVTFSIPVDLRST 330
                NI  E +  L    K+  + L+S+           LV+ F  ++++    ++R  
Sbjct: 235 DRWVLNIKGEPMAKLITRCKEHQVSLTSY-----------LVSVFALALSYQAEGNIRVD 283

Query: 331 IPQASRFGLCYKNVLV---ECPLTLIDDKVFQGLNVYNGYDIRNTKPTNKDPNYEESLLE 387
           IP  +R   C + V V   EC L      +        G DI       +    ++S   
Sbjct: 284 IPMNTR-NKCKETVGVTEQECLLGNFVGGISHTYQAQPGQDIWRMAREAQTTVVQKSQ-- 340

Query: 388 YQFREACTHVDNTLKQRWRAWERSGFNDDDIKRMKFGKTEQGKSKRIIEVNNVTEFQFHV 447
                    +D+T+       E    +   I++    K E+       EV N+   +F  
Sbjct: 341 -------DDIDDTIN------EVKLLDVVSIQKFLAKKLEERWPAGTFEVTNLGFQKFPG 387

Query: 448 DD---NATFNIKDVCFTKSQNLETFMSLSCAFSERSGLNVCIHYP 489
           DD      F ++D  F + Q +    +++   ++  GLN CI  P
Sbjct: 388 DDGEQGVEFQVQDAFFDEPQGISDIFTVAAISTKHGGLNCCISSP 432

>Skud_7.548 Chr7 (891732..893159) [1428 bp, 475 aa] {ON} YGR212W
           (REAL)
          Length = 475

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 6/64 (9%)

Query: 124 LRHIFDKNKFETAKHKPLWQILIV--DETMVIFHGHDVLFDIFAAANFHKLFQQALNQLP 181
           + HIF ++ F  ++HKPLW+ILI+     M++   H VL D  +A +  + F + L    
Sbjct: 103 INHIFQEHNFPYSEHKPLWKILIIPSQNQMLLMTDH-VLMDGMSAVHVWETFMEGLQ--- 158

Query: 182 KDGP 185
           K GP
Sbjct: 159 KQGP 162

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 436 EVNNV--TEFQFHVDDNATFNIKDVCFTKSQNLETFMSLSCAFSERSGLNVCIHYPD 490
           EV N+    F+   D N  F+I +  F + Q +   ++LS   +   GLN CI YP+
Sbjct: 400 EVTNLGLQAFKNACDTNLPFHIVNATFNEPQGISAIITLSVISTPAGGLNCCISYPN 456

>Smik_16.94 Chr16 complement(178129..179529) [1401 bp, 466 aa] {ON}
           YGR212W (REAL)
          Length = 466

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 84/399 (21%), Positives = 161/399 (40%), Gaps = 78/399 (19%)

Query: 124 LRHIFDKNKFETAKHKPLWQILIV--DETMVIFHGHDVLFDIFAAANFHKLFQQALN-QL 180
           + +IF    F  ++HKPLW++LI+     M++   H VL D  +A +  + F + L  Q 
Sbjct: 95  INYIFQNYNFSYSEHKPLWKLLIIPNQNQMLLLTDH-VLMDGISAVHVWETFMEGLQEQQ 153

Query: 181 PKDGPTLECLFKNDSKASFFPKSIYEN-------HKLRLPAIATDLFQLQTQSFF---KS 230
            ++  T+     +     F    +Y +       H +R   +A+ L+    Q      KS
Sbjct: 154 LRENETVYSPVLSPLNEEFILAPVYGDWPIPWNWHVIR--QLASRLYYWFPQIIVSNNKS 211

Query: 231 VY---NWTIKKPLDFINTNPNSGLKYYQ----SCYTDILLGANNLCGTTVFGNISAERVC 283
           +    N+T   P D +  NP +    Y+    +C+ +  L                    
Sbjct: 212 LIQFANYTF--PKDLLEDNPINESHTYKVKNTNCHWEFQLSP-----------------A 252

Query: 284 ALKKIMKQENICLSSFVCAIALLCLKPL----VNNF-GSSVTFSIPVDLRSTIPQASRFG 338
            LK I+++  I  +S    +  L  K      V+++ GS +   +P++ RS+  Q  +  
Sbjct: 253 HLKTILQECKIHNTSLTSLLGALVCKSFEETAVHDYTGSFLKIELPMNTRSSCKQILKLP 312

Query: 339 ----LCYKNVLVECPLTLIDDKVFQGLNVYN-GYDIRNTKPTNKDPNYEESLLEYQFREA 393
               L   N++          K+ +GL +++    I+ T  ++      + + E +  E 
Sbjct: 313 SNDELAVGNLIAAIEF---KHKLHRGLGIWDISAQIQETIKSSTKDKVIDRVNEVKLLEV 369

Query: 394 CTHVDNTLKQRWRAWERSGFNDDDIKRMKFGKTEQGKSKRIIEVNNV--TEFQFHVDDNA 451
            +                 F +D   R+ F     G S    E+ N+   +F+   + + 
Sbjct: 370 IS--------------SQQFIED---RINFNN---GPSST-FEITNLGFQDFKNACNTSL 408

Query: 452 TFNIKDVCFTKSQNLETFMSLSCAFSERSGLNVCIHYPD 490
            F+IKD  F + Q++ +  +LS   +  +GL+ CI YP+
Sbjct: 409 RFHIKDAIFNEPQSISSIFTLSVISTPANGLHCCISYPN 447

>ZYRO0F01540g Chr6 complement(124663..126075) [1413 bp, 470 aa] {ON}
           similar to uniprot|P53304 Saccharomyces cerevisiae
           YGR212W SLI1 N-acetyltransferase confers resistance to
           the sphingolipid biosynthesis inhibitor myriocin (ISP-1)
           by inactivating it co-operates with Ypk1p in mediating
           resistance to myriocin converts myriocin into N-acetyl-
           myriocin
          Length = 470

 Score = 38.1 bits (87), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 61/132 (46%), Gaps = 20/132 (15%)

Query: 56  DQRLSNSLVSRALKKVINNNVELYTTIN-DNLEFQPVKTIM-----FDDVVQKVEFDSYK 109
           +Q  S + +  ALK  I+  ++L   +  D  + +P   I+       DVV+ V++  + 
Sbjct: 34  NQLPSRTQIQHALKSTIDTFIQLRCNVGIDEEDGKPYLKIIDQSLELKDVVEFVDWAKFD 93

Query: 110 DELVNCHDGVPPYLLRHIFDKNKFETAKHKPLWQILIV--DETMVIFHGHDVLFDIFAAA 167
           ++ +N           ++F    F     KPLW++L++  +  +V+   H VLFD  A  
Sbjct: 94  EDKMN-----------YVFQNYAFPYHTEKPLWKVLVIPNERKLVLLMSH-VLFDGMAGV 141

Query: 168 NFHKLFQQALNQ 179
              + F + LNQ
Sbjct: 142 IILQEFLKNLNQ 153

>YGR212W Chr7 (917040..918446) [1407 bp, 468 aa] {ON}
           SLI1N-acetyltransferase, confers resistance to the
           sphingolipid biosynthesis inhibitor myriocin (ISP-1) by
           converting it into N-acetyl-myriocin, co-operates with
           Ypk1p in mediating resistance to myriocin
          Length = 468

 Score = 33.9 bits (76), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 124 LRHIFDKNKFETAKHKPLWQILIV--DETMVIFHGHDVLFDIFAAANFHKLFQQAL 177
           + HIF +  F   ++KPLW+ILI+     M++   H VL D  +A +  + F + L
Sbjct: 95  INHIFQRYNFSYNENKPLWKILILPNQNQMLLLTDH-VLMDGMSAIHVWETFMEGL 149

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%)

Query: 453 FNIKDVCFTKSQNLETFMSLSCAFSERSGLNVCIHYPD 490
           F I D  F + Q + +  SLS   +  +GL+ CI YP+
Sbjct: 411 FYIVDATFNEPQGISSIFSLSVISTPGNGLHCCISYPN 448

>TDEL0A03110 Chr1 complement(554890..555492) [603 bp, 200 aa] {ON}
           Anc_2.536 YMR073C
          Length = 200

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 42/88 (47%), Gaps = 9/88 (10%)

Query: 95  MFDDVVQKVEFDSYKDELVNCHDGVPPYLLRHIFDKNKFETAKHKPLWQILIVDETMVI- 153
           +  + ++K++  ++   L+    GVPPYL+R + + ++    KHK L     V +  V  
Sbjct: 90  LLSEDMEKLQQLNHPHTLIQLQRGVPPYLIRPLLNIDRELLQKHKTLDDCWCVIKGRVYC 149

Query: 154 ------FH--GHDVLFDIFAAANFHKLF 173
                 FH  G D+LF   A  +  ++F
Sbjct: 150 LTYYFDFHPGGVDILFKTCAGKDGTEMF 177

>Ecym_4206 Chr4 (426316..431949) [5634 bp, 1877 aa] {ON} similar to
           Ashbya gossypii AGL147C
          Length = 1877

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 43/104 (41%), Gaps = 23/104 (22%)

Query: 311 LVNNFGSSVTFSIPV----------DLRSTIPQASRFGLCYKNVLVECPLTLIDDKVFQG 360
           L++N  S+    IPV          DL+++     R+ L     L   P TLI+      
Sbjct: 519 LISNLRSAFRREIPVFLTEIYFPISDLKTSTSHQKRYFLSIIQRLCNDPRTLIE------ 572

Query: 361 LNVYNGYDIRNTKPTNKDPNYEESLLEYQFREACTHVDNTLKQR 404
              Y  YD  +  P     N  ES+++Y  R A T VD T  QR
Sbjct: 573 --FYLNYDCASNMP-----NVMESIVDYLTRLALTRVDITPSQR 609

>Ecym_2483 Chr2 (946645..948030) [1386 bp, 461 aa] {ON} similar to
           Ashbya gossypii ACL138C
          Length = 461

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 50/120 (41%), Gaps = 17/120 (14%)

Query: 67  ALKKVINNNVELYTTI----NDNLEFQPVKT-IMFDDVVQKVEFDSYKDELVNCHDGVPP 121
            LK++I  +  LY  I          +P+   I  DDV+++  FDS  +   N       
Sbjct: 41  VLKELIPKHPHLYRNIFTKDGSKKLVRPLNVEIRLDDVLEETGFDSLDESAANS------ 94

Query: 122 YLLRHIFDKNKFETAKHKPLWQILIVDE-TMVIFHGHDVLFDIFAAANFHKLFQQALNQL 180
                I   + F+  + +PLW+++ +   T  +F      FD  +A  F   F  ALN +
Sbjct: 95  -----ILKNSTFQYDQQRPLWKLISLKAGTQFLFCFDHAFFDGMSAVIFWNDFISALNSI 149

>TDEL0E05410 Chr5 complement(989327..990406) [1080 bp, 359 aa] {ON}
           Anc_6.232 YPL215W
          Length = 359

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 29/68 (42%), Gaps = 9/68 (13%)

Query: 195 SKASFFPKSIYENHKLRLPAIATDLFQLQTQSFFKSVYNWTIKKPLDFINTNPNSGLKYY 254
           +K   +PKS YE+   +LP     L +L  ++F         K  +D +   P +G  YY
Sbjct: 95  AKGKVYPKSKYESKSYQLPKWKEALGELVIRTF---------KLDMDKVRAGPVAGFYYY 145

Query: 255 QSCYTDIL 262
             C    L
Sbjct: 146 SLCKEQAL 153

>KAFR0G03810 Chr7 complement(786690..787784) [1095 bp, 364 aa] {ON} 
            Added 3 N bases too fix an intragenic STOP codon that
           can't fix with reads.
          Length = 364

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 13/54 (24%), Positives = 31/54 (57%), Gaps = 4/54 (7%)

Query: 30  MFAAVYSTCFDKEETWSDNATLLTVKDQRLSNSLVSRALKKVINNNVELYTTIN 83
           +F   Y+  FDK++ W +N+ +L +     +++ VS  L ++  N++++ T + 
Sbjct: 144 VFGTAYAVLFDKKQKWDENSKILVIG----ASTSVSNCLVQIAKNHLKIGTIVG 193

>KAFR0B04980 Chr2 complement(1034527..1035621) [1095 bp, 364 aa]
           {ON} Anc_2.373 YMR152W
          Length = 364

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 12/55 (21%), Positives = 33/55 (60%), Gaps = 4/55 (7%)

Query: 29  LMFAAVYSTCFDKEETWSDNATLLTVKDQRLSNSLVSRALKKVINNNVELYTTIN 83
           L+F + Y+  F +++ W++N+ +L +     +++ VS  L ++  N++++ T + 
Sbjct: 142 LVFGSAYAVLFHRKQKWTENSKILVIG----ASTSVSNCLAQIAKNHLKVGTVVG 192

>KAFR0B04110 Chr2 (850702..852126) [1425 bp, 474 aa] {ON} Anc_5.119
           YGR212W
          Length = 474

 Score = 30.8 bits (68), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 47/230 (20%), Positives = 87/230 (37%), Gaps = 45/230 (19%)

Query: 124 LRHIFDKNKFETAKHKPLWQILIVDETMVIFHGHD-VLFDIFAAANFHKLFQQALNQLP- 181
           +  IF    F   K   LW+IL++     +    D  L+D  +   F ++F  +L +   
Sbjct: 99  INDIFQNYDFNYGKESFLWKILVIPSQNQLLLLLDHALYDGNSGVKFWEVFMTSLREAKC 158

Query: 182 -KDGPTLECLFKNDSKASFFPKSIYENHKL-RLPAIATDLFQLQTQSFFKSVYNWTIKKP 239
             +    EC+FK D    F    + E H   + P                  ++W +KK 
Sbjct: 159 NVEEQEDECIFKGDKSTDF----VLEPHPYDKWPG----------------TWSWAVKKV 198

Query: 240 L---------DFINTNPNSGLKYYQSCYTDILLGANNLCGTTVFGN---------ISAER 281
           L           I    +  +++    + D LL      G     N         ++ E 
Sbjct: 199 LAKMLFSASPKMITKIDSKFMQFKDYPFVDKLLEKPPKNGRKYQVNNDNLQWQFRLTPES 258

Query: 282 VCALKKIMKQENICLSSFVCAIALLCLKPLVNN---FGSSVTFSIPVDLR 328
           +  + +  K+  + L+S++ A+ ++ L+ +  N    G SV  SIP++ R
Sbjct: 259 LKKMLESCKKNRVSLTSYLVALFIMSLREINENKLCGGPSVNVSIPMNTR 308

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,946,494
Number of extensions: 2883604
Number of successful extensions: 8245
Number of sequences better than 10.0: 54
Number of HSP's gapped: 8430
Number of HSP's successfully gapped: 59
Length of query: 511
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 397
Effective length of database: 40,409,475
Effective search space: 16042561575
Effective search space used: 16042561575
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 68 (30.8 bits)