Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E00770g6.7ON1047104746340.0
Ecym_30096.7ON1027105122400.0
Kwal_56.223346.7ON1008104321140.0
KLTH0C11594g6.7ON1006105320480.0
KLLA0D00792g6.7ON102071916120.0
ACR020C6.7ON100271016000.0
NCAS0F001806.7ON101873215150.0
Kpol_1045.806.7ON101972114880.0
Skud_5.346.7ON101974514740.0
KAFR0L003306.7ON102873614460.0
Suva_5.136.7ON102373814410.0
Smik_5.326.7ON102073514340.0
YEL055C (POL5)6.7ON102273414320.0
ZYRO0F00440g6.7ON103972814291e-180
TDEL0G046406.7ON101772314161e-178
NDAI0K029106.7ON106375413741e-172
TPHA0J002506.7ON102472513221e-165
KNAG0E009706.7ON100473013121e-163
CAGL0B03553g6.7ON102172511371e-138
TBLA0A072106.7ON104174510931e-131
Smik_8.2565.63ON823134840.29
SAKL0C05698g1.190ON115574772.3
YJR066W (TOR1)1.515ON247071763.2
YPR189W (SKI3)7.546ON143283744.9
SAKL0F05984g3.426ON122777736.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E00770g
         (1047 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E00770g Chr5 (53894..57037) [3144 bp, 1047 aa] {ON} similar...  1789   0.0  
Ecym_3009 Chr3 (18017..21100) [3084 bp, 1027 aa] {ON} similar to...   867   0.0  
Kwal_56.22334 s56 (53478..56504) [3027 bp, 1008 aa] {ON} YEL055C...   818   0.0  
KLTH0C11594g Chr3 complement(952163..955183) [3021 bp, 1006 aa] ...   793   0.0  
KLLA0D00792g Chr4 (73422..76484) [3063 bp, 1020 aa] {ON} similar...   625   0.0  
ACR020C Chr3 complement(391573..394581) [3009 bp, 1002 aa] {ON} ...   620   0.0  
NCAS0F00180 Chr6 (25742..28798) [3057 bp, 1018 aa] {ON} Anc_6.7 ...   588   0.0  
Kpol_1045.80 s1045 complement(186944..190003) [3060 bp, 1019 aa]...   577   0.0  
Skud_5.34 Chr5 complement(47480..50539) [3060 bp, 1019 aa] {ON} ...   572   0.0  
KAFR0L00330 Chr12 complement(57677..60763) [3087 bp, 1028 aa] {O...   561   0.0  
Suva_5.13 Chr5 complement(24593..27664) [3072 bp, 1023 aa] {ON} ...   559   0.0  
Smik_5.32 Chr5 complement(50787..53849) [3063 bp, 1020 aa] {ON} ...   556   0.0  
YEL055C Chr5 complement(48471..51539) [3069 bp, 1022 aa] {ON}  P...   556   0.0  
ZYRO0F00440g Chr6 (42723..45842) [3120 bp, 1039 aa] {ON} similar...   555   e-180
TDEL0G04640 Chr7 complement(845491..848544) [3054 bp, 1017 aa] {...   550   e-178
NDAI0K02910 Chr11 complement(658930..662121) [3192 bp, 1063 aa] ...   533   e-172
TPHA0J00250 Chr10 (55997..59071) [3075 bp, 1024 aa] {ON} Anc_6.7...   513   e-165
KNAG0E00970 Chr5 (183126..186140) [3015 bp, 1004 aa] {ON} Anc_6....   509   e-163
CAGL0B03553g Chr2 (354365..357430) [3066 bp, 1021 aa] {ON} simil...   442   e-138
TBLA0A07210 Chr1 (1796426..1799551) [3126 bp, 1041 aa] {ON} Anc_...   425   e-131
Smik_8.256 Chr8 (425373..427844) [2472 bp, 823 aa] {ON} YHR172W ...    37   0.29 
SAKL0C05698g Chr3 complement(539308..542775) [3468 bp, 1155 aa] ...    34   2.3  
YJR066W Chr10 (559416..566828) [7413 bp, 2470 aa] {ON}  TOR1PIK-...    34   3.2  
YPR189W Chr16 (912664..916962) [4299 bp, 1432 aa] {ON}  SKI3Ski ...    33   4.9  
SAKL0F05984g Chr6 (448144..451827) [3684 bp, 1227 aa] {ON} highl...    33   6.1  

>SAKL0E00770g Chr5 (53894..57037) [3144 bp, 1047 aa] {ON} similar to
            uniprot|P39985 Saccharomyces cerevisiae YEL055C
          Length = 1047

 Score = 1789 bits (4634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 917/1047 (87%), Positives = 917/1047 (87%)

Query: 1    MVEKINRDLFYKLASDLQEERVQAAISLIKELASLENNDSEWEYVLNRLIKGLSSNRNSA 60
            MVEKINRDLFYKLASDLQEERVQAAISLIKELASLENNDSEWEYVLNRLIKGLSSNRNSA
Sbjct: 1    MVEKINRDLFYKLASDLQEERVQAAISLIKELASLENNDSEWEYVLNRLIKGLSSNRNSA 60

Query: 61   RLGFSLCLTEVLSVALEKGYLNSIEEYIQLLQSTLLKETVKNGKEERGLLFGRMFGLQAL 120
            RLGFSLCLTEVLSVALEKGYLNSIEEYIQLLQSTLLKETVKNGKEERGLLFGRMFGLQAL
Sbjct: 61   RLGFSLCLTEVLSVALEKGYLNSIEEYIQLLQSTLLKETVKNGKEERGLLFGRMFGLQAL 120

Query: 121  LNEPLLSKIFLDKTGGLNAHFMVNFMGELVQVALSKTWIREPCLFTLFQVVEKLSPFLND 180
            LNEPLLSKIFLDKTGGLNAHFMVNFMGELVQVALSKTWIREPCLFTLFQVVEKLSPFLND
Sbjct: 121  LNEPLLSKIFLDKTGGLNAHFMVNFMGELVQVALSKTWIREPCLFTLFQVVEKLSPFLND 180

Query: 181  TVCIESIFKLLDDNKLSLTNEGLAIYLFLIHLCPGTSKFIKKSGLLKNLELNSQWKNNDP 240
            TVCIESIFKLLDDNKLSLTNEGLAIYLFLIHLCPGTSKFIKKSGLLKNLELNSQWKNNDP
Sbjct: 181  TVCIESIFKLLDDNKLSLTNEGLAIYLFLIHLCPGTSKFIKKSGLLKNLELNSQWKNNDP 240

Query: 241  LTKGNLPTLSAVLKDVSPVEDSGLKQKGSWAPRLHFVWNIILPILARDDQNEGSSDEHIT 300
            LTKGNLPTLSAVLKDVSPVEDSGLKQKGSWAPRLHFVWNIILPILARDDQNEGSSDEHIT
Sbjct: 241  LTKGNLPTLSAVLKDVSPVEDSGLKQKGSWAPRLHFVWNIILPILARDDQNEGSSDEHIT 300

Query: 301  KKRKKEKAKDVQVKMIEFPEFWKAVVDESFFNEKSSGERKYLGFLILEAAFKQVPLSLVS 360
            KKRKKEKAKDVQVKMIEFPEFWKAVVDESFFNEKSSGERKYLGFLILEAAFKQVPLSLVS
Sbjct: 301  KKRKKEKAKDVQVKMIEFPEFWKAVVDESFFNEKSSGERKYLGFLILEAAFKQVPLSLVS 360

Query: 361  LLFSKNLMRTLINQSSDSKRILHKISQKVLASILELCESHPDKTVPSIQAMLFSENGTIN 420
            LLFSKNLMRTLINQSSDSKRILHKISQKVLASILELCESHPDKTVPSIQAMLFSENGTIN
Sbjct: 361  LLFSKNLMRTLINQSSDSKRILHKISQKVLASILELCESHPDKTVPSIQAMLFSENGTIN 420

Query: 421  FDKLTKTKTVDLLVANPSMTPKHLSSLVDLFVSHLPDDPNEEAALTRFLLDSMLHVVRTH 480
            FDKLTKTKTVDLLVANPSMTPKHLSSLVDLFVSHLPDDPNEEAALTRFLLDSMLHVVRTH
Sbjct: 421  FDKLTKTKTVDLLVANPSMTPKHLSSLVDLFVSHLPDDPNEEAALTRFLLDSMLHVVRTH 480

Query: 481  KTVSDKTWVKPLITSVISMGFFKTSPAKVDQENQDDDHTDGFEFQARERLYSILADLIPL 540
            KTVSDKTWVKPLITSVISMGFFKTSPAKVDQENQDDDHTDGFEFQARERLYSILADLIPL
Sbjct: 481  KTVSDKTWVKPLITSVISMGFFKTSPAKVDQENQDDDHTDGFEFQARERLYSILADLIPL 540

Query: 541  SKQSIHSASWPYITLQVLLSQEQSKELIHPLDDGLNKIKLDALNDLEGIRRELENDPSAS 600
            SKQSIHSASWPYITLQVLLSQEQSKELIHPLDDGLNKIKLDALNDLEGIRRELENDPSAS
Sbjct: 541  SKQSIHSASWPYITLQVLLSQEQSKELIHPLDDGLNKIKLDALNDLEGIRRELENDPSAS 600

Query: 601  QFYGLELLLSMTVLQIYGGDTESLSVLEDLVTFYHSMRDSSEENSLIGVIEIXXXXXXXX 660
            QFYGLELLLSMTVLQIYGGDTESLSVLEDLVTFYHSMRDSSEENSLIGVIEI        
Sbjct: 601  QFYGLELLLSMTVLQIYGGDTESLSVLEDLVTFYHSMRDSSEENSLIGVIEILLALLAQK 660

Query: 661  XXXXXXXXXXVWELFVDKVGTPELEVLFDILSARENKEGFTALFXXXXXXXXXXXXXXXX 720
                      VWELFVDKVGTPELEVLFDILSARENKEGFTALF                
Sbjct: 661  KALLRRLSLLVWELFVDKVGTPELEVLFDILSARENKEGFTALFEAEDDYMDEEDDEEAS 720

Query: 721  XXXXXXXXNASDTVNSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDQSEDNDYSNEDIN 780
                    NASDTVNS                             DDQSEDNDYSNEDIN
Sbjct: 721  QAQGEEGENASDTVNSGEEEEEEEEEEEEEEEEEEEGEEEEEEEGDDQSEDNDYSNEDIN 780

Query: 781  KIDKETTSALAKALNLPDGIINENGEVNFNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 840
            KIDKETTSALAKALNLPDGIINENGEVNFN                              
Sbjct: 781  KIDKETTSALAKALNLPDGIINENGEVNFNELSESDDEDESEEDEDEESMDDEKMMELDD 840

Query: 841  QLSQIFQRRKEALSKISTGNKRKLEAKESRENVIAFKHKVVDMLEVFVKFVERTSKNKEC 900
            QLSQIFQRRKEALSKISTGNKRKLEAKESRENVIAFKHKVVDMLEVFVKFVERTSKNKEC
Sbjct: 841  QLSQIFQRRKEALSKISTGNKRKLEAKESRENVIAFKHKVVDMLEVFVKFVERTSKNKEC 900

Query: 901  GETELKSVTSMFQPLIKCVQQTTDKALADKLSKLIKNRMCKLKLPKLINDSDDIEELTIS 960
            GETELKSVTSMFQPLIKCVQQTTDKALADKLSKLIKNRMCKLKLPKLINDSDDIEELTIS
Sbjct: 901  GETELKSVTSMFQPLIKCVQQTTDKALADKLSKLIKNRMCKLKLPKLINDSDDIEELTIS 960

Query: 961  NLGAVHRLMLADKCGQFPNLYFSTCXXXXXXXXXXXXQASTNDSIYDRLIDIYLSTMXXX 1020
            NLGAVHRLMLADKCGQFPNLYFSTC            QASTNDSIYDRLIDIYLSTM   
Sbjct: 961  NLGAVHRLMLADKCGQFPNLYFSTCSVVSLFLSKLLVQASTNDSIYDRLIDIYLSTMKKW 1020

Query: 1021 XXXXXXXXXXXXXXINWLASKKQTSSK 1047
                          INWLASKKQTSSK
Sbjct: 1021 FSKGKFGTSFFFDFINWLASKKQTSSK 1047

>Ecym_3009 Chr3 (18017..21100) [3084 bp, 1027 aa] {ON} similar to
            Ashbya gossypii ACR020C
          Length = 1027

 Score =  867 bits (2240), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/1051 (45%), Positives = 663/1051 (63%), Gaps = 37/1051 (3%)

Query: 2    VEKINRDLFYKLASDLQEERVQAAISLIKELASL--ENNDSEWEYVLNRLIKGLSSNRNS 59
            ++++NRDLFY+LASD++EERV+AA+ ++ EL+ +  ++N+ EW+YVL RLIKGL+S R  
Sbjct: 1    MKQVNRDLFYRLASDIEEERVKAAVGIVNELSEIVEQDNEQEWQYVLGRLIKGLASARQG 60

Query: 60   ARLGFSLCLTEVLSVALEKGYLNSIEEYIQLLQSTLLKETVKNGKEERGLLFGRMFGLQA 119
            ARLGFS+CL+EV+++ LEKG L S+E YI  L   L    VKNGKEERGL+FG++FGLQA
Sbjct: 61   ARLGFSMCLSEVVTLGLEKGRLESVEVYIGQLFEKLADGHVKNGKEERGLVFGKLFGLQA 120

Query: 120  LLNEPLLSKIFLDKTGGLNAHFMVNFMGELVQVALSKTWIREPCLFTLFQVVEKLSPFLN 179
            LLNEPL  +IF+D    ++  F V FM  LV++ALSKTW+REPCLFTL+Q++EKLS    
Sbjct: 121  LLNEPLFGRIFMDGKV-IDLQFTVLFMDHLVKLALSKTWLREPCLFTLYQLIEKLSSKFT 179

Query: 180  DTVCIESIFKLLDDNKLSLTNEGLAIYLFLIHLCPGTSKFIKKSGLLKNLELNSQWKNND 239
            +   +E+IFKLLD +KL+LTNEGLAIYL LI+ C  T   + KS +L  + L S WKNND
Sbjct: 180  EVGHLEAIFKLLDHHKLTLTNEGLAIYLLLIYECVETKSLLIKSKILSKITLRSCWKNND 239

Query: 240  PLTKGNLPTLSAVLKDVSPVEDSGLKQKGSWAPRLHFVWNIILPILARDDQNEGSSDEHI 299
            PL+KGN+  LS+VLKD+ PVED+ +KQKGSWAPRLHFVW+I++PIL R  +  G++ EH+
Sbjct: 240  PLSKGNVTILSSVLKDIIPVEDNVMKQKGSWAPRLHFVWDILIPILCRQQEIPGAA-EHV 298

Query: 300  TKKRKKEKAKDVQ-VKM-IEFPEFWKAVVDESFFNEKSSGERKYLGFLILEAAFKQVPLS 357
             KKRK +K   ++ V+  + F EFW+ VVDESFFN K+S ERKYLG LI+E A + VP S
Sbjct: 299  PKKRKTDKKDKIEKVRAPLSFSEFWQVVVDESFFNAKASSERKYLGLLIIEKAMQCVPSS 358

Query: 358  LVSLLFSKNLMRTLINQSSDSKRILHKISQKVLASILELCESHPDKTVPSIQAMLFSENG 417
             V  +FSKN+MRTLINQSS+S R LHKIS  VL +I+ +CES P K +P + ++ F  NG
Sbjct: 359  YVPSIFSKNIMRTLINQSSESTRNLHKISTNVLKNIVSICESDPTKVLPVVNSLWFGPNG 418

Query: 418  TINFDKLTKTKTVDLLVANPSMTPKHLSSLVDLFVSHLPDDPNEEAALTRFLLDSMLHVV 477
            +INFD LTK+KT+D ++A   +  +HL+SLV L VS + D  +   +  R+LLD +LH+V
Sbjct: 419  SINFDILTKSKTMDSIIAVQGLKSEHLASLVALIVSEI-DKESSPVSKVRYLLDILLHIV 477

Query: 478  RTHKTVSDKTWVKPLITSVISMGFFKTSPAKVDQENQDDDHTDGFEFQ-----ARERLYS 532
            + HK  +D  W KPL++S++ + FF    +  +  + D       E +     +RERL+S
Sbjct: 478  QAHKLKADMFWTKPLLSSIVKLSFFNDKLSDFEDVDLDAHADADAESKKIPVLSRERLFS 537

Query: 533  ILADLIPLSKQSIHSASWPYITLQVLLSQEQSKELIHPLDDGLNKIKLDALNDLEGIRRE 592
            IL  LIP SKQ++   +WPY+TLQ+++++E  + LI  LD+ L + K  AL  +  IR++
Sbjct: 538  ILGQLIPTSKQNVDGPTWPYVTLQIVIAEEHRRSLIFKLDEELQQTKEHALKAINDIRKK 597

Query: 593  LENDPSASQFYGLELLLSMTVLQIYGGDTESLSVLEDLVTFYHSMRDSSEENSLIGVIEI 652
             +  P AS+  GLELLL +T+LQ+Y GD ES S+LE+L TFY S+   ++ N L+G+ EI
Sbjct: 598  SQESPQASELCGLELLLGVTILQMYSGDAESASILEELTTFYKSI--DTKPNGLVGITEI 655

Query: 653  XXXXXXXXXXXXXXXXXXVWELFVDKVGTPELEVLFDILSARENKEGFTALFXXXXXXXX 712
                              VWE  +DK+   EL +LFDILS RENK+GF ALF        
Sbjct: 656  LLSMVAQKKAVLRRLTLIVWESLIDKIEGDELNLLFDILSVRENKQGFAALFEAADEYVE 715

Query: 713  XXXXXXXXXXXXXXXXNASDTVNSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDQSEDN 772
                               D +N                              ++ S +N
Sbjct: 716  VD----------------DDEINEDVDISHENCDSSDHNDSHSSSYFEECGSNEEDSGNN 759

Query: 773  DYSNEDINKIDKETTSALAKALNLPDGIINENGEVNFNXXXXXXXXXXXXXXXXXXXXXX 832
             Y NE I+KI+KETTSALA AL LP+ +I+ENG+V F                       
Sbjct: 760  GY-NEYIDKINKETTSALADALKLPENMIDENGDVGFE-----DFDDGDEEEEEEESMDD 813

Query: 833  XXXXXXXXQLSQIFQRRKEALSKISTGNKRKLEAKESRENVIAFKHKVVDMLEVFVKFVE 892
                    QLS+IF+RRKEALSK+ TGNKRKLE +ESRE+VI+FKH+V+DMLE++ K+V 
Sbjct: 814  EAMMELDGQLSEIFKRRKEALSKVPTGNKRKLEVRESRESVISFKHRVLDMLEIYCKYVV 873

Query: 893  R-TSKNKECGETELKSVTSMFQPLIKCVQQTTDKALADKLSKLIKNRMCKLKLPKLINDS 951
            R   K+++C  ++L ++ SM  PL+KC+QQT D+ LA+K +KL+KN +CKLKL       
Sbjct: 874  RLAGKSQQCEASKLLNIHSMIDPLLKCIQQTIDRPLAEKAAKLLKNHICKLKLEPFKGCV 933

Query: 952  DDIEELTISNLGAVHRLMLADKCGQFPNLYFSTCXXXXXXXXXXXXQASTNDSIYDRLID 1011
            D++ E+   +L  +H  MLA K GQF  LYF  C                ++  Y+R+ID
Sbjct: 934  DEVSEIVFLSLENIHNSMLAKKPGQFQQLYFGACSTSSLFLGKILVVTKPDEVTYNRIID 993

Query: 1012 IYLSTMXXXXXXXXXXXXXXXXXINWLASKK 1042
            IY  ++                 INWLASK+
Sbjct: 994  IYSQSIKNWTVKGKFGPNFFIDFINWLASKR 1024

>Kwal_56.22334 s56 (53478..56504) [3027 bp, 1008 aa] {ON} YEL055C
            (POL5) - DNA polymerase V [contig 186] FULL
          Length = 1008

 Score =  818 bits (2114), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/1043 (44%), Positives = 631/1043 (60%), Gaps = 46/1043 (4%)

Query: 4    KINRDLFYKLASDLQEERVQAAISLIKELASLENNDSEWEYVLNRLIKGLSSNRNSARLG 63
            +INRDLFYKLASDL EER+QA I L+ +L+ LE + SEW+YVL+RLIKGLSS+RN ARLG
Sbjct: 5    EINRDLFYKLASDLSEERLQATIDLVTQLSKLEKDSSEWQYVLDRLIKGLSSSRNGARLG 64

Query: 64   FSLCLTEVLSVALEKGYLNSIEEYIQLLQSTLLKETVKNGKEERGLLFGRMFGLQALLNE 123
            FSLCLTEV+++ALEKG L  +++Y+ LL S L KE VKNGKEERGLLFG++FGLQ LLNE
Sbjct: 65   FSLCLTEVVALALEKGVLARVDQYMHLLISALSKENVKNGKEERGLLFGKLFGLQVLLNE 124

Query: 124  PLLSKIFLDKTGGLNAHFMVNFMGELVQVALSKTWIREPCLFTLFQVVEKLSPFLNDTVC 183
            PL SK+F      LN   M ++M  L+ +AL+KTWIRE  LFTLFQ VEKL+P L     
Sbjct: 125  PLFSKVFTPDENQLNVELMSSYMSYLIDIALAKTWIRESSLFTLFQAVEKLAPLLGSRQP 184

Query: 184  IESIFKLLDDNKLSLTNEGLAIYLFLIHLCPGTSKFIKKSGLLKNLELNSQWKNNDPLTK 243
            ++++ +LLD   L+ T+EGLAIYLFL+H C  T   ++K G L  L L + WKNNDPL +
Sbjct: 185  LKAVLELLDSKGLTQTSEGLAIYLFLLHRCSHTGPVLRKKGFLDELNLKNPWKNNDPLKR 244

Query: 244  GNLPTLSAVLKDVSPVEDSGLKQKGSWAPRLHFVWNIILPILARDDQNEGSSDEHITKKR 303
            GNLP +S  LKD    +D  L QKG WAPRLHF W+I+L  L   + +E ++     +  
Sbjct: 245  GNLPAISNALKDSGARDDPSLTQKGVWAPRLHFAWDIVLQTLLHAENSEITT----MQPP 300

Query: 304  KKEKAKDVQVKMIEFPEFWKAVVDESFFNEKSSGERKYLGFLILEAAFKQVPLSLVSLLF 363
             K++ K+ +   I+FPEFWK+VVDESFFNEKSS ERKYLG L+ E  F+  P   +  LF
Sbjct: 301  SKKRKKEEKEAFIKFPEFWKSVVDESFFNEKSSSERKYLGILVFEKTFQLSPPRYLPQLF 360

Query: 364  SKNLMRTLINQSSDSKRILHKISQKVLASILELCESHPDKTVPSIQAMLFSENGTINFDK 423
            SKNL+R LINQ   ++R LHKISQK LA+I+E+C++ P+KT PS   + F E GTINFD 
Sbjct: 361  SKNLIRCLINQCGSAERNLHKISQKALATIVEVCKAQPEKTAPSFVGLSFGEYGTINFDH 420

Query: 424  LTKTKTVDLLVANPSMTPKHLSSLVDLFVSHLPDDPNEEAALTRFLLDSMLHVVRTHKTV 483
            LTKTKTV+ L++N S+    L  L +  +S+L  +  +E +  RF+LD++LH+VR HK  
Sbjct: 421  LTKTKTVNSLLSNKSLRSDDLMILEESLISNLFGNL-KELSRARFILDAILHLVRAHKAH 479

Query: 484  SDKTWVKPLITSVISMGFFKTSPAKVDQENQDDDHTDGFEFQARERLYSILADLIPLSKQ 543
            +D+ W+KP++ +++ +GFF+ S  K  +++Q+  H+      A ERL+SILADL+ + +Q
Sbjct: 480  ADEVWLKPVLKALVCLGFFQQSELKDVKDSQESFHS--LSSIASERLFSILADLLTV-EQ 536

Query: 544  SIHSASWPYITLQVLLSQEQSKELIHPLDDGLNKIKLDALNDLEGIRRELENDPSASQFY 603
              +S  WP+I +Q+L +    K L+  +D+ L  I   ++  L  I ++  N+ + SQF 
Sbjct: 537  DTYSVCWPFIAVQLLKTDTNQKTLLQSMDEELGDILDSSMTVLSSISQK-ANEANLSQFQ 595

Query: 604  GLELLLSMTVLQIYGGDTESLSVLEDLVTFYHSMRDSSEENSLIGVIEIXXXXXXXXXXX 663
            GL+LL S+ +LQ Y G+ ES+SVLEDLV+F +   D ++   L G IEI           
Sbjct: 596  GLQLLFSVNILQAYAGEVESISVLEDLVSFCNEFEDGAKSAPLAGFIEILLSLAAQKKAL 655

Query: 664  XXXXXXXVWELFVDKVGTPELEVLFDILSARENKEGFTALFXXXXXXXXXXXXXXXXXXX 723
                    WE FV  V   +L VL ++L  RENKEGF+ LF                   
Sbjct: 656  SRKSSLLAWESFVADVTEKDLTVLLNVLPTRENKEGFSNLFEGGSESEGDSEEDEEMNDE 715

Query: 724  XXXXXNASDTVNSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDQSEDNDYSNEDINKID 783
                 +ASD                                 ++ SED+  S++D+ KID
Sbjct: 716  EEPEKDASDD--------------------------EIEESDNNVSEDDSSSDDDMGKID 749

Query: 784  KETTSALAKALNLPDGIINENGEVNFNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLS 843
            KE TSALAKALNLPD I+++ GEV F                               QLS
Sbjct: 750  KEATSALAKALNLPDSIVDDKGEVRFE----DLGDTDEEEEESEEDLDDEKMMELDGQLS 805

Query: 844  QIFQRRKEALSKISTGNKRKLEAKESRENVIAFKHKVVDMLEVFVKFVERTSKNKECGET 903
            +IF+RRKEALSKI TGNKRK E KESRENVIAFKH+VVDMLE+ V+++E  SK K+ G  
Sbjct: 806  EIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEILVRWIE--SKMKKDGHI 863

Query: 904  E---LKSVTSMFQPLIKCVQQTTDKALADKLSKLIKNRMCKLKLPKLINDSDDIE-ELTI 959
            E   L  V ++  PL+ C++ T DK LA+K++KL+KN++CKLK P   + ++ ++ +  +
Sbjct: 864  EKSVLDKVFAIILPLLDCIRTTLDKPLAEKIAKLLKNKICKLK-PSFSSTTEKVDKKAVL 922

Query: 960  SNLGAVHRLMLADKCGQFPNLYFSTCXXXXXXXXXXXXQASTNDSIYDRLIDIYLSTMXX 1019
            S L +VH  ML  K GQF  LYFS C                    Y+ L  IY  T+  
Sbjct: 923  SLLRSVHEAMLVKKAGQFQTLYFSGCSTTSMFLARLVVDTFPELETYEELTGIYHKTLDG 982

Query: 1020 XXXXXXXXXXXXXXXINWLASKK 1042
                           +NWL+ KK
Sbjct: 983  WFVTGKFGVSMFVEFLNWLSVKK 1005

>KLTH0C11594g Chr3 complement(952163..955183) [3021 bp, 1006 aa] {ON}
            similar to uniprot|P39985 Saccharomyces cerevisiae
            YEL055C
          Length = 1006

 Score =  793 bits (2048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/1053 (44%), Positives = 636/1053 (60%), Gaps = 56/1053 (5%)

Query: 1    MVEKINRDLFYKLASDLQEERVQAAISLIKELASLENNDSEWEYVLNRLIKGLSSNRNSA 60
            +  +++RDLFYKLASDL EER+QA I L+ +L+ +E    EWEYVLNRLIKGLSS+RN A
Sbjct: 2    VAAEVDRDLFYKLASDLSEERLQAIIGLVTQLSKVEKESREWEYVLNRLIKGLSSSRNGA 61

Query: 61   RLGFSLCLTEVLSVALEKGYLNSIEEYIQLLQSTLLKETVKNGKEERGLLFGRMFGLQAL 120
            RLG+ LCLTEV++ ALEK  L   +EY++LL STL +E +KNGKEERG+LFG++FGLQ L
Sbjct: 62   RLGYCLCLTEVVASALEKSVLAHADEYLRLLLSTLSRENIKNGKEERGILFGKLFGLQVL 121

Query: 121  LNEPLLSKIFLDKTGGLNAHFMVNFMGELVQVALSKTWIREPCLFTLFQVVEKLSPFLND 180
            LNEPL S++F      +N  FM+ ++G L+ VAL+KTWIRE  +FTL+Q +EKLSP +  
Sbjct: 122  LNEPLFSQVF-KAEDEINLEFMLTYVGTLIDVALAKTWIRESSMFTLYQAIEKLSPVMGS 180

Query: 181  TVCIESIFKLLDDNKLSLTNEGLAIYLFLIHLCPGTSKFIKKSGLLKNLELNSQWKNNDP 240
               ++++  LLD   L+ T+EGLA+YL+L H    T+  ++K GLL++L+LNS WKNNDP
Sbjct: 181  QKPLKALLTLLDSRGLTQTSEGLAVYLYLFHKSFITTGALRKKGLLEDLKLNSPWKNNDP 240

Query: 241  LTKGNLPTLSAVLKDVSPVEDSGLKQKGSWAPRLHFVWNIILPILARDDQNEGSSDEHIT 300
            L+KGNLP ++  LK+++  ED  +KQKG W PRLHFVW+IIL       + E  + E   
Sbjct: 241  LSKGNLPAIANALKEINSSEDLSVKQKGIWMPRLHFVWDIILTSFFEGGEYEDKASEPAK 300

Query: 301  KKRKKEKAKDVQVKMIEFPEFWKAVVDESFFNEKSSGERKYLGFLILEAAFKQVPLSLVS 360
            KKRKK   +  Q   I+FPEFWK+VVDESFFNEKSS ERKYLGFL+ E AF   P+S   
Sbjct: 301  KKRKKSSEERHQ--QIKFPEFWKSVVDESFFNEKSSSERKYLGFLVFEKAFSLAPVSYTH 358

Query: 361  LLFSKNLMRTLINQSSDSKRILHKISQKVLASILELCESHPDKTVPSIQAMLFSENGTIN 420
             L SKNL R LINQ   S+R LHK+SQ+VL +I+++C++ P+KT PS + +   E+G+I+
Sbjct: 359  TLLSKNLTRCLINQCGSSERNLHKVSQRVLTTIVDVCKNQPEKTAPSFETLALKEHGSIS 418

Query: 421  FDKLTKTKTVDLLVANPSMTPKHLSSLVDLFVSHLPDDPNEEAALTRFLLDSMLHVVRTH 480
            FD+LTK+KT++LL++  S+T + L+ L ++  +HL     + + + RFLLD+MLH+VR H
Sbjct: 419  FDQLTKSKTLNLLLSGKSLTDQQLTLLGEVLTNHLFTSLRDHSRV-RFLLDAMLHLVRAH 477

Query: 481  KTVSDKTWVKPLITSVISMGFFKTSPAKVDQENQDDDHTDGFEFQARERLYSILADLIPL 540
            K+ +DK W+ PL+ S++  GFF+    + D++ +  D T      A ERLYSILADLI  
Sbjct: 478  KSAADKVWLAPLLDSLVQQGFFELD--ENDRQPEVGDETFTVSKLAVERLYSILADLISA 535

Query: 541  SKQSIHSASWPYITLQVLLSQEQSKELIHPLDDGLNKIKLDALNDLEGIRRELENDPSAS 600
              +S     WP  T+++L+S+ +  +L++P+D+ L +I   ++   + I  E E      
Sbjct: 536  DYKS-EKVCWPRFTVEILMSKLKKNKLLNPMDEELTEILNSSIKTFKTICSEAEKGGKQM 594

Query: 601  QFYGLELLLSMTVLQIYGGDTESLSVLEDLVTFYHSMRDSSEENSLIGVIEIXXXXXXXX 660
            Q  G +L+ S+ +LQ Y G+T+S+ VL+DL +F+ ++ + ++  S  G IEI        
Sbjct: 595  QARGFQLIFSVNILQAYSGETDSIPVLQDLNSFHQTLEE-NKSGSYAGFIEILLSLAAQK 653

Query: 661  XXXXXXXXXXVWELFVDKVGTPELEVLFDILSARENKEGFTALFXXXXXXXXXXXXXXXX 720
                      VWELFV +    ++ VL +IL ARENKEGF+ LF                
Sbjct: 654  KALLRKASLLVWELFVGEASQDDIAVLLEILPARENKEGFSKLF---------------- 697

Query: 721  XXXXXXXXNASDTVNSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDQSEDNDYSNEDIN 780
                       D   S                             DDQ        ED  
Sbjct: 698  --------EGDDEGGSDEEEISDELFAEEGASGDNTEEEESGPDSDDQ------DGEDTE 743

Query: 781  KIDKETTSALAKALNLPDGIINENGEVNFNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 840
            +IDKE TSAL KALNLP+ I+N+NGEV+F                               
Sbjct: 744  QIDKEATSALVKALNLPESIVNDNGEVHFE-----DLEDTEDEEISDEDLDDEKMMELDG 798

Query: 841  QLSQIFQRRKEALSKISTGNKRKLEAKESRENVIAFKHKVVDMLEVFVKFVERTSKNKEC 900
            QLS+IF+RRKEALSKI TGNKRK E KESRENVIAFKH+VVDMLE+FV++ E  S+ K+ 
Sbjct: 799  QLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEIFVRWAE--SELKQG 856

Query: 901  GETELKSVTS----MFQPLIKCVQQTTDKALADKLSKLIKNRMCKLKLPKLINDS--DDI 954
            G  E KSVTS    +  PLI CV+ T DK LA+K++KL+KN++CKL   K+  D+  D +
Sbjct: 857  GRPE-KSVTSKIISIILPLISCVRTTLDKPLAEKVTKLLKNKICKL---KITTDTSLDGL 912

Query: 955  EELTISN-LGAVHRLMLADKCGQFPNLYFSTCXXXXXXXXXXXXQASTNDSIYDRLIDIY 1013
            EE    N L +VH  ML  KCGQF NLYFS C              S     Y  L ++Y
Sbjct: 913  EENLFENSLKSVHEAMLLKKCGQFQNLYFSACSTASMFLAKLFVHRSPRPETYFTLTEVY 972

Query: 1014 LSTMXXXXXXXXXXXXXXXXXINWLASKKQTSS 1046
              T+                 +NWL+ KKQ +S
Sbjct: 973  HKTLNEWFVGGKFSANLFIEFLNWLSIKKQQNS 1005

>KLLA0D00792g Chr4 (73422..76484) [3063 bp, 1020 aa] {ON} similar to
           uniprot|P39985 Saccharomyces cerevisiae YEL055C
          Length = 1020

 Score =  625 bits (1612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/719 (47%), Positives = 471/719 (65%), Gaps = 38/719 (5%)

Query: 1   MVEKINRDLFYKLASDLQEERVQAAISLIKELASLENNDSE-----WEYVLNRLIKGLSS 55
           +V ++NRDLF+K+AS+L++ER++AAI LI E++ ++  +SE     WEYV+ RL+KGL+S
Sbjct: 6   VVSRVNRDLFFKVASELEKERLEAAIQLINEISRVDTRESEDGVREWEYVIGRLVKGLAS 65

Query: 56  NRNSARLGFSLCLTEVLSVALEK-GYLNSIEEYIQLLQSTLLKETV-KNGKEERGLLFGR 113
           NR  ARLGFS+CLTEV+++ALE+   L SI  ++  L+ TL   T  KNGKEERG+LFG+
Sbjct: 66  NRGGARLGFSMCLTEVIALALERRDILPSIYAFLNQLEQTLPAGTAFKNGKEERGVLFGQ 125

Query: 114 MFGLQALLNEPLLSKIFLDKT-GGLNAHFMVNFMGELVQVALSKTWIREPCLFTLFQVVE 172
           MF LQ+LLNEP+ SK+FL      +N  F++ ++ +L+Q+ALSKTW+REPCL++++Q ++
Sbjct: 126 MFALQSLLNEPVFSKLFLSTDDNSINMEFLLTYLNKLIQLALSKTWLREPCLYSVYQTIQ 185

Query: 173 KL-SPFLNDTVCIESIFKLLDDNKLSLTNEGLAIYLFLIHLCPGTSKFIKKSGLLKNLEL 231
           K  +   ND   I  I  LLD+ KL+LTNEGL+IYL          +    S L+ +   
Sbjct: 186 KCETRLFNDPTAINLILGLLDEKKLTLTNEGLSIYLMF-----NAQRDTYSSSLVIH--- 237

Query: 232 NSQWKNNDPLTKGNLPTLSAVLKDVSPVEDSGLKQKGSWAPRLHFVWNIILPILARDDQN 291
           NS WKNNDPL+KGN+  L++VLKDV PVE S LKQKG+WAPRLH+VW+I+LP+L  D   
Sbjct: 238 NSGWKNNDPLSKGNVQLLASVLKDVVPVEKSDLKQKGTWAPRLHYVWDILLPLLEDDGSF 297

Query: 292 EGSSDEHITKKRKKEKAK--DVQVKMIEFPEFWKAVVDESFFNEKSSGERKYLGFLILEA 349
             S + HI+KKRKK  A     +   I+FP+FW+AVVDESFFNEKSS ERKYLGFLILE 
Sbjct: 298 GQSMESHISKKRKKNTASMSSERTGRIQFPDFWQAVVDESFFNEKSSNERKYLGFLILEE 357

Query: 350 AFKQVPLSLVSLLFSKNLMRTLINQSSDSKRILHKISQKVLASILELCESHPDKTVPSIQ 409
           A K     L+ +L S+NL+R +INQS DS+R+L+KIS + L SI+  CE  P K VP ++
Sbjct: 358 AIKVCSPKLIQVLLSQNLLRCIINQSQDSQRMLNKISTQALKSIVAECERSPAKVVPLVE 417

Query: 410 AMLFSENGTINFDKLTKTKTVDLLVANPSMTPKHLSSLVDLFVSHLPDDPNEEAA--LTR 467
              F  NG+INFDKL K+K V+ L++  S+  +HL  LV+L +S LP D + + +  LTR
Sbjct: 418 VFWFGRNGSINFDKLIKSKLVNSLISTSSLEKEHLVDLVNLLISQLPQDQSTKDSFNLTR 477

Query: 468 FLLDSMLHVVRTHKTVSDKTWVKPLITSVISMGFFKTSPAKVDQENQDDDHTDGFEFQAR 527
           F+ D+ LH+ R HKT  +  WVKPL++++I   FF  S           D++   E  A+
Sbjct: 478 FIFDTFLHITRAHKTRLESHWVKPLLSAIIKAAFFNES-----------DNSKLSEL-AK 525

Query: 528 ERLYSILADLIP-LSKQSIHSASWPYITLQVLLSQEQSKELIH-PLDDGLNKIKLDALND 585
           ERLYSIL +LI   SK S   ++WPYI LQ++L  E S   +   LD+ L  ++  A+  
Sbjct: 526 ERLYSILGELISEPSKSSGDISTWPYIALQIILKIEGSGSTLSIDLDEDLESVRKSAIKS 585

Query: 586 LEGIRRELENDPSASQFYGLELLLSMTVLQIYGGDTESLSVLEDLVTFYHSMRDSSEENS 645
           L+    + +N+ +  +  GLELLLS+ +LQ+Y GD ES+S+L+DL++FY       E   
Sbjct: 586 LKQNHSDNKNNTNP-KLNGLELLLSVAILQLYAGDEESVSILQDLISFYEEC--DKESTD 642

Query: 646 LIGVIEIXXXXXXXXXXXXXXXXXXVWELFVDKVGTPELEVLFDILSARENKEGFTALF 704
           L+G+ EI                  VWE FV  +G PEL VL   L+ARENK+GF  LF
Sbjct: 643 LVGITEILLSLVAQRKSLLKKLSLIVWESFVHDIGEPELNVLLQTLTARENKQGFADLF 701

 Score =  169 bits (428), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 111/287 (38%), Positives = 153/287 (53%), Gaps = 16/287 (5%)

Query: 767  DQSEDNDYSNED----INKIDKETTSALAKALNLPDGIINENGEV----NFNXXXXXXXX 818
            + SED D S ED    + KI+KE TSALAKALNLPD I+ E+G+V    N          
Sbjct: 737  EDSED-DVSEEDKDAALEKIEKEATSALAKALNLPDSIVGEHGDVQLGNNEEEDSDEDSD 795

Query: 819  XXXXXXXXXXXXXXXXXXXXXXQLSQIFQRRKEALSKISTGNKRKLEAKESRENVIAFKH 878
                                  QLS+IF+RRKEAL  + TGNKRK+E +ESRENVI+FKH
Sbjct: 796  EDDDFSGEDESMDDEAMMQLDDQLSEIFKRRKEALGSVPTGNKRKVEVQESRENVISFKH 855

Query: 879  KVVDMLEVFVKFVERT-SKNKECGET--ELKSVTSMFQPLIKCVQQTTDKALADKLSKLI 935
            +VVDMLE++VK  +R  ++N     T  E  +++S+  PL+KC+Q T DKALADK +KL+
Sbjct: 856  RVVDMLEIYVKSFDRAVARNNTSIITVEEWNNLSSIILPLLKCLQHTLDKALADKCAKLM 915

Query: 936  KNRMCKLKLPKLINDSDDIEELTISNLGAVHRLMLADKCGQFPNLYFSTCXXXXXXXXXX 995
            K R+CK+K   +  +   +       L  VH+L++  K GQF  L+FSTC          
Sbjct: 916  KLRLCKVK-ATIAKEEKTVTSEIFHLLEKVHKLIMTAKPGQFQQLFFSTCSLASLFLSKL 974

Query: 996  XXQASTNDSIYDRLIDIYLSTMXXXXXXXXXXXXXXXXXINWLASKK 1042
               +  +   ++ LID+Y  T                   NWL +K+
Sbjct: 975  YLSSGGS---HENLIDLYADTSKAWMKDGKCTVNFFIDFSNWLQTKR 1018

>ACR020C Chr3 complement(391573..394581) [3009 bp, 1002 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL055C
           (POL5)
          Length = 1002

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/710 (47%), Positives = 470/710 (66%), Gaps = 18/710 (2%)

Query: 1   MVEKINRDLFYKLASDLQEERVQAAISLIKELASL--ENNDSEWEYVLNRLIKGLSSNRN 58
           M  ++NRDLFYKL SDL +ERVQ+AI+LI EL  L  E N  EWEYVL RL++GL+S+  
Sbjct: 1   MARQVNRDLFYKLTSDLSDERVQSAIALITELNELAVEENGKEWEYVLGRLVRGLASSNK 60

Query: 59  SARLGFSLCLTEVLSVALEKGYLNSIEEYIQLLQSTLLKETVKNGKEERGLLFGRMFGLQ 118
           SARLGFSLCLTEV + ALE G++ S EEY++ L++ L  + VKNGKEERG LFGRMFGLQ
Sbjct: 61  SARLGFSLCLTEVAAAALENGHIGSAEEYLERLEAALPVDKVKNGKEERGQLFGRMFGLQ 120

Query: 119 ALLNEPLLSKIFLDKTGGLNAHFMVNFMGELVQVALSKTWIREPCLFTLFQVVEKLSPFL 178
           A+LNEPL S++F+   G +   F   FM  LVQ+AL+K W+R+PCLFTL+QV+E+L+P  
Sbjct: 121 AMLNEPLFSRVFVAGDGQIQQAFAHQFMQRLVQLALTKAWLRQPCLFTLYQVIERLAPRA 180

Query: 179 NDTVCIESIFKLLDDNKLSLTNEGLAIYLFLIHLCPGTSKFIKKSGLLKNLELNSQWKNN 238
            DT  + ++  LLD++ L+ T+EGLAIYLFL + CP   + + ++ +   L L  +WK +
Sbjct: 181 TDTEFLRAVLTLLDEHNLTHTSEGLAIYLFLQNKCPEIKRILDETKIFDALPLVKRWKAD 240

Query: 239 DPLTKGNLPTLSAVLKDVSPVEDSGLKQKGSWAPRLHFVWNIILPILARDDQNEGSSDEH 298
           +PL KGN   L++VLKD + +E  G KQKG W PRLHFVW+++LP+LA   + + S D H
Sbjct: 241 NPLAKGNAKALASVLKDDALIEGDGPKQKGVWTPRLHFVWDLLLPLLA---EEKVSPDTH 297

Query: 299 I---TKKRKKEKAKDVQVKMIEFPEFWKAVVDESFFNEKSSGERKYLGFLILEAAFKQVP 355
           +    K +  +K K  +  M+ F EFW+ VVDESFF+EK+S ERKYLG LI+E A + VP
Sbjct: 298 VHIAKKHKTGKKPKSAESGMLSFGEFWQVVVDESFFSEKASSERKYLGVLIMEKAVRSVP 357

Query: 356 LSLVSLLFSKNLMRTLINQSSDSKRILHKISQKVLASILELCESHPDKTVPSIQAMLFSE 415
            SLV  +FSKN +RTLINQSS++ R LHK+S   L +I+  CE+   K VP + A+ F  
Sbjct: 358 SSLVQDIFSKNALRTLINQSSETTRHLHKLSVNFLKTIVSACETDASKVVPVLTAIWFGP 417

Query: 416 NGTINFDKLTKTKTVDLLVANPSMTPKHLSSLVDLFVSHLPDDPNEEAALTRFLLDSMLH 475
           NGTINFDKLTK+KT D LV   S+T   L+ LV L +  L +  N + +  +F+LD++LH
Sbjct: 418 NGTINFDKLTKSKTTDSLVTAKSLTATELAQLVTLLLQQL-EHENTDISKIKFILDTLLH 476

Query: 476 VVRTHKTVSDKTWVKPLITSVISMGFFKTSPAKVDQENQDDDHTDGFEFQARERLYSILA 535
           V+R HK  +  +W  PL+ +++   FF ++P+ + +++++          +RERL+S+L 
Sbjct: 477 VIRAHKWKAHLSWTNPLLLALVRYAFF-SAPSHLSEQSEE------IITLSRERLFSVLG 529

Query: 536 DLIPLSKQSIHSASWPYITLQVLLSQEQSKELIHPLDDGLNKIKLDALNDLEGIRRELEN 595
           +LIPLSK  + + SW Y TL++LL +++   L   LD  L  +  +AL  L  I  +   
Sbjct: 530 ELIPLSKHDMGAPSWAYATLELLLQEKEKHPLALQLDAELETVTSNALKILRKIINKSTK 589

Query: 596 DPSAS-QFYGLELLLSMTVLQIYGGDTESLSVLEDLVTFYHSMRDSSEENSLIGVIEIXX 654
            P+ + Q +GLELLLS+++LQ++ GD +S S LE+L +FY S    + +N L+G+ EI  
Sbjct: 590 SPNENPQLFGLELLLSVSILQVHAGDVDSASTLEELASFYESATQGA-DNGLVGITEILL 648

Query: 655 XXXXXXXXXXXXXXXXVWELFVDKVGTPELEVLFDILSARENKEGFTALF 704
                           VWE F+DKVG  ELE+L + LSARENK GF  LF
Sbjct: 649 SLVAQKKSMLRKLTLVVWESFIDKVGKEELELLLNTLSARENKAGFAQLF 698

 Score =  205 bits (521), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 118/276 (42%), Positives = 163/276 (59%), Gaps = 10/276 (3%)

Query: 769  SEDNDYSNEDINKIDKETTSALAKALNLPDGIINENGEVNFNXXXXXXXXXXXXXXXXXX 828
            S+  DYS+ED+ KIDKE TSALA AL LPD I++E+G V F                   
Sbjct: 732  SDQEDYSDEDVAKIDKEATSALAHALRLPDNILDEDGNVGFEEMDDEEEEEESMDDEAMM 791

Query: 829  XXXXXXXXXXXXQLSQIFQRRKEALSKISTGNKRKLEAKESRENVIAFKHKVVDMLEVFV 888
                        QLS+IF+RRK+AL+KI TGN+RK+EAKESR++VIAFKH+VVDMLE++ 
Sbjct: 792  ELDG--------QLSEIFKRRKDALNKIPTGNQRKIEAKESRDSVIAFKHRVVDMLEIYC 843

Query: 889  KFVERT-SKNKECGETELKSVTSMFQPLIKCVQQTTDKALADKLSKLIKNRMCKLKLPKL 947
            K VER+ +KNK+   T   ++ SM +P++K +QQT D+ LA+K+SKL+KN +CK+K    
Sbjct: 844  KNVERSVTKNKKLSATMSANMLSMAEPMVKAIQQTLDRPLAEKISKLLKNSVCKMKPAAY 903

Query: 948  INDSDDI-EELTISNLGAVHRLMLADKCGQFPNLYFSTCXXXXXXXXXXXXQASTNDSIY 1006
               + +I EE  +++L  VH  +L+ K GQFP L+FS C                + S  
Sbjct: 904  KEFTSEINEESILTSLENVHATILSPKPGQFPQLFFSACSSTSLFLSKVLIAMKDDPSTS 963

Query: 1007 DRLIDIYLSTMXXXXXXXXXXXXXXXXXINWLASKK 1042
            +++I IY +TM                 INWLASKK
Sbjct: 964  EQVIGIYSTTMKHWNVSGKFGPNFFIDFINWLASKK 999

>NCAS0F00180 Chr6 (25742..28798) [3057 bp, 1018 aa] {ON} Anc_6.7
           YEL055C
          Length = 1018

 Score =  588 bits (1515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/732 (46%), Positives = 458/732 (62%), Gaps = 54/732 (7%)

Query: 1   MVEKINRDLFYKLASDLQEERVQAAISLIKELASL--ENNDSEWEYVLNRLIKGLSSNRN 58
           MV K+NRDLFYKLASDLQEER QAAISL+KEL +L   +   EW YV+NRLIKGL+S+R+
Sbjct: 1   MVTKVNRDLFYKLASDLQEERFQAAISLVKELTNLLLPDETEEWTYVVNRLIKGLASDRS 60

Query: 59  SARLGFSLCLTEVLSVALEKGY-----LNSIEEYIQLLQSTLLKETVKN---------GK 104
           SARLGFSLCLTEV+++AL         L +I++++QLL  TL  +T  N         G+
Sbjct: 61  SARLGFSLCLTEVINLALSMKENAPEGLQTIDDFLQLLSKTLSLDTNANEKGALKKKKGR 120

Query: 105 EERGLLFGRMFGLQALLNEPLLSKIFLDKTGGLN--AHFMVNFMGELVQVALSKTWIREP 162
           +ERGLLFG+MFGLQA+ NEP+ S +FL K  G      F   FM E+V +AL K WI+E 
Sbjct: 121 DERGLLFGKMFGLQAVTNEPVFSSVFLTKKDGKTEITPFAFKFMNEVVDLALKKNWIKES 180

Query: 163 CLFTLFQVVEKLSPFLNDTVCIESIFKLLDDNKLSLTNEGLAIYLFLIHLCPGTSKFIKK 222
           CLFTLFQ ++KL P+ N    + SI  LLD + LSLT+EGLA+YL +++     +K    
Sbjct: 181 CLFTLFQTIQKLLPYANKDTYL-SILSLLDSHNLSLTSEGLAVYLTILYGDTNDNKLDTS 239

Query: 223 SGLLKNLELNSQWKNNDPLTKGNLPTLSAVLKDVSPV------EDSGLKQKGSWAPRLHF 276
           S   KN      WKNNDPL++GNLP L+ VL+D S        E+S  +   +W PRLHF
Sbjct: 240 SIEFKN----PGWKNNDPLSRGNLPLLTEVLRDSSVTQPSEGYENSKKQNASNWNPRLHF 295

Query: 277 VWNIILPILARDDQNEGSSDEHITKKRKKEKAKDVQVKMIEFPEFWKAVVDESFFNEKSS 336
           VW+I+LPIL        S+ +HI+KKRKK   +    K IEFPEFW+ VVDESFFNEK+S
Sbjct: 296 VWDILLPILISGKHTTASNTQHISKKRKKNNNE--LPKHIEFPEFWQMVVDESFFNEKAS 353

Query: 337 GERKYLGFLILEAAFKQVPLSLVSLLFSKNLMRTLINQSSDSKRILHKISQKVLASILEL 396
            ERKYLGFLI     K V  + ++  FS N MR+LINQS+DSKR+LHK+SQ  L +I+E+
Sbjct: 354 SERKYLGFLIFIKTIKVVSQTQLNNCFSHNFMRSLINQSTDSKRLLHKMSQNALNTIIEV 413

Query: 397 C-ESHPDKTVPSIQAMLFSENGTINFDKLTKTKTVDLLVANPSMTPKHLSSLVDLFVSHL 455
           C E   +K V  + AM+F  +G+INFDKLTK+KT+  L++   +  K L+ L DLF S++
Sbjct: 414 CQEDSSNKLVKCVNAMVFGPSGSINFDKLTKSKTISKLISIHPLDVKTLADLFDLFTSNI 473

Query: 456 PDDPNEEAALTRFLLDSMLHVVRTHKT-VSDKTWVKPLITSVISMGFFKTSPAKVDQENQ 514
             + +E     R++LD++LH+VRTHKT +     V PL+  +I   FF        +EN+
Sbjct: 474 -SEKSENKQKNRYVLDTLLHIVRTHKTGLEYDAIVTPLLDPLIQWAFFA-------KENE 525

Query: 515 DDDHTDGFEFQARERLYSILADLIPLSKQSIHSASWPYITLQVLLSQEQSK--ELIHPLD 572
             +        A+ER  SILA+L  +  +  H  SW Y  L ++L +E++   EL++ LD
Sbjct: 526 PLNEL------AKERFSSILAELTSVIPKEPHH-SWQYYALDIILKKERTGKFELVNKLD 578

Query: 573 DGLNKIKLDALNDLEGIRRELENDPSASQFYGLELLLSMTVLQIYGGDTESLSVLEDLVT 632
           + L KIK DA + +  I +     P + Q  GLE LLSM +LQ++ G+TESLS +E+L+ 
Sbjct: 579 ENLGKIKNDACDVIVKIIK----SPQSPQLNGLESLLSMCLLQLFSGETESLSTIEELIE 634

Query: 633 FYHSMRDSSEENSLIGVIEIXXXXXXXXXXXXXXXXXXVWELFVDKVGTPELEVLFDILS 692
           FY   +  +E  SL+G+ EI                  VWE F+  VG  EL +L D+L 
Sbjct: 635 FYKEHKGDTESTSLVGITEILLSLLAQKKAVLRKLSLMVWEQFITNVGKEELNILLDVLK 694

Query: 693 ARENKEGFTALF 704
           ARENK+GF  LF
Sbjct: 695 ARENKQGFAHLF 706

 Score =  174 bits (441), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 106/268 (39%), Positives = 149/268 (55%), Gaps = 7/268 (2%)

Query: 778  DINKIDKETTSALAKALNLPDGIINENGEVNFNXXXXXXXXXXXXXXXXXXXXXXXXXXX 837
            ++N IDKE TSALAKALNLP+ I+N+ GEV+                             
Sbjct: 755  EVNNIDKEATSALAKALNLPENIVNDKGEVDVAKLEALSDSDMDDDDDDSDEESMDDEKM 814

Query: 838  XXX--QLSQIFQRRKEALSKISTGNKRKLEAKESRENVIAFKHKVVDMLEVFVKFVERTS 895
                 QLS+IF+RRKEALS  STGN+RK+EAKESRENVIAFK +VVD+L V+VK+VE+  
Sbjct: 815  MLLDDQLSEIFKRRKEALSTTSTGNQRKIEAKESRENVIAFKSRVVDLLTVYVKYVEKLQ 874

Query: 896  KNKECGETELKSVTSMFQPLIKCVQQTTDKALADKLSKLIKNRMCKLKLPKLINDSDDIE 955
                    +  ++ S  +P++ CVQ+T DK+LADK+SKL+K R+ K+K     N ++ +E
Sbjct: 875  TADHS--QKFVNLISFVEPMVTCVQKTLDKSLADKVSKLLKTRIFKIKSSTFKNSANPVE 932

Query: 956  ELTISNLGAVHRLMLADKCGQFPNLYFSTCXXXXXXXXXXXXQASTNDS-IYDRLIDIYL 1014
             L    L  +H  +L +K GQ P LY++               +ST+++  Y++LID Y 
Sbjct: 933  VLEY--LKKLHEKLLTEKPGQHPQLYYTLSSSASLFFSKIYVASSTDETNAYNKLIDQYS 990

Query: 1015 STMXXXXXXXXXXXXXXXXXINWLASKK 1042
            +T                   NWLAS+K
Sbjct: 991  NTTKSWMSKSKFGPNFFADFFNWLASRK 1018

>Kpol_1045.80 s1045 complement(186944..190003) [3060 bp, 1019 aa]
           {ON} complement(186946..190005) [3060 nt, 1020 aa]
          Length = 1019

 Score =  577 bits (1488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/721 (46%), Positives = 469/721 (65%), Gaps = 57/721 (7%)

Query: 2   VEKINRDLFYKLASDLQEERVQAAISLIKELASLENND--SEWEYVLNRLIKGLSSNRNS 59
           +EK+NRD FYKLASDL EERVQ+A++LIK+L++L+ ++   E+EYVLNRLI GLSSNRNS
Sbjct: 1   MEKVNRDSFYKLASDLPEERVQSAVALIKDLSALKPSEVEKEFEYVLNRLISGLSSNRNS 60

Query: 60  ARLGFSLCLTEVLSVALEK-----GYLNSIEEYIQLLQSTLLKETV------KNGKEERG 108
           ARLGFSLCLTEV+++AL++       L SI++++ ++  TL+ ++V      K GK+ERG
Sbjct: 61  ARLGFSLCLTEVVNLALDRKDQPLTCLRSIDDFLDMVDKTLVLDSVATGKKLKKGKDERG 120

Query: 109 LLFGRMFGLQALLNEPLLSKIFLDKTGGLNAHFMVNFMGELVQVALSKTWIREPCLFTLF 168
           ++FGRMF LQALLNEPL +K+F+DK G + + F + F  +LV++A+ K W+REPCLFTL+
Sbjct: 121 IMFGRMFALQALLNEPLFAKVFIDKNGKI-SKFAIRFQTQLVELAVLKNWLREPCLFTLY 179

Query: 169 QVVEKLSPFLNDTVCIESIFKLLDDNKLSLTNEGLAIYLFLIHLCPGTSKFIKKSGLLKN 228
           Q VEK  P++ D+  IES+ +LLD  KL+LTNEGLAIYL LIH      K I  S     
Sbjct: 180 QTVEKFMPYI-DSSYIESLVQLLDKYKLTLTNEGLAIYLSLIH---TNGKKIASS----- 230

Query: 229 LELNSQ-WKNNDPLTKGNLPTLSAVLKDVSPVEDSGLKQ--KGSWAPRLHFVWNIILPIL 285
           L L SQ WK NDPL KGNLPTL+ VL + S +  S   Q    +W+PRLHFVW+I+LPIL
Sbjct: 231 LPLESQGWKLNDPLAKGNLPTLTQVLLN-SNINQSETPQGNAANWSPRLHFVWDILLPIL 289

Query: 286 ARDDQNEGSSDEHITKKRKKEKAKDVQVKMIEFPEFWKAVVDESFFNEKSSGERKYLGFL 345
               Q+  ++DEH++KK+K +      +K   F  FWK VVDESFFNEKSS ERKYLGFL
Sbjct: 290 L--GQDSTTNDEHVSKKQKSKTTSSTSIK---FQSFWKMVVDESFFNEKSSSERKYLGFL 344

Query: 346 ILEAAFKQVPLSLVSLLFSKNLMRTLINQSSDSKRILHKISQKVLASILELCESHPDKTV 405
           I++ + + VP  LV  LF +N++R++INQS+D+KR+LHKISQKVL SI+E CE    K  
Sbjct: 345 IIQKSLELVPAQLVESLFGQNVLRSMINQSADTKRMLHKISQKVLNSIIEACEKDTTKIT 404

Query: 406 PSIQAMLFSENGTINFDKLTKTKTVDLLVANPSMTPKHLSSLVDLFVSHLPDDPNEEAAL 465
           P ++ +LF ENG  NFDKLTKTKT++ +++  ++  + LS +  + +S+     +E    
Sbjct: 405 PIVKVILFGENGATNFDKLTKTKTINKILSIKNLEEETLSQIF-IMLSNEIKGSSESIQK 463

Query: 466 TRFLLDSMLHVVRTHK-TVSDKTWVKPLITSVISMGFFKTSPAKVDQENQDDDHTDGFEF 524
            +F+LD++LHVVR HK  ++  T +  L+T VI + FF        +EN+   +      
Sbjct: 464 DQFVLDTILHVVRNHKLEMNIGTIIIQLLTPVIDLAFFL-------KENERISNI----- 511

Query: 525 QARERLYSILADLIPLSKQSIHSASWPYITLQVLLSQEQSKE-LIHPLDDGLNKIKLDAL 583
            A+ER +S+L++L  +   +  + SW Y  L+++ ++E S   L   +D  L  IK   +
Sbjct: 512 -AKERFFSLLSELAAI---TTSTRSWQYTALELISNKEASGSPLNQEMDQDLIAIKEKGI 567

Query: 584 NDLEGIRRELENDPSASQFYGLELLLSMTVLQIYGGDTESLSVLEDLVTFYHSMRDSSEE 643
             L    +E+       Q  GLE LLSM++LQ+Y GD +S+S++EDL TFY    D S  
Sbjct: 568 ECL----KEVTKKSDTVQLRGLECLLSMSLLQLYAGDVDSVSIVEDLCTFYDEREDDSV- 622

Query: 644 NSLIGVIEIXXXXXXXXXXXXXXXXXXVWELFVDKVGTPELEVLFDILSARENKEGFTAL 703
            SL+G+ EI                   WE FV  +G  E++VL D+L+ARENKEGF  L
Sbjct: 623 -SLVGITEILLALLAQRKAVLKKIALVAWEQFVPFIGPEEVKVLVDVLNARENKEGFAQL 681

Query: 704 F 704
           F
Sbjct: 682 F 682

 Score =  174 bits (441), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 107/280 (38%), Positives = 151/280 (53%), Gaps = 14/280 (5%)

Query: 781  KIDKETTSALAKALNLPDGIINENGEVNFNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 840
            KI+KETTSALAKALNLPD IINENGEV+ +                              
Sbjct: 738  KINKETTSALAKALNLPDNIINENGEVDLDALEGMSEEENDDDDDDESEEEDDESMDDEK 797

Query: 841  ------QLSQIFQRRKEALSKISTGNKRKLEAKESRENVIAFKHKVVDMLEVFVKFVER- 893
                  QLS+IF+RRKEALS +++GN+RKL+ KESRENVIAFKH+++D+LE ++K+VE+ 
Sbjct: 798  MMELDDQLSEIFKRRKEALSSVASGNQRKLDVKESRENVIAFKHRIIDLLETYIKYVEKI 857

Query: 894  TSKNKE----CGETELKSVTSMFQPLIKCVQQTTDKALADKLSKLIKNRMCKLKLPKLIN 949
            TS+  E      E  L  V  M   +++C+Q T D+ LADK+SKL+K ++ K+ L    N
Sbjct: 858  TSRKLEDQPINKEQLLNCVFMMMNAMVECIQHTLDRPLADKISKLLKVKLFKINLTFFDN 917

Query: 950  DSDDIEELTISNLGAVHRLMLADKCGQFPNLYFSTCXXXXXXXXXXXXQASTNDS---IY 1006
             +   +E  ++ L A+H L++  K GQ  +LYFS C            + +  D     +
Sbjct: 918  GNVSNQESVLTQLKAIHELLITSKPGQHASLYFSVCSTSSLFLSKLLIETTNADERSYAF 977

Query: 1007 DRLIDIYLSTMXXXXXXXXXXXXXXXXXINWLASKKQTSS 1046
             +LIDIY                      NWL SKK +++
Sbjct: 978  SQLIDIYGELSKKWLLKGRFGPIVFMDFYNWLNSKKNSAT 1017

>Skud_5.34 Chr5 complement(47480..50539) [3060 bp, 1019 aa] {ON}
           YEL055C (REAL)
          Length = 1019

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/745 (45%), Positives = 472/745 (63%), Gaps = 84/745 (11%)

Query: 1   MVEKINRDLFYKLASDLQEERVQAAISLIKELASLE--NNDSEWEYVLNRLIKGLSSNRN 58
           M  K+NRDLF+KLASDLQEER+ AA++LIK+L++LE  ++  EW YVLNRLIKGL+S+RN
Sbjct: 1   MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDAEEWSYVLNRLIKGLASDRN 60

Query: 59  SARLGFSLCLTEVLSVALE-------KGYLNSIEEYIQLLQSTL-------LKETVKNGK 104
           SARLGFSLCLTEV+++ +        KG L S  E++  L S L        K+ VK GK
Sbjct: 61  SARLGFSLCLTEVVNLGINMPSGQRPKG-LESKNEFLDTLSSILDIYVNDGSKKPVK-GK 118

Query: 105 EERGLLFGRMFGLQALLNEPLLSKIFLDKTGGLNAHFMVNFMGELVQVALSKTWIREPCL 164
           +ERG+LFG++FGL++LLNEPL S+IF+D     N  F++ FM +L+ +AL K WIREPCL
Sbjct: 119 DERGILFGKLFGLKSLLNEPLFSEIFVDDIKKGNTEFVIRFMEQLIDLALRKNWIREPCL 178

Query: 165 FTLFQVVEKLSPFLNDTVCIESIFKLLDDNKLSLTNEGLAIYLFLIH-----LCPGTSKF 219
           F+LFQ ++ L PF+N++  ++ I  + D   L+LTNEGL+ YL L +     L P T   
Sbjct: 179 FSLFQTIKMLLPFMNESTAVK-ILLIYDKYDLTLTNEGLSTYLVLKYESDESLIPST--- 234

Query: 220 IKKSGLLKNLEL-NSQWKNNDPLTKGNLPTLSAVLKDVSPVEDS------GLKQK-GSWA 271
                    L+L NS WKNNDPL +GNLP L+ VL+D S + D+        KQK  +W 
Sbjct: 235 ---------LDLRNSGWKNNDPLARGNLPLLTKVLRDSSVLPDTNGKLQDAKKQKNANWN 285

Query: 272 PRLHFVWNIILPILARDDQNEGSSDEHITKKRKKEKAKDVQVKMIEFPEFWKAVVDESFF 331
           PRLHFVW+++LP+       +  + EHITKKRKK   K VQ   I+FPEFWK  VDESFF
Sbjct: 286 PRLHFVWDVLLPLFG---SGKLENTEHITKKRKKTSGKKVQ-NSIQFPEFWKMAVDESFF 341

Query: 332 NEKSSGERKYLGFLILEAAFKQVPLSLVSLLFSKNLMRTLINQSSDSKRILHKISQKVLA 391
           NEK+S ERKYLGFLI++A FK VP S +   FS+N+MRTLINQS DS+RIL+KI+Q  L 
Sbjct: 342 NEKASSERKYLGFLIIDATFKTVPGSCIGSCFSQNVMRTLINQSIDSQRILNKIAQITLE 401

Query: 392 SILELCESHP-DKTVPSIQAMLFSENGTINFDKLTKTKTVDLLVANPSMTPKHLSSLVDL 450
           SI++ CE  P  K VP + AMLF  +G+INFDKLTK+  +  L+A   +    L+ L+  
Sbjct: 402 SIVKACEEDPIKKLVPCLNAMLFGPHGSINFDKLTKSNIISKLIAIKELPSAVLAQLISA 461

Query: 451 FVSHLPDDPNEEAALTRFLLDSMLHVVRTHKT-VSDKTWVKPLITSVISMGFFKTSPAKV 509
           F+  L  +   +   T F+LDS+LH++R HK  ++D   +KP++T +I M FFK +    
Sbjct: 462 FLLQL-QEKRGDLPHTHFILDSLLHIIRAHKVEINDVGIIKPVLTPIIHMAFFKHA---- 516

Query: 510 DQENQDDDHTDGFEFQ-----ARERLYSILADLI---PLSKQSIHSASWPYITLQVLLSQ 561
                    TD  EF+     A+ERLYSIL +L     ++ +     SW Y+TL ++L  
Sbjct: 517 ---------TDEQEFEQLHELAKERLYSILGELTINKEVNSEDPQINSWQYLTLNLILDI 567

Query: 562 EQS--KELIHPLDDGLNKIKLDALNDLEGIRRELENDPSASQFYGLELLLSMTVLQIYGG 619
           E+S   +LI+PLD+ L KIK +A++ L  I +      + +Q +GL  LLSM ++Q+Y G
Sbjct: 568 EKSYKADLINPLDESLEKIKNEAISSLAEISKS-----NTTQSWGLSTLLSMCLIQLYAG 622

Query: 620 DTESLSVLEDLVTFYHSMRDSSEENSLIGVIEIXXXXXXXXXXXXXXXXXXVWELFVDKV 679
           +T+S+SV+E+L  F        + NS++G+ EI                  +W+ F++ V
Sbjct: 623 ETDSISVIEELCEF-----TKHDNNSMVGITEILLSFLAQKKALLRKLSLIIWQQFIEDV 677

Query: 680 GTPELEVLFDILSARENKEGFTALF 704
           G  EL++L D+L ARENK+GF  LF
Sbjct: 678 GLEELQILLDVLKARENKQGFAQLF 702

 Score =  179 bits (455), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 108/279 (38%), Positives = 153/279 (54%), Gaps = 11/279 (3%)

Query: 770  EDNDYSNEDINKIDKETTSALAKALNLPDGIINENGEVNFNXXXXXXXXXXXXXXXXXXX 829
            ++ D +NED+  IDKE T AL KAL+LPD I+N+ GEV+ N                   
Sbjct: 741  DEEDEANEDVVNIDKEATGALIKALHLPDNIVNDKGEVDMNQLGGLSDDDDDEDEESMDD 800

Query: 830  XXXXXXXXXXXQLSQIFQRRKEALSKISTGNKRKLEAKESRENVIAFKHKVVDMLEVFVK 889
                       QLS+IF+RRKEALS ISTGN+RK+E KESRENVI+FKH++VDML V+VK
Sbjct: 801  EKMMELDD---QLSEIFKRRKEALSNISTGNQRKVEVKESRENVISFKHRIVDMLTVYVK 857

Query: 890  FVERTS-----KNKECGETELKSVTSMFQPLIKCVQQTTDKALADKLSKLIKNRMCKLKL 944
            + E+ +     +N    E  L  +     P++KC+++T DK LADK+SKL+K ++ K+K 
Sbjct: 858  YCEKLAIANKVENSSNLEGPLSKLVYFIVPMLKCIRETLDKPLADKISKLLKGKIFKIKA 917

Query: 945  PKLINDSDDIEELTISNLGAVHRLMLADKCGQFPNLYFSTCXXXXXXXXXXXXQASTNDS 1004
                    +IE + +  L + H LML  K GQ  +++FS C            +   N++
Sbjct: 918  NTFKILDKNIELMNL--LKSTHELMLTSKPGQHASVFFSACSTSSLFLSKLYFEIGGNNA 975

Query: 1005 IYDRLIDIYLSTMXXXXXXXXXXXXXXXXXINWLASKKQ 1043
            + D LID+Y +T                   NWL+SKKQ
Sbjct: 976  L-DELIDLYAATTKEWMLKGKFSTNVFIDFTNWLSSKKQ 1013

>KAFR0L00330 Chr12 complement(57677..60763) [3087 bp, 1028 aa] {ON}
           Anc_6.7 YEL055C
          Length = 1028

 Score =  561 bits (1446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/736 (45%), Positives = 471/736 (63%), Gaps = 46/736 (6%)

Query: 1   MVEKINRDLFYKLASDLQEERVQAAISLIKELASLE--NNDSEWEYVLNRLIKGLSSNRN 58
           M  K+NRDLFYKLAS+L EER+QAA+S+I+EL++L+  ++  EW YVL RLIKGLSS+R 
Sbjct: 4   MSGKVNRDLFYKLASELGEERLQAAVSIIQELSALKLPDHTEEWNYVLGRLIKGLSSDRT 63

Query: 59  SARLGFSLCLTEVLSVALE---KGY----LNSIEEYIQLLQSTLL-----KETVKN--GK 104
            ARLGFSLCLTEV+++A++   KG     L++I++Y+ +L  TL      K+  K   GK
Sbjct: 64  GARLGFSLCLTEVINLAIDLAGKGVELDSLSNIDQYLTILSETLSIDAGNKQNNKKMKGK 123

Query: 105 EERGLLFGRMFGLQALLNEPLLSKIFLDKTGGLNAHFMVNFMGELVQVALSKTWIREPCL 164
           +ERGLLFG+MFGL+ALLNEPL SK FL     + ++F   FM EL+ +A  K WIREPCL
Sbjct: 124 DERGLLFGKMFGLKALLNEPLFSKTFL-PNKKVASNFCERFMVELLDLASRKNWIREPCL 182

Query: 165 FTLFQVVEKLSPFLNDTVCIESIFKLLDDNKLSLTNEGLAIYLFLIHLCPGTSK-FIKKS 223
           FTLFQ VEKL PF  D   I+ +  LLDD+K +LTNEGLAIYL L+H  P   K F  K 
Sbjct: 183 FTLFQTVEKLLPFA-DFEFIKIVLGLLDDHKFTLTNEGLAIYLLLLHKGPEKGKEFNDKI 241

Query: 224 GLLKNLELNSQWKNNDPLTKGNLPTLSAVLKDVSPVEDSGLKQ--KGSWAPRLHFVWNII 281
            LL  +  NS WK NDPL +GNLP L+ VL++ S   +    +    +W PRLHFVW+I+
Sbjct: 242 KLL--VLKNSSWKLNDPLARGNLPRLTQVLRESSLASEEKKVEVMSANWQPRLHFVWDIL 299

Query: 282 LPILARDDQNEGSSDEHITKKRKKEKAKDVQVKMIEFPEFWKAVVDESFFNEKSSGERKY 341
           LP ++  + N  S ++H++K+RKK K  +     I FPEFW+  VDESFFNEK+S ERKY
Sbjct: 300 LPTVSTIESN--SDEKHMSKRRKKNKGPETNT-YIRFPEFWQMTVDESFFNEKASSERKY 356

Query: 342 LGFLILEAAFKQVPLSLVS-LLFSKNLMRTLINQSSDSKRILHKISQKVLASILELCESH 400
           LGF I E A   V   L S   FS+N MR+LINQSSD+ R+LHKIS +V+ +I++ CE  
Sbjct: 357 LGFSIFERAISIVQNPLHSETCFSQNFMRSLINQSSDASRLLHKISTRVMNTIVKACEES 416

Query: 401 PD-KTVPSIQAMLFSENGTINFDKLTKTKTVDLLVANPSMTPKHLSSLVDLFVSHLPDDP 459
           P  K +P I ++LF+ NG+ NFDKLTK+KTV  L++   +T   L  L D+  S +    
Sbjct: 417 PSTKLIPVIHSILFATNGSTNFDKLTKSKTVSKLISITGLTLHTLLQLFDMLTSQIKVGT 476

Query: 460 NEEAALTRFLLDSMLHVVRTHK-------TVSDKT--WVKPLITSVISMGFFKTSPAKVD 510
           +E+   T+F+LDS+LH+VR+HK       T S +T   +K  I  ++ + FF    A+ D
Sbjct: 477 SEDFKKTQFILDSLLHIVRSHKQDIFDSCTGSTETELIIKHAIAPLVRLAFF----AQTD 532

Query: 511 QENQDDDHTDGFEFQARERLYSILADLIPLSKQSIHSASWPYITLQVLLSQEQS--KELI 568
              ++D+  +  +  A+ERL+S+L++L   + + +H  SW Y TL  ++ +E      LI
Sbjct: 533 IAKKEDESDNQVDELAKERLFSVLSELTTTTNKQLH--SWQYYTLLEIIDRENENPNSLI 590

Query: 569 HPLDDGLNKIKLDALNDLEGIRRELENDPSASQFYGLELLLSMTVLQIYGGDTESLSVLE 628
           + +DD L  ++ +A+  ++GI  + E   S+ +  GLE LLSM +LQ+Y GD +S++ +E
Sbjct: 591 NKMDDDLKTVRDNAIKVIKGIASKNEKTTSSGE-RGLESLLSMCLLQLYSGDADSVATIE 649

Query: 629 DLVTFYHSMRDSSEENSLIGVIEIXXXXXXXXXXXXXXXXXXVWELFVDKVGTPELEVLF 688
           +L+TFY++ RD  E+ +++G+ EI                  VWE FV ++    L +L 
Sbjct: 650 ELITFYNASRDVEEKRTMVGITEILLSLLAQKKAVLKKLSLLVWEQFVSEIDEDVLNLLL 709

Query: 689 DILSARENKEGFTALF 704
           D+L ARENK+GF  LF
Sbjct: 710 DVLPARENKQGFAELF 725

 Score =  175 bits (444), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 110/275 (40%), Positives = 149/275 (54%), Gaps = 25/275 (9%)

Query: 776  NEDINKIDKETTSALAKALNLPDGIINENGEVNFNXXXXXXXXXXXXXXXXXXXXXXXXX 835
            NE I KIDKE TSALAKALNLPD IINENGEVNF+                         
Sbjct: 772  NEAIAKIDKEATSALAKALNLPDDIINENGEVNFDDLSDGSDISSDEESLDDEKMMELDD 831

Query: 836  XXXXXQLSQIFQRRKEALSKISTGNKRKLEAKESRENVIAFKHKVVDMLEVFVKFVERTS 895
                 QL++IF+RRKEALS +STGN+RK+E KESRE+VIAFKH+V D+L +++K  E + 
Sbjct: 832  -----QLAEIFKRRKEALSSVSTGNQRKIEVKESRESVIAFKHRVFDLLSIYIKHAEDS- 885

Query: 896  KNKECGETELKSVTSMFQPLIKCVQQTTDKALADKLSKLIKNRMCKLKLPKLINDSDDIE 955
                  E   K      +P++KCVQQT DK+LADK+SKL+K ++ KLK       + ++E
Sbjct: 886  ------ELPAKYAILFIEPMMKCVQQTLDKSLADKISKLLKTKVYKLK-------TKNME 932

Query: 956  ELT----ISNLGAVHRLMLADKCGQFPNLYFSTCXXXXXXXXXXXXQASTN-DSIYDRLI 1010
            E+T      ++ +VH  +L  K GQ+   ++S C              S + +  Y +++
Sbjct: 933  EITAEQVFDHMTSVHETLLTSKPGQYQPTFYSLCSSTSIFLSKLLLLVSNDKEEAYGKIV 992

Query: 1011 DIYLSTMXXXXXXXXXXXXXXXXXI-NWLASKKQT 1044
            DIY  T                    NWL+SKK T
Sbjct: 993  DIYSETTKKWVLKDSKFGSNIFIDFYNWLSSKKST 1027

>Suva_5.13 Chr5 complement(24593..27664) [3072 bp, 1023 aa] {ON}
           YEL055C (REAL)
          Length = 1023

 Score =  559 bits (1441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/738 (44%), Positives = 466/738 (63%), Gaps = 71/738 (9%)

Query: 1   MVEKINRDLFYKLASDLQEERVQAAISLIKELASLE--NNDSEWEYVLNRLIKGLSSNRN 58
           M  K+NRDLF+KLASDLQEER+ AA++LIK+L++LE  ++  EW YVLNRLIKGL+S+RN
Sbjct: 1   MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDSEEWSYVLNRLIKGLASDRN 60

Query: 59  SARLGFSLCLTEVLSVALE-------KGYLNSIEEYIQLLQSTL---LKETVKN---GKE 105
           SARLGFSLCLTEV+++A+        KG L S+ +++  L   L   + ET K    GK+
Sbjct: 61  SARLGFSLCLTEVINLAMNMPSGQRPKG-LESMNDFLDTLSFILDINVNETGKKPVKGKD 119

Query: 106 ERGLLFGRMFGLQALLNEPLLSKIFLDKTGGLNAHFMVNFMGELVQVALSKTWIREPCLF 165
           ERG+LFG++FGL++LLNEPL S IF++     N  F++ FM +L+ +AL K WI+EPCL+
Sbjct: 120 ERGILFGKLFGLKSLLNEPLFSGIFVEDLKRGNTEFIIRFMEQLIDLALRKNWIKEPCLY 179

Query: 166 TLFQVVEKLSPFLNDTVCIESIFKLLDDNKLSLTNEGLAIYLFLIH-----LCPGTSKFI 220
           +LFQ ++ L P +N++   E I    D   L+LTNEGL+ YL L +     L P T    
Sbjct: 180 SLFQTIKMLLPTMNESTAAE-ILLTYDKYDLTLTNEGLSTYLLLKYESDKDLVPSTLG-- 236

Query: 221 KKSGLLKNLELNSQWKNNDPLTKGNLPTLSAVLKD--VSP-----VEDSGLKQKGS-WAP 272
                LKNL     WKNNDPL +GNLP L+ VL+D  V+P      +D+  KQK + W P
Sbjct: 237 -----LKNL----GWKNNDPLARGNLPLLTKVLRDSAVAPDTNGKAQDNTKKQKNTNWNP 287

Query: 273 RLHFVWNIILPILARDDQNEGSSDEHITKKRKKEKAKDVQVKMIEFPEFWKAVVDESFFN 332
           RLHFVWNI+LP+       +  + EHI+KKRKK   K V    I+FPEFW+  VDESFFN
Sbjct: 288 RLHFVWNILLPLFG---SGKLENAEHISKKRKKTSNKKVPSS-IQFPEFWQMAVDESFFN 343

Query: 333 EKSSGERKYLGFLILEAAFKQVPLSLVSLLFSKNLMRTLINQSSDSKRILHKISQKVLAS 392
           EK+S ERKYLGFLI++A FK VP S +   FS+N+MRTLINQS DS+RIL+KI+Q  L S
Sbjct: 344 EKASSERKYLGFLIIDATFKTVPGSCIGYCFSRNVMRTLINQSIDSQRILNKIAQITLDS 403

Query: 393 ILELCESHP-DKTVPSIQAMLFSENGTINFDKLTKTKTVDLLVANPSMTPKHLSSLVDLF 451
           I++ CE  P +K VP + AMLF  +G+INFDKLTKT     L+A   +    L+ L +LF
Sbjct: 404 IIKACEEDPVNKLVPCLSAMLFGPHGSINFDKLTKTSITSKLIAIKELPATVLNQLFNLF 463

Query: 452 VSHLPDDPNEEAALTRFLLDSMLHVVRTHKT-VSDKTWVKPLITSVISMGFFKTSPAKVD 510
           V  L  +  ++   T F+LDS+LH++R HK  ++D   +KP+++ ++ M FFK +     
Sbjct: 464 VLQL-QEKKDDLPHTHFVLDSLLHIIRAHKAEINDVEIIKPVLSPIVYMAFFKHA----- 517

Query: 511 QENQDDDHTDGFEFQARERLYSILADLI---PLSKQSIHSASWPYITLQVLLSQEQSK-- 565
               DD  ++     A+ERLYSIL +L     +  +     SW ++TL+++L  E+S   
Sbjct: 518 ---TDDKESEQLHELAKERLYSILGELTINKEMRSEDPQINSWQFLTLRLILDMEKSHKG 574

Query: 566 ELIHPLDDGLNKIKLDALNDLEGIRRELENDPSASQFYGLELLLSMTVLQIYGGDTESLS 625
           +L +PLD+GL K K +A++ L  I +      + SQ +GL  LLSM ++Q+Y G+T+S+S
Sbjct: 575 DLTNPLDEGLEKTKNEAISSLTEISKS-----NTSQSWGLSTLLSMCLIQLYAGETDSIS 629

Query: 626 VLEDLVTFYHSMRDSSEENSLIGVIEIXXXXXXXXXXXXXXXXXXVWELFVDKVGTPELE 685
           V+E+L  F        E +S++G+ EI                  +W+ F+  VG  EL+
Sbjct: 630 VIEELCEFA-----KDENSSMVGITEILLSLLAQKKALLKKLSLIIWQQFIGDVGLKELQ 684

Query: 686 VLFDILSARENKEGFTAL 703
           +L D+L  RENK+GF  L
Sbjct: 685 ILLDVLKTRENKQGFALL 702

 Score =  173 bits (438), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 110/273 (40%), Positives = 148/273 (54%), Gaps = 11/273 (4%)

Query: 782  IDKETTSALAKALNLPDGIINENGEVNFNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX- 840
            IDKE TSAL KALNLPD I+N+ GEV+ +                               
Sbjct: 754  IDKEATSALIKALNLPDNIVNDKGEVDMDQLEGISDDGDGGDDDEDEESMDDEKMMELDD 813

Query: 841  QLSQIFQRRKEALSKISTGNKRKLEAKESRENVIAFKHKVVDMLEVFVKFVERTS-KNK- 898
            QLS+IF+RRKEALS ISTGN+RK+E KESRENVIAFKH++VDML ++VK  E+ +  NK 
Sbjct: 814  QLSEIFKRRKEALSSISTGNQRKVEVKESRENVIAFKHRIVDMLTIYVKHCEKLAIANKG 873

Query: 899  ----ECGETELKSVTSMFQPLIKCVQQTTDKALADKLSKLIKNRMCKLKLPKLINDSDDI 954
                E G   L ++     P+IKC+++T D+ LADK+SKL+K ++ K++     +    I
Sbjct: 874  ELSIEIG-GPLSNLVYFIIPMIKCIKETLDRPLADKISKLLKGKIFKIRTSAFKDLDKTI 932

Query: 955  EELTISNLGAVHRLMLADKCGQFPNLYFSTCXXXXXXXXXXXXQASTNDSIYDRLIDIYL 1014
            E L +  L + H+ ML  K GQ  N++FS C              + ND  +D LID+Y 
Sbjct: 933  ELLDL--LKSAHKEMLTSKPGQHANVFFSACSTSSLFLSKLYVDINGNDK-FDDLIDLYA 989

Query: 1015 STMXXXXXXXXXXXXXXXXXINWLASKKQTSSK 1047
            ST                  INWL+SKK+   K
Sbjct: 990  STTKQWTQKGKFGANIFIDFINWLSSKKEGVEK 1022

>Smik_5.32 Chr5 complement(50787..53849) [3063 bp, 1020 aa] {ON}
           YEL055C (REAL)
          Length = 1020

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/735 (44%), Positives = 466/735 (63%), Gaps = 66/735 (8%)

Query: 1   MVEKINRDLFYKLASDLQEERVQAAISLIKELASLE--NNDSEWEYVLNRLIKGLSSNRN 58
           M  K+NRDLF+KLASDLQEER+ AA++LI++L++L   ++  EW YVLNRL+KGL+S+RN
Sbjct: 1   MTGKVNRDLFFKLASDLQEERLHAAVALIEDLSALNLPSDAEEWLYVLNRLVKGLASDRN 60

Query: 59  SARLGFSLCLTEVLSVALE-------KGYLNSIEEYIQLLQSTL-------LKETVKNGK 104
           SARLGFSLCLTEV+++A+        KG L S  +++  L S L        K++VK GK
Sbjct: 61  SARLGFSLCLTEVINLAINMPSGQRPKG-LESTNDFLNTLSSVLDVNVNDGGKKSVK-GK 118

Query: 105 EERGLLFGRMFGLQALLNEPLLSKIFLDKTGGLNAHFMVNFMGELVQVALSKTWIREPCL 164
           +ERG+LFG++FGL++LLNEPL S+IF+      N  F + F  EL+ +AL K WI+EPC 
Sbjct: 119 DERGILFGKLFGLKSLLNEPLFSEIFIKNFENGNTDFFIRFTEELIDLALKKNWIKEPCF 178

Query: 165 FTLFQVVEKLSPFLNDTVCIESIFKLLDDNKLSLTNEGLAIYLFLIHLCPGTSKFIKKSG 224
           FTLFQ ++ L PF+++++  + I  + D   ++LTNEGL+ YL L +   G    I  + 
Sbjct: 179 FTLFQTIKMLLPFIDESIAAK-ILLIYDKYNMTLTNEGLSTYLLLKY--GGDKNLIPSTL 235

Query: 225 LLKNLELNSQWKNNDPLTKGNLPTLSAVLKDVSPVEDSGLKQKGS-------WAPRLHFV 277
            LKNL     WK++DPL +GNLP L+ VL+D S + D+  K + +       W PRLHFV
Sbjct: 236 DLKNL----GWKSDDPLARGNLPLLTKVLRDSSVIPDTDGKSRDTKKQKNTNWNPRLHFV 291

Query: 278 WNIILPILARDDQNEGSSDEHITKKRKKEKAKDVQVKMIEFPEFWKAVVDESFFNEKSSG 337
           W+I+LP+       +  + EH++KKRKK   K VQ   I+FPEFWK  +DESFFNEK+S 
Sbjct: 292 WDILLPLFG---SGKLENTEHVSKKRKKTSTKKVQ-NSIQFPEFWKMAIDESFFNEKASS 347

Query: 338 ERKYLGFLILEAAFKQVPLSLVSLLFSKNLMRTLINQSSDSKRILHKISQKVLASILELC 397
           ERKYLGFLI++AAFK VP S +   FS+N+MRTLINQS DS+R+L+KI+Q  L SI++ C
Sbjct: 348 ERKYLGFLIIDAAFKTVPGSYIGSCFSQNVMRTLINQSIDSQRVLNKIAQITLGSIVKAC 407

Query: 398 ESH-PDKTVPSIQAMLFSENGTINFDKLTKTKTVDLLVANPSMTPKHLSSLVDLFVSHLP 456
           E    +K VP + +MLF  +G++NFDKLTK+ TV  L+A   +    L+ L+++F+  L 
Sbjct: 408 EEDLTNKLVPCLNSMLFGPHGSVNFDKLTKSSTVSKLIAIKELPSTVLTQLLNVFLPQL- 466

Query: 457 DDPNEEAALTRFLLDSMLHVVRTHKT-VSDKTWVKPLITSVISMGFFKTSPAKVDQENQD 515
                +   T F+LDS+LH++R HK  + D   +KP++T +I M FFK +         D
Sbjct: 467 QQSKRDLTHTHFILDSILHIIRAHKVEIDDMDVMKPILTPIIYMAFFKDA--------TD 518

Query: 516 DDHTDGFEFQARERLYSILADLIPLSKQSIHSA-----SWPYITLQVLLSQEQSKE--LI 568
           D   +     A+ERL+SIL +L     + IHS      SW ++TL+++L  E+S    LI
Sbjct: 519 DQELEQLHELAKERLFSILGELT--MNKEIHSEDPEINSWQFLTLKLILDMEKSHRGILI 576

Query: 569 HPLDDGLNKIKLDALNDLEGIRRELENDPSASQFYGLELLLSMTVLQIYGGDTESLSVLE 628
           +PLD+ L K K +A++ L  I R      S +Q +GL  LLSM ++Q+Y G+T+S+SV+E
Sbjct: 577 NPLDENLEKTKEEAISSLAEISRS-----STAQAWGLSTLLSMCLIQLYAGETDSISVIE 631

Query: 629 DLVTFYHSMRDSSEENSLIGVIEIXXXXXXXXXXXXXXXXXXVWELFVDKVGTPELEVLF 688
           +L  F        + NS++G+ EI                  +W+ F++ VG  EL+VL 
Sbjct: 632 ELCEF-----SKDKNNSMVGITEILLSLLAQKKALLKKLSLIIWQQFIEDVGLEELQVLL 686

Query: 689 DILSARENKEGFTAL 703
           D+L ARENK+GF  L
Sbjct: 687 DVLKARENKQGFAQL 701

 Score =  174 bits (442), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 103/267 (38%), Positives = 147/267 (55%), Gaps = 10/267 (3%)

Query: 782  IDKETTSALAKALNLPDGIINENGEVNFNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQ 841
            IDKE TSAL KALNLPD I+N+ GEV+ +                              Q
Sbjct: 753  IDKEATSALVKALNLPDNIVNDKGEVDIDQLEGLSDDDEDDEDEESMDDEKMMELDG--Q 810

Query: 842  LSQIFQRRKEALSKISTGNKRKLEAKESRENVIAFKHKVVDMLEVFVKFVER-----TSK 896
            LS+IF+RRKEALS ISTGN+RK+E KESRENVI+FKH++VDML V+VK+ E+      S+
Sbjct: 811  LSEIFKRRKEALSNISTGNQRKVEVKESRENVISFKHRIVDMLTVYVKYCEKLALANKSE 870

Query: 897  NKECGETELKSVTSMFQPLIKCVQQTTDKALADKLSKLIKNRMCKLKLPKLINDSDDIEE 956
            +     + L  +     P++KC+ +T D+ LADK+SKL+K ++ K+K+        +IE 
Sbjct: 871  DSSSIGSPLSKLVYFIIPILKCINETLDRPLADKISKLLKGKIFKIKVNAFKEMDKNIEV 930

Query: 957  LTISNLGAVHRLMLADKCGQFPNLYFSTCXXXXXXXXXXXXQASTNDSIYDRLIDIYLST 1016
            + +  L + H+++L  K GQ P +++S C            +   ND + D LID+Y +T
Sbjct: 931  MDL--LKSTHKVLLTSKPGQHPAVFYSACSTSSLFLSKLYVEIHGNDKL-DELIDLYAAT 987

Query: 1017 MXXXXXXXXXXXXXXXXXINWLASKKQ 1043
                              INWL+SKKQ
Sbjct: 988  TKEWTNRGKFGANVFIDFINWLSSKKQ 1014

>YEL055C Chr5 complement(48471..51539) [3069 bp, 1022 aa] {ON}
           POL5DNA Polymerase phi; has sequence similarity to the
           human MybBP1A and weak sequence similarity to B-type DNA
           polymerases, not required for chromosomal DNA
           replication; required for the synthesis of rRNA
          Length = 1022

 Score =  556 bits (1432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/734 (45%), Positives = 467/734 (63%), Gaps = 62/734 (8%)

Query: 1   MVEKINRDLFYKLASDLQEERVQAAISLIKELASLE--NNDSEWEYVLNRLIKGLSSNRN 58
           M  K+NRDLF+KLASDL+EER+ AA++LIK+L++L+  ++  EW YVLNRLIKGLSS+RN
Sbjct: 1   MTGKVNRDLFFKLASDLREERLHAAVALIKDLSALDLPDDAEEWSYVLNRLIKGLSSDRN 60

Query: 59  SARLGFSLCLTEVLSVALE-------KGYLNSIEEYIQLLQSTL-------LKETVKNGK 104
           SARLGFSLCLTEV+++A+        KG L S  E++  L + L        K+++K GK
Sbjct: 61  SARLGFSLCLTEVINLAVNMPPGQRPKG-LESTNEFLSTLSTILNVNVNEGTKKSMK-GK 118

Query: 105 EERGLLFGRMFGLQALLNEPLLSKIFLDKTGGLNAHFMVNFMGELVQVALSKTWIREPCL 164
           +ERG+LFG++FGL++LLNEPL S+IF+      N  F + F  +L+ +AL K WI+EPC 
Sbjct: 119 DERGILFGKLFGLKSLLNEPLFSEIFVKDLEKGNTEFFIRFTEQLIDLALKKNWIKEPCF 178

Query: 165 FTLFQVVEKLSPFLNDTVCIESIFKLLDDNKLSLTNEGLAIYLFLIHLCPGTSKFIKKSG 224
           FTLFQ ++ L PF++++   E I  + D   L+LTNEGL+ YL L +   G    I    
Sbjct: 179 FTLFQTMKMLLPFMDESSA-EKILLIYDKYDLTLTNEGLSTYLLLKY--EGDESLIPSVL 235

Query: 225 LLKNLELNSQWKNNDPLTKGNLPTLSAVLKDVSPVEDS--GLK----QKGS-WAPRLHFV 277
            LKN      WK+NDPL +GNLP L+ VL++ S + D+  GLK    QK + W PRLHFV
Sbjct: 236 DLKN----PGWKDNDPLARGNLPLLTKVLRNSSVIPDANGGLKETKKQKNTNWNPRLHFV 291

Query: 278 WNIILPILARDDQNEGSSDEHITKKRKKEKAKDVQVKMIEFPEFWKAVVDESFFNEKSSG 337
           W+++LP+   + + E +S  HI+KKRKK   K VQ   I+FPEFWK  VDESFFNEK+S 
Sbjct: 292 WSVLLPLFG-NGKLENTS--HISKKRKKTNNKKVQ-NSIQFPEFWKMAVDESFFNEKASS 347

Query: 338 ERKYLGFLILEAAFKQVPLSLVSLLFSKNLMRTLINQSSDSKRILHKISQKVLASILELC 397
           ERKYLGFLI++AAFK VP S +   FS+N+MRTLINQS DS+R+L+KISQ  L SI++ C
Sbjct: 348 ERKYLGFLIIDAAFKAVPGSYIGFCFSQNVMRTLINQSIDSQRVLNKISQLTLDSIVKAC 407

Query: 398 ES-HPDKTVPSIQAMLFSENGTINFDKLTKTKTVDLLVANPSMTPKHLSSLVDLFVSHLP 456
           E    ++ VP + AMLF  +G+INFDKLTK+ TV  L+A   +    L+ L+D+F   L 
Sbjct: 408 EEDSANRLVPCLNAMLFGPHGSINFDKLTKSGTVSKLIAIKELPSTVLAQLLDVFFLQLQ 467

Query: 457 DDPNEEAALTRFLLDSMLHVVRTHKT-VSDKTWVKPLITSVISMGFFKTSPAKVDQENQD 515
           D     +  T F LDS+LH+VR HK  ++D   +KP++  ++ M FFK +         D
Sbjct: 468 DKKGVLSH-TLFALDSILHIVRAHKVEINDMDIMKPVLRPIVYMAFFKHT--------SD 518

Query: 516 DDHTDGFEFQARERLYSILADLI---PLSKQSIHSASWPYITLQVLLSQEQSK--ELIHP 570
           D   +     A+ERLYSIL +L     +  +     SW Y+TL+++L  E S   +LI+P
Sbjct: 519 DLKLEQLHELAKERLYSILGELTINKEIRCKDPEINSWQYLTLKLILDIENSHVGDLINP 578

Query: 571 LDDGLNKIKLDALNDLEGIRRELENDPSASQFYGLELLLSMTVLQIYGGDTESLSVLEDL 630
           LD+ L  IK +A++ L  + R        +Q +GL  LLSM ++Q+Y GDT+S+SV+E+L
Sbjct: 579 LDENLENIKNEAISCLSKVCRS-----RTAQSWGLSTLLSMCLVQLYAGDTDSISVIEEL 633

Query: 631 VTFYHSMRDSSEENSLIGVIEIXXXXXXXXXXXXXXXXXXVWELFVDKVGTPELEVLFDI 690
             F        E NS++G+ EI                  +W+ F+++VG  EL++L DI
Sbjct: 634 CEF-----SKHENNSMVGITEILLSLLAQKKALLRKLSLIIWQQFIEEVGLEELQILLDI 688

Query: 691 LSARENKEGFTALF 704
           L ARENK+GF  LF
Sbjct: 689 LKARENKQGFAQLF 702

 Score =  177 bits (448), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 110/268 (41%), Positives = 146/268 (54%), Gaps = 10/268 (3%)

Query: 782  IDKETTSALAKALNLPDGIINENGEVNFNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQ 841
            IDKE TSAL KALNLPD I+N+ GEV+ +                              Q
Sbjct: 755  IDKEATSALVKALNLPDNIVNDKGEVDLDQLEGLSDDGGDDEDEESMDDEKMMELDD--Q 812

Query: 842  LSQIFQRRKEALSKISTGNKRKLEAKESRENVIAFKHKVVDMLEVFVKFVER-TSKNKEC 900
            LS+IF+RRKEALS ISTGN+RK E K+SRENVI+FKH+VVDML V+VK+ E+ T  NK  
Sbjct: 813  LSEIFKRRKEALSSISTGNQRKFEVKQSRENVISFKHRVVDMLAVYVKYCEKLTLANKSE 872

Query: 901  GETELKSVTS----MFQPLIKCVQQTTDKALADKLSKLIKNRMCKLKLPKLINDSDDIEE 956
                L    S       P++KCV +T D+ LADK+SKL+K ++ K+K+    + + DIE 
Sbjct: 873  HSNNLGGSLSKLVYFIIPMLKCVNETLDRPLADKISKLLKGKIFKIKVTAFKDMNKDIEL 932

Query: 957  LTISNLGAVHRLMLADKCGQFPNLYFSTCXXXXXXXXXXXXQASTNDSIYDRLIDIYLST 1016
            + +  L   H+LML  K GQ   +++S C            +   ND + D LID+Y +T
Sbjct: 933  MDL--LKKTHKLMLTSKPGQHAAVFYSMCSTSSLFLSKLYVEIGGNDKL-DELIDLYTAT 989

Query: 1017 MXXXXXXXXXXXXXXXXXINWLASKKQT 1044
                              INWL+SKKQT
Sbjct: 990  TKEWMQKGKCGPNIFIDFINWLSSKKQT 1017

>ZYRO0F00440g Chr6 (42723..45842) [3120 bp, 1039 aa] {ON} similar to
           gnl|GLV|CAGL0B03553g Candida glabrata CAGL0B03553g and
           weakly similar to YEL055C uniprot|P39985 Saccharomyces
           cerevisiae
          Length = 1039

 Score =  555 bits (1429), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 332/728 (45%), Positives = 467/728 (64%), Gaps = 61/728 (8%)

Query: 1   MVEKINRDLFYKLASDLQEERVQAAISLIKELASLE--NNDSEWEYVLNRLIKGLSSNRN 58
           M  K+NRD FY+LASDLQ+ERV+AA+SLI+EL++LE    + EW YVL RLI GL+S RN
Sbjct: 1   MPGKVNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNEEWSYVLKRLISGLASGRN 60

Query: 59  SARLGFSLCLTEVLSVALEKGYL-----NSIEEYIQLLQSTLLKETVKN------GKEER 107
           SARLGFSLCL+EV+ +AL+KG L     +S ++Y++LL + L  + V        GK+ER
Sbjct: 61  SARLGFSLCLSEVVKMALDKGTLAPQDLSSPDQYLELLSNNLSPDAVGKSKKDLKGKDER 120

Query: 108 GLLFGRMFGLQALLNEPLLSKIFLDKTGGLNAHFMVNFMGELVQVALSKTWIREPCLFTL 167
           G+LFG+MFGLQA+LNEPL + IF D+ G ++  F + F  EL ++A+ K W+RE CL+TL
Sbjct: 121 GILFGKMFGLQAILNEPLFTSIFFDQEGKVSP-FALRFAQELAELAVKKNWLRESCLYTL 179

Query: 168 FQVVEKLSPFLNDTVCIESIFKLLDDNKLSLTNEGLAIYLFLIHLCPGTSKFIKKS-GLL 226
           FQ V++L P +   + + SI  LLD  +L++TNEGLAIYL L H   G ++   KS  + 
Sbjct: 180 FQTVQRLVPAMESEI-VSSILLLLDKYQLTMTNEGLAIYLLLFH---GKARKNGKSFKVP 235

Query: 227 KNLELN-SQWKNNDPLTKGNLPTLSAVLKDV----SPVEDSGLKQKGSWAPRLHFVWNII 281
            +L L  + WKNNDPL+KGNLP LS VL+D     S V D    +  +W PRLHFVW+I+
Sbjct: 236 SSLALEFAAWKNNDPLSKGNLPQLSRVLRDAPANDSEVADGSHPKSANWNPRLHFVWDIL 295

Query: 282 LPILARDDQNEGSSDEHITKKRKKEKAKDVQVKMIEFPEFWKAVVDESFFNEKSSGERKY 341
           +PILA      G SDE I  K+  +K K   V+ IEFPEF++A VDE+FF+EK+S ERKY
Sbjct: 296 IPILA-----PGKSDEEIPSKKSHKKKKKDTVEGIEFPEFFQAAVDETFFSEKASSERKY 350

Query: 342 LGFLILEAAFKQVPLSLVSLLFSKNLMRTLINQSSDSKRILHKISQKVLASILELCESHP 401
           LGFL+   A + V    +   F++N MRTLINQSSDSKR+L+KISQK L +I++ CE   
Sbjct: 351 LGFLVFIRAVEVVSSQWIQSCFTQNFMRTLINQSSDSKRLLNKISQKALDAIVKACEKDA 410

Query: 402 -DKTVPSIQAMLFSENGTINFDKLTKTKTVDLLVANPSMTPKHLSSLVDLFVSHLP--DD 458
            +K    ++AMLF  +GTI+FDKLTK+KT   LVA   ++   L  L ++  + L   ++
Sbjct: 411 SEKIALCLEAMLFGPHGTISFDKLTKSKTASKLVAIKDISSSGLDRLFNMLSAQLSREEE 470

Query: 459 PNEEAALTRFLLDSMLHVVRTHK-TVSDKTWVKPLITSVISMGFFKTSPAKVDQENQDDD 517
           PN++    +F+LD++LH VRTH+  +S +    PL+ S++++ FF           + +D
Sbjct: 471 PNKQH--YQFVLDTVLHAVRTHRLEISQELIAHPLLDSIVTLAFFS---------KKGED 519

Query: 518 HTDGFEFQARERLYSILADLIPLSKQSIHSASWPYITLQVLLSQE-QSKELIHPLDDGLN 576
            +D     ARERL+SIL++L  + K      SW + TL+++LS+E +  E I+ LD+ L 
Sbjct: 520 ISD----LARERLFSILSELT-IQKD---GQSWQHYTLKLILSKEAEGNEPINKLDEDLK 571

Query: 577 KIKLDALNDLEGIRRELENDPSASQFYGLELLLSMTVLQIYGGDTESLSVLEDLVTFYHS 636
            I+ +AL+ L+ I  +      + Q  GLE LLS  +LQ+Y GD+ESLS++E+L  FY  
Sbjct: 572 AIETEALDILQNISSD------SPQSRGLEWLLSNCLLQLYSGDSESLSIVEELCIFYR- 624

Query: 637 MRDSSEENSLIGVIEIXXXXXXXXXXXXXXXXXXVWELFVDKVGTPELEVLFDILSAREN 696
               +E NSL+G+ EI                  VWE FV +VG  EL++L ++L AREN
Sbjct: 625 -EGLNESNSLVGITEILLSLLAQKKALLRKLSLVVWEQFVSEVGEQELKILLEVLDAREN 683

Query: 697 KEGFTALF 704
           KEGF  LF
Sbjct: 684 KEGFAKLF 691

 Score =  171 bits (433), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 104/285 (36%), Positives = 147/285 (51%), Gaps = 20/285 (7%)

Query: 778  DINKIDKETTSALAKALNLPDGIINENGEVNFNXXXXXXXX------------XXXXXXX 825
            ++ KID+E TSALAKALNLP+ I+N+ GEV+                             
Sbjct: 754  NVAKIDREATSALAKALNLPENIVNDKGEVDVERLEAENGANSDEMDDDDDDEEDEEEDE 813

Query: 826  XXXXXXXXXXXXXXXQLSQIFQRRKEALSKISTGNKRKLEAKESRENVIAFKHKVVDMLE 885
                           QLSQIF+RRKEALS ++TGN+RK+E KE+RENVI FKH++VDMLE
Sbjct: 814  EEESMDDEQMMKLDEQLSQIFKRRKEALSGVTTGNERKVEVKEARENVITFKHRIVDMLE 873

Query: 886  VFVKFVERTS---KNKECGETE-LKSVTSMFQPLIKCVQQTTDKALADKLSKLIKNRMCK 941
             ++K  +R +    N E    +  K++    +P+I+C+Q T DK LADK+SKL+K R+ K
Sbjct: 874  AYIKHADRIALQDNNDEANSKDTFKNLFLFVEPMIRCLQLTLDKPLADKISKLLKGRLYK 933

Query: 942  LKLPKLINDSDDIEELTISNLGAVHRLMLADKCGQFPNLYFSTCXXXXXXXXXXXXQAST 1001
            +K+       D   +  +  L   H+ +L  K GQFP LYFSTC            + ++
Sbjct: 934  IKISAFKGAIDS--KRLLEQLEVTHKALLTSKPGQFPALYFSTCSTTSLFLGKVLVENNS 991

Query: 1002 NDSI--YDRLIDIYLSTMXXXXXXXXXXXXXXXXXINWLASKKQT 1044
             D    Y ++ID+Y  T                   NWL S+K+T
Sbjct: 992  EDPAISYGQMIDLYADTTKEWLLIGKFGANVFADFHNWLLSRKKT 1036

>TDEL0G04640 Chr7 complement(845491..848544) [3054 bp, 1017 aa] {ON}
           Anc_6.7 YEL055C
          Length = 1017

 Score =  550 bits (1416), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 327/723 (45%), Positives = 455/723 (62%), Gaps = 52/723 (7%)

Query: 1   MVEKINRDLFYKLASDLQEERVQAAISLIKELASLENND--SEWEYVLNRLIKGLSSNRN 58
           M  ++NRD FYKLASDLQEERVQAA++LI+EL++L+  D  SEW YVL RLI GLSS+RN
Sbjct: 1   MTGRVNRDWFYKLASDLQEERVQAAVALIQELSALDLPDGASEWSYVLKRLINGLSSSRN 60

Query: 59  SARLGFSLCLTEVLSVAL-----EKGYLNSIEEYIQLLQSTLL--------KETVKNGKE 105
           SARLGFSLCLTEV+++AL         L+SI+ ++ LL STL         K+ +K GK+
Sbjct: 61  SARLGFSLCLTEVINLALNLEGDRPEELSSIDTFLDLLSSTLSLQPSGQDSKKQIK-GKD 119

Query: 106 ERGLLFGRMFGLQALLNEPLLSKIFLDKTGGLNAHFMVNFMGELVQVALSKTWIREPCLF 165
           ERGLLFG+MFGLQALL+EPL  K+F+ K  G+ + F + FM EL Q+A+ K+W+REPCLF
Sbjct: 120 ERGLLFGKMFGLQALLSEPLFEKVFISKEKGI-SDFALRFMDELCQLAVFKSWLREPCLF 178

Query: 166 TLFQVVEKLSPFLNDTVCIESIFKLLDDNKLSLTNEGLAIYLFLIHLCPGTSKFIKKSGL 225
           TLFQ  E++ P L D    + + +LLD  +L+LTNEGLAIYL L++  P   +    S L
Sbjct: 179 TLFQAYERILP-LADIETAQVVLRLLDQYQLTLTNEGLAIYLLLLYKSP---RDYSSSIL 234

Query: 226 LKNLELNSQWKNNDPLTKGNLPTLSAVLKDVS-PVEDSGLKQKGSWAPRLHFVWNIILPI 284
             + E  S WK+NDPL +GNLP LS VL+D S   ED    +  +W PRLHFVW+I+LPI
Sbjct: 235 QMDFESKS-WKSNDPLARGNLPLLSQVLRDSSVATEDESSPKASNWTPRLHFVWDILLPI 293

Query: 285 LARDDQNEGSSDEHITKKRKKEKAKDVQVKMIEFPEFWKAVVDESFFNEKSSGERKYLGF 344
           + +D+    S D     K++K++        I+FPEFW+  VDES FNEK+S ERK+LG 
Sbjct: 294 ITQDNSRRESEDRKPKTKKRKKEK----ATAIQFPEFWQMAVDESMFNEKASTERKFLGL 349

Query: 345 LILEAAFKQVPLSLVSLLFSKNLMRTLINQSSDSKRILHKISQKVLASILELCESHP-DK 403
           +I + A +  P  LV   FS+N+MRTLIN +SDSKR+L KIS KVL SI+++C+  P +K
Sbjct: 350 VIFQKALEVTPHKLVGCCFSQNVMRTLINHASDSKRLLFKISLKVLNSIVDICKKRPKEK 409

Query: 404 TVPSIQAMLFSENGTINFDKLTKTKTVDLLVANPSMTPKHLSSLVDLFVSHLPDDPNEEA 463
            VP + A+LF  +G+INFDKLTK+KT   L+A   +    L+ L  L  S+L +    E 
Sbjct: 410 LVPCLSAILFGPHGSINFDKLTKSKTATNLLAVNGLDETALNELFGLLSSNLIESSLVEQ 469

Query: 464 ALTRFLLDSMLHVVRTHKTVSDK-TWVKPLITSVISMGFFKTSPAKVDQENQDDDHTDGF 522
              +F+LD+MLH VR+HK+  +K   V  ++  +IS+ FF             D+HT   
Sbjct: 470 KNQQFILDTMLHAVRSHKSELNKDIIVTSILRPIISLAFFTVK----------DEHTSNL 519

Query: 523 EFQARERLYSILADLIPLSKQSIHSASWPYITLQVLLSQ-EQSKELIHPLDDGLNKIKLD 581
              A+ER YSIL+++  L+ +     S+  + L ++  +    KEL   LDD L  +K +
Sbjct: 520 ---AKERFYSILSEITHLNNE---GPSYQNMALDIIRDEIAAGKELTTKLDDTLEDVKSE 573

Query: 582 ALNDLEGIRRELENDPSASQFYGLELLLSMTVLQIYGGDTESLSVLEDLVTFYHSMRDSS 641
           AL  L+ I     N+    Q  GLE+L+SM +LQ+Y G++E++SV+E+L  FY    ++S
Sbjct: 574 ALRTLQAI----SNNEKNPQLRGLEMLISMCLLQLYSGESEAVSVIEELCAFYQDTDENS 629

Query: 642 EENSLIGVIEIXXXXXXXXXXXXXXXXXXVWELFVDKVGTPELEVLFDILSARENKEGFT 701
              SL+G+ EI                   W+ FV ++G  EL+ L D+L ARENK+GF+
Sbjct: 630 --TSLVGITEILLSLLAQKKAVLRKLSLSAWQQFVSEIGEAELKALLDVLPARENKKGFS 687

Query: 702 ALF 704
            LF
Sbjct: 688 QLF 690

 Score =  178 bits (452), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 110/285 (38%), Positives = 155/285 (54%), Gaps = 15/285 (5%)

Query: 770  EDNDYSNEDINKIDKETTSALAKALNLPDGIINENGEVNFN-----------XXXXXXXX 818
            ED++ + +D+ KIDKE TSALAKALNLPD I+N+ GEV+ N                   
Sbjct: 736  EDSNENQDDVAKIDKEATSALAKALNLPDNIVNDKGEVDLNNWDDGADDVADDGADDEVD 795

Query: 819  XXXXXXXXXXXXXXXXXXXXXXQLSQIFQRRKEALSKISTGNKRKLEAKESRENVIAFKH 878
                                  QLSQIF+RRK+ALS ISTGN+RK EAKESRE+VIAFK 
Sbjct: 796  GEEDEDEDEDSMDDEKMMELDDQLSQIFKRRKDALSNISTGNQRKNEAKESREDVIAFKQ 855

Query: 879  KVVDMLEVFVKFVERTSKNKECGETELKSVTSMFQPLIKCVQQTTDKALADKLSKLIKNR 938
            +V+DMLE++VKFVE+ S  KE   +++ S   + +P+IKC+QQTTDK+LA++++KL++ +
Sbjct: 856  RVIDMLEIYVKFVEKQSL-KEENYSKISSCLLLLEPMIKCIQQTTDKSLANRIAKLLRTK 914

Query: 939  MCKLKLPKLINDSDDIEELTISNLGAVHRLMLADKCGQFPNLYFSTCXXXXXXXXXXXXQ 998
            + KLK        D  E + +  L   H  +   K GQ   +Y+S C            +
Sbjct: 915  VFKLKTSAFCGSCDQDELMEM--LRMTHEKIQTLKPGQHQAIYYSVCSTASLFLTKIIIE 972

Query: 999  AS-TNDSIYDRLIDIYLSTMXXXXXXXXXXXXXXXXXINWLASKK 1042
             S + D+    +ID+Y  TM                  NWL+S+K
Sbjct: 973  NSDSKDAAVHDIIDLYAETMKQWASNGKFGPNIFIDFSNWLSSRK 1017

>NDAI0K02910 Chr11 complement(658930..662121) [3192 bp, 1063 aa]
           {ON} Anc_6.7 YEL055C
          Length = 1063

 Score =  533 bits (1374), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 330/754 (43%), Positives = 461/754 (61%), Gaps = 73/754 (9%)

Query: 1   MVEKINRDLFYKLASDLQEERVQAAISLIKELASLENND--SEWEYVLNRLIKGLSSNRN 58
           M  K+NRDLFYKLASDL+EER+Q+A+SLIKEL+ L   D   EW YVLNRLIKGL+S+RN
Sbjct: 1   MAGKVNRDLFYKLASDLEEERLQSAVSLIKELSQLNVPDDIEEWTYVLNRLIKGLASDRN 60

Query: 59  SARLGFSLCLTEVLSVALEKG-----YLNSIEEYIQLLQSTL--------------LKET 99
           SARLGFSLCLTE +++AL  G      + SI E++ LL  TL              LK+ 
Sbjct: 61  SARLGFSLCLTEAINLALGMGDNAPQGVQSINEFLDLLSKTLPIDSNTVATENKTALKK- 119

Query: 100 VKNGKEERGLLFGRMFGLQALLNEPLLSKIFL-DKTGGLNAHFMVNFMGELVQVALSKTW 158
            K G++ERG+LFG++F LQALLNEPL S IFL +    +++   + ++ EL  +   K W
Sbjct: 120 -KKGRDERGILFGKLFALQALLNEPLFSTIFLSEDKKKIDSSLFIRYVDELFTLGSKKNW 178

Query: 159 IREPCLFTLFQVVEKLSPFLNDTVCIESIFKLLDDNKLSLTNEGLAIYLFLIHLCPGTSK 218
           IRE C FTL+Q +EKL P+  D    + +  LLD  +L+L+ EGLAIYL +I+      +
Sbjct: 179 IRESCFFTLYQTIEKLLPYA-DIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRSANKKQ 237

Query: 219 FIKKSGLLKNLEL-NSQWKNNDPLTKGNLPTLSAVLKDVS---------PVEDSGLKQKG 268
             K    L +++L NS WK+N+PL +GNLP L+ +L+D +         P   +  +   
Sbjct: 238 LEKT---LSDIQLSNSHWKSNNPLARGNLPALTNILRDSNVTEFQDHEKPPTKNNKQPPA 294

Query: 269 SWAPRLHFVWNIILPILARDDQNE--GSSDEHITKKRKKEKAKDVQVKMIEFPEFWKAVV 326
           +WAPRLHFVW+I+LPIL      E   S D+HI+KKRKK K      + I FPEFW+  +
Sbjct: 295 NWAPRLHFVWDILLPILTTTTTEEDTNSDDKHISKKRKKIKKNQDSNEFIRFPEFWQMAI 354

Query: 327 DESFFNEKSSGERKYLGFLILEAAFKQVP---LSLVSLLFSKNLMRTLINQSSDSKRILH 383
           DESFFNEK+S ERKYLGFLI +   + +      L+S  F++N MR+LINQSSD+KR+LH
Sbjct: 355 DESFFNEKASSERKYLGFLIFQKTIQSIGKNNAKLISTCFTRNFMRSLINQSSDNKRLLH 414

Query: 384 KISQKVLASILELCESHP-DKTVPSIQAMLFSEN--GTINFDKLTKTKTVDLLVANPSMT 440
           K+SQ  + +I+++CE  P +K +P + A+LF+ N  G+INFDKLTK+KTV  L++   ++
Sbjct: 415 KMSQIAIDTIVKVCEDDPSNKLIPCLDALLFNTNVGGSINFDKLTKSKTVSKLISIKHLS 474

Query: 441 PKHLSSLVDLFVSHLPDDPNEE--AALTRFLLDSMLHVVRTHKTVSD-KTWVKPLITSVI 497
              L  L+ LF+S +     E+    + +F LD++LHVVR+HK+  D  + V+PL+  ++
Sbjct: 475 SSTLRQLIKLFISQINAMSTEKEITIVNQFALDTILHVVRSHKSEFDYDSVVEPLLNPLV 534

Query: 498 SMGFFKTSPAKVDQENQDDDHTDGFEFQARERLYSILADLI-----PLSKQSIHSASWPY 552
            + FF          ++D++  +     A+ERLYSIL++L      P S  + H  SW Y
Sbjct: 535 KLAFF----------SKDNEALNEL---AKERLYSILSELTGATSSPKSSNAAH--SWHY 579

Query: 553 ITLQVLLSQEQS--KELIHPLDDGLNKIKLDALNDLEGIRRELENDPSASQFYGLELLLS 610
            TLQ++L  E+S  +EL++ LD  L  IK + L  L  I      D    Q  GLELLLS
Sbjct: 580 YTLQLILELEKSGNQELVNKLDADLETIKNNGLKVLNEISMT-NTDEMTQQSKGLELLLS 638

Query: 611 MTVLQIYGGDTESLSVLEDLVTFYHSMRDSSEENSLIGVIEIXXXXXXXXXXXXXXXXXX 670
           M +LQ++ GDTESLS +E+LV FY + +   E  SL+G+ EI                  
Sbjct: 639 MCILQLFSGDTESLSTIEELVEFYSNSK-QEESTSLVGITEILLSLLAQKKAILRKLSLS 697

Query: 671 VWELFVDKVGTPELEVLFDILSARENKEGFTALF 704
           VWE F+  +G  EL VL  +L  RENK+GF  LF
Sbjct: 698 VWEHFISDIGKNELNVLLAVLPVRENKQGFAHLF 731

 Score =  182 bits (461), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 114/283 (40%), Positives = 151/283 (53%), Gaps = 20/283 (7%)

Query: 776  NEDINKIDKETTSALAKALNLPDGIINENGEVNFNXXXXXXXXXXXXXXXXXXXXXXXXX 835
            N DI  IDKE TSALAKALNLP+ I+NE GEV+                           
Sbjct: 784  NGDIANIDKEATSALAKALNLPENIVNEKGEVDLAKLENMSDNDLDNSINDDDDDESDEE 843

Query: 836  XXXXX-------QLSQIFQRRKEALSKISTGNKRKLEAKESRENVIAFKHKVVDMLEVFV 888
                        QLS+IF+RRKEALS ISTGN+RK+E KESRENVIAFKH+V+DML +++
Sbjct: 844  SMDDEKMMELDDQLSEIFKRRKEALSNISTGNQRKIEVKESRENVIAFKHRVIDMLMIYM 903

Query: 889  KFVERTSKNKECGETELKSVTSMFQPLIKCVQQTTDKALADKLSKLIKNRMCKLK----- 943
            K+VE  +   E GE +  ++    +P+IKCV+QT DK+LADK+ KL+K ++ K+K     
Sbjct: 904  KYVEGLTLTTENGE-KFGNLLLFIEPMIKCVKQTLDKSLADKVVKLVKTKLFKIKSSNFQ 962

Query: 944  LPKLINDSDDIEELTISNLGAVHRLMLADKCGQFPNLYFSTCXXXXXXXXXXXXQASTND 1003
            +  L  D D + EL    L   H  +L  K GQFP+LY+S C               +ND
Sbjct: 963  IESLNADDDRVMEL----LQRTHESLLTSKAGQFPSLYYSLCSTFSIFLGKILVHVESND 1018

Query: 1004 S--IYDRLIDIYLSTMXXXXXXXXXXXXXXXXXI-NWLASKKQ 1043
                Y +LID+Y  T                    NWL+S++Q
Sbjct: 1019 KEIAYGKLIDLYGETTKSWVMSKGKFGINTFTDFYNWLSSQRQ 1061

>TPHA0J00250 Chr10 (55997..59071) [3075 bp, 1024 aa] {ON} Anc_6.7
           YEL055C
          Length = 1024

 Score =  513 bits (1322), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 293/725 (40%), Positives = 440/725 (60%), Gaps = 66/725 (9%)

Query: 4   KINRDLFYKLASDLQEERVQAAISLIKELASLENNDS---EWEYVLNRLIKGLSSNRNSA 60
           +++RDLFYKLASD+ EER+ + + ++  L  L   D    EW YV++RL+KGL SNRNSA
Sbjct: 2   RVDRDLFYKLASDVPEERIASVVGVVGNLEKLSVGDEGEKEWVYVVDRLVKGLESNRNSA 61

Query: 61  RLGFSLCLTEVLSVALEKGY------LNSIEEYIQLLQS--------TLLKETVKNGKEE 106
           RLGFS+CLTE L + L +        L  + +Y++ + S        T   +    GK+E
Sbjct: 62  RLGFSMCLTEALHLVLSRDVAERPRCLKDVGDYLKAVDSQFPLSAVGTGKAKVKVKGKDE 121

Query: 107 RGLLFGRMFGLQALLNEPLLSKIFLDKTGGLNAHFMVNFMGELVQVALSKTWIREPCLFT 166
           RG LFGR+F  + LLNEPL S +F  K       F++ F   ++Q+   K W+ EPC F+
Sbjct: 122 RGTLFGRLFAYKVLLNEPLFSLLFDQK-------FLIEFQERVIQLGSMKNWLLEPCFFS 174

Query: 167 LFQVVEKLSPFLNDTVCIESIFKLLDDNKLSLTNEGLAIYLFLIHLCPGTSKFIKKSGLL 226
           L+Q +EKL P L+      ++ ++ D++KL++TNEGL++YL L        KF      L
Sbjct: 175 LYQAIEKLLPGLDQEYAQATVAQI-DEHKLTMTNEGLSVYLLL------AKKFTLSDFTL 227

Query: 227 KNLELNSQWKNNDPLTKGNLPTLSAVLKDVSPVEDSGLKQKGSWAPRLHFVWNIILPILA 286
           +N    S WK NDPL KGNL  ++ V+ D + V+ +      +WAPRLH++W+IIL    
Sbjct: 228 EN----SAWKANDPLQKGNLSVMAKVMLDTN-VDGANSNTNKNWAPRLHYIWDIILREFF 282

Query: 287 RDDQNEGSSDEHITKKRKKEKAKDVQVKMIEFPEFWKAVVDESFFNEKSSGERKYLGFLI 346
            D++  GS  +H+ +K+K +K+K+ Q   +EF  FW+AVVDESFFN+K+S ERKY G+LI
Sbjct: 283 -DNEQHGSDAKHVYQKKKHDKSKNPQ--RVEFKSFWQAVVDESFFNDKASPERKYQGYLI 339

Query: 347 LEAAFKQVPLSLVSLLFSKNLMRTLINQSSDSKRILHKISQKVLASILELCESHPDKTVP 406
            + A + VP S V   F++N+MR++INQ+SDSKR+L+K+SQK L +++ +CES P K  P
Sbjct: 340 FQKAVESVPASEVEYCFTQNIMRSMINQASDSKRMLNKLSQKTLNTLVSICESEPAKLTP 399

Query: 407 SIQAMLFSENGTINFDKLTKTKTVDLLVANPSMTPKHLSSLVDLFVSHL--PDDPNEEAA 464
            + A+LFSE G++NFD LTK+KTV  L+A       +L++L+ LF S L   D   E   
Sbjct: 400 VLTALLFSEEGSLNFDILTKSKTVSRLLATKQSDHHYLATLIRLFTSRLNVSDKTPELEE 459

Query: 465 LT---RFLLDSMLHVVRTHKTV--SDKTWVKPLITSVISMGFFKTSPAKVDQENQDDDHT 519
           L    +F+LDS+L+++R+ K +  +DK  V  ++ S I + FF+          +D+++ 
Sbjct: 460 LNPRLKFILDSLLNLIRSQKALLETDKEIVMEILESTIQLAFFQ----------KDNEYI 509

Query: 520 DGFEFQARERLYSILADLIPLSKQSIHSASWPYITLQVLLSQEQSKELIHPLDDGLNKIK 579
           +     A+ERL S+LA+LI L        SWPY+ L++++++E+S+ LI  LDD L  +K
Sbjct: 510 NNI---AKERLSSMLAELIVLPST---DGSWPYLALEIIVTKEKSETLIDSLDDSLVAVK 563

Query: 580 LDALNDLEGIRRELENDPSASQFYGLELLLSMTVLQIYGGDTESLSVLEDLVTFYHSMRD 639
            ++L+ L+ I    E    +SQ  G+E L+SM ++Q+Y GD ES+ ++EDL TFYH   +
Sbjct: 564 AESLDILKKIS---ELKSKSSQLLGIESLMSMNLIQLYSGDAESIGIIEDLTTFYHETSN 620

Query: 640 SSEENSLIGVIEIXXXXXXXXXXXXXXXXXXVWELFVDKVGTPELEVLFDILSARENKEG 699
               N   GV EI                  VWE F+D++G  E+ +L + L ARENKEG
Sbjct: 621 HETAN-FTGVTEILLSLLAQRKSLLRKLSLLVWEQFIDQIGKEEINLLLNFLHARENKEG 679

Query: 700 FTALF 704
           F+ LF
Sbjct: 680 FSVLF 684

 Score =  172 bits (437), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 108/285 (37%), Positives = 149/285 (52%), Gaps = 21/285 (7%)

Query: 776  NEDINKIDKETTSALAKALNLPDGIINENGEVNFNXXXXXXXXXXXXXXXXXXXXXXXXX 835
            +E I++IDKETTSALAKALNLPD IINENGEVN N                         
Sbjct: 741  DEKISQIDKETTSALAKALNLPDNIINENGEVNINMLEGMDEDDDDDSSSAEDDDESMDD 800

Query: 836  XXXXX---QLSQIFQRRKEALSKISTGNKRKLEAKESRENVIAFKHKVVDMLEVFVKFVE 892
                    QLS+IF+RRK+ALS +STGN+RKL+ KESRENVIAFKH+++DMLE+++K +E
Sbjct: 801  EKMMELDDQLSEIFKRRKDALSTVSTGNQRKLDVKESRENVIAFKHRIIDMLEIYIKHIE 860

Query: 893  RTSKNKECG---------ETELKSVTSMFQPLIKCVQQTTDKALADKLSKLIKNRMCKLK 943
            + S N+  G         E  L  + ++      CVQQT DK L +K+ KL K R  K++
Sbjct: 861  QLSLNRADGGKVVTTEKTEQTLAIMLAIVDAFANCVQQTLDKPLIEKIIKLFKGRFSKIR 920

Query: 944  LPKLINDSDDIEELT--ISNLGAVHRLMLADKCGQFPNLYFSTCXXXXXXXXXXXXQAST 1001
                    +DIE  T  +++L  +H  +  +K GQF   Y+  C              + 
Sbjct: 921  FTLF----EDIETSTEIMNSLERIHIHLNTNKPGQFSAAYYLFCSSTSLYLCRFLIDTTV 976

Query: 1002 ---NDSIYDRLIDIYLSTMXXXXXXXXXXXXXXXXXINWLASKKQ 1043
                  ++++L+D+Y +T                   NWLASKKQ
Sbjct: 977  EAEKTKMFEKLVDVYAATTKIWMQEGKYGAKIFVDFYNWLASKKQ 1021

>KNAG0E00970 Chr5 (183126..186140) [3015 bp, 1004 aa] {ON} Anc_6.7
           YEL055C
          Length = 1004

 Score =  509 bits (1312), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 314/730 (43%), Positives = 443/730 (60%), Gaps = 58/730 (7%)

Query: 1   MVEKINRDLFYKLASDLQEERVQAAISLIKELASLE--NNDSEWEYVLNRLIKGLSSNRN 58
           M  K+NRD FYKLASDL EER+QAA+SLIKEL+SL    +  EW YV+NRLIKGLSS+RN
Sbjct: 1   MTGKVNRDHFYKLASDLPEERLQAAVSLIKELSSLPLPASKDEWSYVVNRLIKGLSSDRN 60

Query: 59  SARLGFSLCLTEVLSVALEKG------YLNSIEEYIQLLQSTLLKE-----TVKNGKEER 107
            ARLGFSLCLTEV+ +A++         L S++ ++ LL  T   +       + GKEER
Sbjct: 61  GARLGFSLCLTEVVDLAIKMDDDKAPEELKSMDSFLHLLSKTFSIDPQDEKKKRKGKEER 120

Query: 108 GLLFGRMFGLQALLNEPLLSKIFLDKTGGLNAHFMVNFMGELVQVALSKTWIREPCLFTL 167
           GL+FG++F LQALLNEPL S IF+ K G +   F   F+ ELV +A  K WI++PCLFTL
Sbjct: 121 GLMFGKLFALQALLNEPLFSDIFI-KDGKI-TKFTTKFIDELVNLASRKNWIKQPCLFTL 178

Query: 168 FQVVEKLSPFLNDTVCIESIFKLLDDNKLSLTNEGLAIYLFLIHLCPGTSKFIKKSGLLK 227
           +Q +E+L P+ +D+  ++++  +LD NK +LTNEGLAIYL  I    G S     S LL 
Sbjct: 179 YQTIERLLPYSDDSF-VKTVVTVLDVNKYTLTNEGLAIYLLFI--SKGYS-----SALLS 230

Query: 228 NLELNSQWKNNDPLTKGNLPTLSAVLKDVSPVEDSGLKQ--KGSWAPRLHFVWNIILPIL 285
               N  WK N+PL KGNL  +S V+++ + V D    +    +W P+LHFVW+I+LPIL
Sbjct: 231 INVTNKGWKYNNPLLKGNLSLVSEVVRESAVVVDDNETKTNNANWHPKLHFVWDILLPIL 290

Query: 286 ARDDQNEGSSDEHITKKRKKE-----KAKDVQVKMIEFPEFWKAVVDESFFNEKSSGERK 340
             D + E        KK+KK      K+K   V  IEFPEFWKA+VDE++F++K+S ERK
Sbjct: 291 YNDPREEP------LKKKKKHNNGSSKSKSEAVGAIEFPEFWKAIVDETYFSDKASSERK 344

Query: 341 YLGFLILEAAFKQVPLSLVSLLFSKNLMRTLINQSSDSKRILHKISQKVLASILELCESH 400
           +LG LI   A   VP   ++  FS+NLMR LINQ SDS+R LHKI++K L SI++ CE+ 
Sbjct: 345 FLGLLIFLKALPTVPSKWIACCFSQNLMRCLINQCSDSERHLHKIAEKCLISIVKTCEAD 404

Query: 401 PD-KTVPSIQAMLFSENGTINFDKLTKTKTVDLLVANPSMTPKHLSSLVDLFVSHLPDDP 459
           P  K VP + A+LF  NG+INFD+LTK+KTV  L+A   +    +  L  LF S L    
Sbjct: 405 PGHKLVPVVGALLFGTNGSINFDRLTKSKTVAKLIATKGLEDDSIGKLFALFTSELNSQK 464

Query: 460 NEEAALTRFLLDSMLHVVRTH----KTVSDKTWVKP-LITSVISMGFFKTSPAKVDQENQ 514
           NE  A+  F+LD++LH++R+H    K     TW+   L+  ++ +GFF  +      E  
Sbjct: 465 NE--AVLHFILDTLLHILRSHKLNLKGEHISTWLMSVLLLPLVKLGFFHAT------ETS 516

Query: 515 DDDHTDGFEFQARERLYSILADLIPLSKQSIHSASWPYITLQVLLSQEQSKELIHPLDDG 574
            +D  +  E  ARER+YSIL++L  +     H  SW +  L  L + E    L + LD+ 
Sbjct: 517 PEDKINVSEI-ARERIYSILSELSSVPTGDAH--SWQFHILNELTTVENELTLTNALDED 573

Query: 575 LNKIKLDALNDLEGIRRELENDPSASQFYGLELLLSMTVLQIYGGDTESLSVLEDLVTFY 634
           L  +K   L+ +  +   ++ND S+    G+E LL+M +LQ+Y G+ +S++ ++++  + 
Sbjct: 574 LTTVKDTGLSVIHSL--SVKNDKSSR---GIESLLAMCLLQLYSGEADSVATIKEICDYL 628

Query: 635 HSMRDSSEENSLIGVIEIXXXXXXXXXXXXXXXXXXVWELFVDKVGTPELEVLFDILSAR 694
              + S    SL+G+ EI                  VWE  ++ VG+ EL ++ D+LSAR
Sbjct: 629 TEEKSSKNSISLVGITEILLGLLAQKKTVLTKTSLLVWEQLIEDVGSDELNLILDVLSAR 688

Query: 695 ENKEGFTALF 704
           ENKEGF+ LF
Sbjct: 689 ENKEGFSYLF 698

 Score =  169 bits (429), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 95/271 (35%), Positives = 154/271 (56%), Gaps = 12/271 (4%)

Query: 776  NEDINKIDKETTSALAKALNLPDGIINENGEVNFNXXXXXXXXXXXXXXXXXXXXXXXXX 835
            N+D+  ID++T  ALAKAL LP+ ++NE+GEV FN                         
Sbjct: 741  NKDVTNIDRQTACALAKALKLPENVVNEDGEVKFNEIDDLEDESSDDESMDDEAMMALDG 800

Query: 836  XXXXXQLSQIFQRRKEALSKISTGNKRKLEAKESRENVIAFKHKVVDMLEVFVKFVERTS 895
                 QL+ IF+RRK+ALS + TGN RK+E ++SRE+VI FK +++DML ++VK+VE+  
Sbjct: 801  -----QLADIFKRRKDALSHVPTGNMRKIEVRDSRESVINFKQRMIDMLTIYVKYVEKLD 855

Query: 896  -KNKECGETELKSVTSMFQPLIKCVQQTTDKALADKLSKLIKNRMCKLKLPKLINDSDDI 954
             ++K+  + +L++V++  +P++KCVQ+T D+ LADK+ KL+K ++ K+K+P    D    
Sbjct: 856  LEDKDVMKEKLQTVSTFVEPMLKCVQRTLDRPLADKIFKLLKAKIFKVKIPVSAEDG--- 912

Query: 955  EELTISNLGAVH-RLMLADKCGQFPNLYFSTCXXXXXXXXXXXXQASTN-DSIYDRLIDI 1012
             E  + +L  +H   +LA+K GQ+  +Y+S C            ++  N D+ ++ +IDI
Sbjct: 913  -ERFVESLQRIHGTYLLAEKSGQYQAIYYSLCSSASIFFCKLLIESRDNKDAAHNEVIDI 971

Query: 1013 YLSTMXXXXXXXXXXXXXXXXXINWLASKKQ 1043
            Y  T                   NWL+SK+Q
Sbjct: 972  YAETTKKWMDKKKFPTSVFFDFYNWLSSKRQ 1002

>CAGL0B03553g Chr2 (354365..357430) [3066 bp, 1021 aa] {ON} similar
           to uniprot|P39985 Saccharomyces cerevisiae YEL055c POL5
           DNA polymerase V
          Length = 1021

 Score =  442 bits (1137), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 291/725 (40%), Positives = 422/725 (58%), Gaps = 59/725 (8%)

Query: 4   KINRDLFYKLASDLQEERVQAAISLIKELASLE--NNDSEWEYVLNRLIKGLSSNRNSAR 61
           K+NRD FYKLASDL EER+QAA+ +IK+L++LE      EW Y +NRL+KGL S+RNSAR
Sbjct: 3   KVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQEIEEWNYTINRLVKGLGSSRNSAR 62

Query: 62  LGFSLCLTEVLSVALEKG-----YLNSIEEYIQLLQSTLLKE----TVKNGKEERGLLFG 112
           LGFS+CL+E L++AL  G      LNSIE Y+++L  TL  +      + GK+ERG+LFG
Sbjct: 63  LGFSMCLSEALNLALSLGDKAPEGLNSIENYLKILNETLGADFDEGKKRKGKDERGILFG 122

Query: 113 RMFGLQALLNEPLLSKIFLDKTGGLNAHFMVNFMGELVQVALSKTWIREPCLFTLFQVVE 172
           ++FGLQALLNEPL S +F+ K G  N  F+  F+ E++ ++  K WIREP LF+L+Q +E
Sbjct: 123 KLFGLQALLNEPLFSNVFVTKDGISN--FVPVFVQEMINLSKCKNWIREPALFSLYQTLE 180

Query: 173 KLSPFLNDTVCIESIFKLLDDNKLSLTNEGLAIYLFLIHLCPGTSKFIKKSGLLKNLELN 232
           KL   ++ +  I ++   LD+N L++TNEGLAIYL L+      S  I ++ + +    N
Sbjct: 181 KLISKVSKS-DITNLISQLDENNLTMTNEGLAIYLLLVD----ESNKISRAEIAEIKLQN 235

Query: 233 SQWKNNDPLTKGNLPTLSAVLKD---VSPVEDS-GLKQKG--SWAPRLHFVWNIILPILA 286
             WK+NDPL KGNLP+L+ VL D   V+  ED+   KQKG  +W PRLHFVW  +L  + 
Sbjct: 236 QGWKSNDPLAKGNLPSLTKVLLDNDGVAFAEDNEQRKQKGGANWNPRLHFVWEKLLSTII 295

Query: 287 RDDQNEGSSDEHITKKRKKEKAKDVQVKMIEFPEFWKAVVDESFFNEKSSGERKYLGFLI 346
               +    D+H++KKRKK       +  I+F EFW+ VVDE++FN+K+S ERKYLGFLI
Sbjct: 296 NGSHSLNVEDKHVSKKRKKNNT----IASIKFHEFWQMVVDETYFNDKASSERKYLGFLI 351

Query: 347 LEAAFKQV-PLSLVSLLFSKNLMRTLINQSSDSKRILHKISQKVLASILELCESHPDKTV 405
            + AF  +     V     +N +R+LINQ S+ KR L+KI+ + +  I+E CE+   K +
Sbjct: 352 FQRAFPMLKSYEDVVDSLGQNFIRSLINQCSEKKRHLNKIALQTVEIIVESCENDTTKIL 411

Query: 406 PSIQAMLFSENGTINFDKLTKTKTVDLLVANPSMTPKHLSSLVDLFVSHLPDDPNEEAAL 465
           P  + + F ++G+I FD+L+KTK +  L+   S+  + LS L D+    L    +EE + 
Sbjct: 412 PVFETLAFGKSGSITFDRLSKTKLLSRLLGIKSVRYEVLSKLFDILSRQLS-IKSEEKSF 470

Query: 466 TRFLLDSMLHVVRTHKTVSDKTWV-KPLITSVISMGFFKTSPAKVDQENQDDDHTDGFEF 524
           ++F+LDSMLH+VR  K   D   + + ++  ++ + FF T   +  QE            
Sbjct: 471 SQFILDSMLHLVRNQKAEVDSLLLTEKVLPQIVKLAFF-TGDNETLQE------------ 517

Query: 525 QARERLYSILADLIPLSKQSIH---SASWPYITLQVLLSQ--EQSKELIHPLDDGLNKIK 579
            ++ERL+SIL++L      S+H   S   P   +  L+ Q  E  +++   LDD L + +
Sbjct: 518 MSKERLFSILSEL-----NSLHLSESQEIPQYVVIKLVQQHIEGGEKMTSELDDELRETE 572

Query: 580 LDALNDLEGIRRELENDPSASQFYGLELLLSMTVLQIYGGDTESLSVLEDLVTFYHSMRD 639
             AL     I  E+          GL  L +  +LQ+Y GD+ES+  L++L   Y  +  
Sbjct: 573 SSALR----ILAEIAKATDKPYLRGLGSLFATCLLQLYTGDSESVGTLQELKDIYEKLI- 627

Query: 640 SSEENSLIGVIEIXXXXXXXXXXXXXXXXXXVWELFVDKVGTPELEVLFDILSARENKEG 699
           S +E  L  + EI                  VWE  V  V   EL +L DIL ARENK+G
Sbjct: 628 SDDERPLSSITEILLSLLAQKKALLKKASIAVWEQVVPYVSQDELNLLLDILLARENKQG 687

Query: 700 FTALF 704
           F  LF
Sbjct: 688 FAQLF 692

 Score =  181 bits (459), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 110/283 (38%), Positives = 156/283 (55%), Gaps = 11/283 (3%)

Query: 766  DDQSEDNDYSNEDINKIDKETTSALAKALNLPDGIINENGEVNFNXXXXXXXXXXXXXXX 825
            D  S+  +  N+ +N IDKETTSALAKAL+LP  IIN NGEV+                 
Sbjct: 740  DTSSDSVEDHNDAVNNIDKETTSALAKALDLPADIINANGEVDIEKLEMQSDDDEDDEDD 799

Query: 826  XXXXXXXXXXXXXXXQLSQIFQRRKEALSKISTGNKRKLEAKESRENVIAFKHKVVDMLE 885
                           QLS+IF+RRKEALS I TGNKRK E KESRE+VIAFKH++VD+L 
Sbjct: 800  ESMDDEQMMDLDD--QLSEIFKRRKEALSNIPTGNKRKNEVKESRESVIAFKHRIVDLLL 857

Query: 886  VFVKFVERTSKNKECGET----ELKSVTSMFQPLIKCVQQTTDKALADKLSKLIKNRMCK 941
            V++K VE+  + ++  E     +L  + +   P+IKC++QT DK+LA+KL+KL+K R+ K
Sbjct: 858  VYIKHVEKMIQREDVDENSKADKLNCLLTFAIPMIKCIKQTLDKSLAEKLAKLLKTRLFK 917

Query: 942  LKLPKLINDSDDIEELTISNLGAVHRLMLADKCGQFPNLYFSTCXXXXXX-XXXXXXQAS 1000
            +++  +  D+ D+    + +   +H+  L  K GQFP LY+S C              A 
Sbjct: 918  IRVTGIKLDTADV----VEDFQRIHQDFLFAKPGQFPILYYSVCSSTSLYFSKILVDNAD 973

Query: 1001 TNDSIYDRLIDIYLSTMXXXXXXXXXXXXXXXXXINWLASKKQ 1043
                +Y+ L+D Y +T+                 +NWLASKKQ
Sbjct: 974  YQQGVYETLVDTYSTTIKEWLKDTKFPHSIFLDFVNWLASKKQ 1016

>TBLA0A07210 Chr1 (1796426..1799551) [3126 bp, 1041 aa] {ON} Anc_6.7
           YEL055C
          Length = 1041

 Score =  425 bits (1093), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 290/745 (38%), Positives = 426/745 (57%), Gaps = 81/745 (10%)

Query: 2   VEKINRDLFYKLASDLQEERVQAAISLIKELASLENNDS---------EWEYVLNRLIKG 52
           ++ +NRD+FY+LASDL+EER+Q+ + L+KEL  L+ N+S         EW YV+NRLI G
Sbjct: 1   MQVVNRDVFYRLASDLEEERLQSVVLLVKELDELKANNSDENRELVVKEWNYVVNRLING 60

Query: 53  LSSNRNSARLGFSLCLTEVLSVALEKGY-------LNSIEEYIQLLQSTLLKETVKN--- 102
           L+SNR  ARLGFSLCLTEVL++AL + +       L  I  ++ L+  TL   + K    
Sbjct: 61  LASNRKGARLGFSLCLTEVLNLALSQKWKNILPPNLTDISSFLHLISDTLSIPSSKQGEP 120

Query: 103 -----GKEERGLLFGRMFGLQALLNEPLLSKIFLDKTGGLNAHFMVNFMGELVQVALSKT 157
                GK+ERGLLFG++F LQ+LLN+P+  KIF       N   +  F+ EL+ ++  K 
Sbjct: 121 RKLLKGKDERGLLFGKLFALQSLLNDPIFGKIF----NKDNKAILFEFIYELIALSNLKN 176

Query: 158 WIREPCLFTLFQVVEKLSPFLNDTVCIESIFKLLDDNKLSLTNEGLAIYLFLIHLCPGTS 217
           WI+EP LFTLF  ++K+  FL D   I  +  +L  N L+LTNEGL+IY++LI+  P   
Sbjct: 177 WIKEPTLFTLFNFIQKIIEFL-DRSDIVQLLNILASNNLTLTNEGLSIYIYLIYTNPH-- 233

Query: 218 KFIKKSGLLKNLELNSQWKNNDPLTKGNLPTLSAVLKDVSPVEDS-GLKQKGSWAPRLHF 276
             I    +  +   N+ WKNNDP  K N+  LS VL + S    S       +W PRLH+
Sbjct: 234 --ISPEDIQIDNNNNNTWKNNDPFLKSNIVLLSKVLLNTSAASQSEKHTSNANWTPRLHY 291

Query: 277 VWNIILPILARDDQNEGSSDEHITKKRKKEKAKDVQVKMIEFPEFWKAVVDESFFNEKSS 336
           VW++ILPIL     N  SSD+ + K   K +   V    I+F EFW+ V+DESFFNEK+S
Sbjct: 292 VWDVILPILL----NPKSSDKLLNKNGNKRRK--VSRDRIKFNEFWRQVIDESFFNEKAS 345

Query: 337 GERKYLGFLILEAAFKQVPL----SLVSLLFSKNLMRTLINQSSDSKRILHKISQKVLAS 392
            ERKYLGFLI++  F   PL    + +  +F+ NL+R++INQ +DSKR L+KIS K +  
Sbjct: 346 HERKYLGFLIIQKTF---PLLNTANDIESIFTSNLIRSIINQMNDSKRYLNKISHKTIDQ 402

Query: 393 ILELCESHPD-KTVPSIQAMLFSE--NGTINFDKLTKTKTVDLLVANPSMTPKHLSSLVD 449
           I+  C+S+ + + +P +   LF E  + +INFDKLTKTKT+  L+    ++   LS L  
Sbjct: 403 IVSQCQSNSELRLIPVLNGFLFKEENSSSINFDKLTKTKTISRLINLQDLSTDTLSKLFF 462

Query: 450 LFVSHLPDDPNEEAALTRFLLDSMLHVVRTHKT--VSDKTWVKPLITSVISMGFFKTSPA 507
           LF S L  D        +FLLDS+LH++R+HK+  +    ++ P++  +I + FFK + A
Sbjct: 463 LFTSKL--DSFTTTTELQFLLDSILHIIRSHKSQIIVSHKFLDPVLEPIILLTFFKET-A 519

Query: 508 KVDQENQDDDHTDGFEFQARERLYSILADLIPLSKQSIHSASWPYITLQVL--LSQEQSK 565
            V   N             ++RL SIL DL  + +   +S+S  Y+TL ++  L+++   
Sbjct: 520 DVSISN-----------ILKDRLISILNDLTTVGE---NSSSIQYLTLNLIVNLNEDPKN 565

Query: 566 ELIHPLDDGLNKIKLDALNDLEGIRRELENDPSASQFYGLELLLSMTVLQIYGGDTESLS 625
            L    DD L ++K  A+  L   +R +E+    S+   L  LLS++V+Q+Y  D +S++
Sbjct: 566 VLNFKFDDSLLEVKDSAITTL---KRAIEHSKRDSRLKSLVSLLSLSVIQLYLADIDSIA 622

Query: 626 VLEDLVTFYHS------MRDSSEENSLIGVIEIXXXXXXXXXXXXXXXXXXVWELFVDKV 679
            ++DL  FY        M++     SL G+IEI                  +WE F+D +
Sbjct: 623 TIQDLCDFYDRYKSNTIMKNDKNRPSL-GIIEILLALFAQKKSILKKLGLAMWESFIDLI 681

Query: 680 GTPELEVLFDILSARENKEGFTALF 704
              E + +FD+L  RENKEGF  LF
Sbjct: 682 ELNEFDEIFDVLLTRENKEGFARLF 706

 Score =  184 bits (466), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 124/303 (40%), Positives = 162/303 (53%), Gaps = 21/303 (6%)

Query: 766  DDQS--EDNDY---SNEDINKIDKETTSALAKALNLPDGIINENGEVNFNXXXXXX---- 816
            DD S  E+ND    SN+DIN+IDKE TSALAKAL LPD IIN+ GEV+            
Sbjct: 739  DDNSSDEENDSIVESNDDINRIDKEATSALAKALKLPDNIINDKGEVDLGKLEDISDNEV 798

Query: 817  --XXXXXXXXXXXXXXXXXXXXXXXXQLSQIFQRRKEALSKISTGNKRKLEAKESRENVI 874
                                      QLSQIF RRKEALS I TGNKRKL+ KESRENVI
Sbjct: 799  HFSSSDDDADMSDESMDDEQMMELDGQLSQIFSRRKEALSNIQTGNKRKLDVKESRENVI 858

Query: 875  AFKHKVVDMLEVFVKFVERTSKNKECGETE-----LKSVTSMFQPLIKCVQQTTDKALAD 929
            AFKH++VDM+EV++K +E  +K+ E  E       L S+  + + L+ C+QQT D+ LA+
Sbjct: 859  AFKHRIVDMIEVYLKHIEIITKSSENIERTYFNKILNSIPLIIKSLLLCIQQTLDRNLAE 918

Query: 930  KLSKLIKNRMCKLKLPKLINDSDDIEELTISNLGAVH-RLMLADKCGQFPNLYFSTCXXX 988
            K+SKL+KN++ K+KL +  +  D   E  +  +  +H   +L  K GQ+  LYF  C   
Sbjct: 919  KISKLLKNKLFKIKLVEFKDCGDLTSENILEWISTLHTECILVKKSGQYQPLYFKLCSGS 978

Query: 989  XXXXXXXXXQASTNDSIYDRLIDIYLSTMXX--XXXXXXXXXXXXXXXINWLASKKQ--T 1044
                     + STN  +YD LID+Y  T                     NWL+SK+   T
Sbjct: 979  SLFYCRIFAETSTNADLYDSLIDLYGQTTKTWFKNSEMKIPTTIFSDFHNWLSSKRSVTT 1038

Query: 1045 SSK 1047
            SSK
Sbjct: 1039 SSK 1041

>Smik_8.256 Chr8 (425373..427844) [2472 bp, 823 aa] {ON} YHR172W
           (REAL)
          Length = 823

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 66/134 (49%), Gaps = 11/134 (8%)

Query: 364 SKNLMRTLINQSSDSKRILHKISQKVLASILELCESHP--DKTVPSIQAMLFSENGTINF 421
           S NLMR L+    D++ +   +S   L    E+ E+HP  D + P ++A  F     I F
Sbjct: 474 SNNLMRQLLTAQFDTEALPQVLSH-YLQIYPEVPENHPMNDDSDPLMEANNFKNMNAILF 532

Query: 422 DKLTKTKTVDLLVANPSM-TPKHLSSLVDL-FVSHLPDDPN---EEAALTRFLLDSMLH- 475
           D+L+K +T    + NP + TP+  +++  L F  ++P   N       L ++ + S    
Sbjct: 533 DELSKGRTGTNHMTNPELYTPR--NAIYHLKFNINMPYPLNIIISRTCLIKYQIISRYQL 590

Query: 476 VVRTHKTVSDKTWV 489
           V++ H  + D TW+
Sbjct: 591 VLQYHSRLLDDTWM 604

>SAKL0C05698g Chr3 complement(539308..542775) [3468 bp, 1155 aa]
           {ON} weakly similar to uniprot|P21268 Saccharomyces
           cerevisiae YJL157C FAR1 Cyclin-dependent kinase
           inhibitor that mediates cell cycle arrest in response to
           pheromone also forms a complex with Cdc24p Ste4p and
           Ste18p that may specify the direction of polarized
           growth during mating potential Cdc28p substrate
          Length = 1155

 Score = 34.3 bits (77), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 38/74 (51%), Gaps = 2/74 (2%)

Query: 181 TVCIESIFKLLDDNKLSLTNEGLAIYLFLIHLCPGTSKFIKKSGLLKNLELNSQWKNNDP 240
           TV ++++  L +  KL  TN+ L  Y F +H C GTS  +    LL+  + N   ++   
Sbjct: 817 TVAMDAVSDLFELGKL--TNQILCSYGFSVHHCRGTSNRVNMCELLEGFKYNVTVRDFGS 874

Query: 241 LTKGNLPTLSAVLK 254
           +   + PT+ A L+
Sbjct: 875 VAAIDAPTMVAELQ 888

>YJR066W Chr10 (559416..566828) [7413 bp, 2470 aa] {ON}
           TOR1PIK-related protein kinase and rapamycin target;
           subunit of TORC1, a complex that controls growth in
           response to nutrients by regulating translation,
           transcription, ribosome biogenesis, nutrient transport
           and autophagy; involved in meiosis
          Length = 2470

 Score = 33.9 bits (76), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 41/71 (57%), Gaps = 6/71 (8%)

Query: 9   LFYKLASDLQEERVQAAISLIKELASLENNDSEWEY------VLNRLIKGLSSNRNSARL 62
           +F +L SD +EER  A+ISL   L SLE+  S  E+      + N++++ + + + S R+
Sbjct: 77  IFRELTSDYKEERKLASISLFDLLVSLEHELSIEEFQAVSNDINNKILELVHTKKTSTRV 136

Query: 63  GFSLCLTEVLS 73
           G  L +  ++S
Sbjct: 137 GAVLSIDTLIS 147

>YPR189W Chr16 (912664..916962) [4299 bp, 1432 aa] {ON}  SKI3Ski
            complex component and TPR protein, mediates 3'-5' RNA
            degradation by the cytoplasmic exosome; null mutants have
            superkiller phenotype of increased viral dsRNAs and are
            synthetic lethal with mutations in 5'-3' mRNA decay
          Length = 1432

 Score = 33.1 bits (74), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 42/83 (50%), Gaps = 3/83 (3%)

Query: 333  EKSSGERKYLGFLILEAAFKQVPLSLVSLLFS---KNLMRTLINQSSDSKRILHKISQKV 389
            EK+  ER+   F I++  F ++ L L +   S    +L + +I++SSD K +  KIS  +
Sbjct: 1171 EKTQDERELFNFAIIKGQFARIHLGLGNFELSIENADLSQGIISESSDEKSMKTKISNHI 1230

Query: 390  LASILELCESHPDKTVPSIQAML 412
               +     +  D+T+   Q +L
Sbjct: 1231 CLGLSYFFLNDFDQTLNQFQELL 1253

>SAKL0F05984g Chr6 (448144..451827) [3684 bp, 1227 aa] {ON} highly
           similar to uniprot|P53254 Saccharomyces cerevisiae
           YGR090W UTP22 Possible U3 snoRNP protein involved in
           maturation of pre-18S rRNA based on computational
           analysis of large-scale protein-protein interaction data
          Length = 1227

 Score = 32.7 bits (73), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 36/77 (46%), Gaps = 4/77 (5%)

Query: 207 LFLIHLCPGTSKFIKKSGLLKNLELNSQWKNNDPLTKGNLPTLSAVLKDVSPVEDSGLKQ 266
           ++L +L    S  + K GL+  L+L+ ++ NNDPL     P L    K   P E +  K 
Sbjct: 240 VYLAYLTHHLSIILSKHGLMDFLQLDYEYFNNDPLQ----PILKLSCKTAGPSEYNFYKT 295

Query: 267 KGSWAPRLHFVWNIILP 283
           K S    + F + +  P
Sbjct: 296 KSSINLIVGFPYGLFDP 312

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 98,453,771
Number of extensions: 4187086
Number of successful extensions: 16996
Number of sequences better than 10.0: 56
Number of HSP's gapped: 17131
Number of HSP's successfully gapped: 92
Length of query: 1047
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 927
Effective length of database: 39,721,479
Effective search space: 36821811033
Effective search space used: 36821811033
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 71 (32.0 bits)