Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E00748g6.5ON77477436240.0
KLTH0C11616g6.5ON74066125370.0
Kwal_56.223296.5ON77665224890.0
KLLA0D00748g6.5ON78968024420.0
Ecym_30076.5ON76967823150.0
ACR022W6.5ON75462322940.0
Kpol_1045.836.5ON74862522770.0
TDEL0G046606.5ON73959722480.0
CAGL0A01133g6.5ON80160722260.0
ZYRO0F00396g6.5ON73259622010.0
TPHA0J002206.5ON74062221980.0
NDAI0I027306.5ON83259621710.0
YPL270W (MDL2)6.5ON77361221620.0
NCAS0D022106.5ON77363421530.0
Smik_6.4786.5ON77362821420.0
TBLA0A071906.5ON79460021430.0
Suva_16.356.5ON76761821380.0
Skud_16.76.5ON77361621260.0
KNAG0E028006.5ON74161920080.0
KAFR0B064806.5ON75163018230.0
SAKL0C02244g1.67ON71260914470.0
TDEL0C063501.67ON69361514360.0
ZYRO0F17050g1.67ON71463414330.0
KLLA0C01991g1.67ON70660414300.0
TPHA0B046201.67ON72062014300.0
Ecym_10721.67ON68359814220.0
NCAS0B087001.67ON71560314190.0
NDAI0A005601.67ON71461714190.0
Kpol_2000.791.67ON70761414100.0
YLR188W (MDL1)1.67ON69560913830.0
AFR683C1.67ON67760413751e-180
Kwal_33.133081.67ON70660913771e-180
Skud_12.2531.67ON69261813731e-180
KLTH0F02024g1.67ON73461113651e-178
Smik_12.2481.67ON69661713571e-177
Suva_10.2841.67ON69361613391e-175
TBLA0A053001.67ON70762013241e-172
CAGL0E00385g1.67ON60859312851e-168
SAKL0H00968g5.20ON7003935281e-56
Kwal_26.94805.20ON7193845151e-54
KNAG0E013205.20ON6953825131e-54
NCAS0D024305.20ON7023955033e-53
Skud_13.4755.20ON6914105006e-53
AGL335W5.20ON6914014981e-52
KAFR0I025805.20ON7094004981e-52
KLLA0A10131g5.20ON7204204964e-52
Kpol_513.235.20ON7083874954e-52
NDAI0I024405.20ON7303984954e-52
CAGL0M13739g5.20ON7274104946e-52
TDEL0G004305.20ON6964014902e-51
Smik_13.5185.20ON6874184892e-51
TBLA0C070005.20ON7253864893e-51
KLTH0B09482g5.20ON6944074883e-51
Suva_13.4915.20ON6934044856e-51
YMR301C (ATM1)5.20ON6904044848e-51
TPHA0L022705.20ON7113854733e-49
ZYRO0D07106g5.20ON7093954691e-48
Kpol_1018.1851.527ON12765754752e-48
Ecym_56495.20ON6964074662e-48
KAFR0E002301.527ON12705394707e-48
KNAG0G001901.527ON12755194653e-47
TDEL0F003401.527ON12575544564e-46
YKL209C (STE6)1.527ON12905234539e-46
ZYRO0G02244g1.527ON12734084512e-45
SAKL0A10208g1.527ON13105934503e-45
Smik_11.141.527ON13166484422e-44
TPHA0O001601.527ON12535254422e-44
Suva_11.111.527ON12905304422e-44
TBLA0B100701.527ON12965724404e-44
CAGL0K00363g1.527ON12275134396e-44
AFR432W1.527ON12845374396e-44
Skud_11.111.527ON12956254333e-43
NCAS0G035101.527ON12885244244e-42
KLLA0B14256g1.527ON12714084164e-41
Kwal_33.155611.527ON12976754092e-40
KLTH0B01100g1.527ON12983794075e-40
Ecym_36121.527ON13155234041e-39
NDAI0D015401.527ON12935424031e-39
ZYRO0G07612g4.6ON16955463961e-38
TDEL0E056104.52ON15355843952e-38
KNAG0E011204.6ON17175603942e-38
NCAS0E041605.10ON15066103916e-38
YHL035C (VMR1)4.6ON15925613899e-38
CAGL0C03289g4.6ON16485703881e-37
CAGL0E03355g4.52ON15355523881e-37
Suva_10.234.6ON16615323853e-37
TBLA0G007104.6ON16915483835e-37
Ecym_84184.6ON16785503835e-37
Ecym_42658.303ON15055323826e-37
CAGL0G00242g5.10ON14775583827e-37
KLLA0E00529g4.6ON16505553818e-37
SAKL0H26026g4.6ON16535533782e-36
NDAI0B006405.10ON14915503773e-36
Skud_7.6145.10ON14775653755e-36
YLL048C (YBT1)4.6ON16615373721e-35
CAGL0E03982g4.6ON16595763721e-35
NCAS0J00160singletonON16545473702e-35
YGR281W (YOR1)5.10ON14775653683e-35
KLTH0H16038g4.6ON16495233684e-35
Kwal_56.22747na 1ON15385553666e-35
Skud_8.94.6ON15875233641e-34
Skud_12.224.6ON16615313631e-34
Smik_12.114.6ON16615333622e-34
KAFR0B056308.303ON15155243603e-34
KNAG0J027304.52ON15375613604e-34
NDAI0J011508.303ON15175253604e-34
TPHA0C009608.303ON15235363604e-34
Kpol_311.34.6ON16575183595e-34
Kwal_34.157704.6ON14365163585e-34
Suva_7.5775.10ON14785563561e-33
Smik_8.64.6ON15855363542e-33
CAGL0L06402g8.303ON15355373532e-33
Suva_8.164.6ON15995443532e-33
Kpol_1060.75.10ON14605543523e-33
Smik_12.484.52ON15575513523e-33
NCAS0C059304.6ON16575603523e-33
TPHA0K023104.6ON16495283514e-33
Smik_16.275.10ON14775693506e-33
KLTH0C09240gna 1ON15465583496e-33
TDEL0F043008.303ON15142483498e-33
SAKL0H00704g5.10ON14395643471e-32
KNAG0K001705.10ON14425553461e-32
TDEL0G018504.6ON16425013452e-32
KLLA0D04059g4.52ON15685493452e-32
Smik_11.367na 2ON15955463452e-32
Skud_4.3958.303ON15165423443e-32
KAFR0C065105.10ON14575253433e-32
KAFR0I013004.52ON15365503434e-32
KLLA0F20075g8.303ON15165263424e-32
NCAS0B034708.303ON15125473417e-32
TPHA0F001804.6ON16465263417e-32
Suva_2.2978.303ON15165483408e-32
Kwal_56.238448.303ON14942483409e-32
Kpol_1033.288.303ON15315513391e-31
YDR135C (YCF1)8.303ON15155403372e-31
NDAI0H001904.6ON16825303382e-31
Skud_12.524.52ON15615603363e-31
AGR047W8.303ON14922743363e-31
Smik_4.3808.303ON15165353363e-31
SAKL0H16016g8.303ON14994783354e-31
Suva_10.594.52ON15615583344e-31
Suva_10.60singletonON9905583318e-31
KLTH0G12716g8.303ON15002513319e-31
Skud_18.2singletonON15805403311e-30
TPHA0A056205.10ON14775603311e-30
KAFR0L001904.6ON16535173292e-30
Zrou_YGOB_Anc_5.105.10ON9926353272e-30
TDEL0G003305.10ON14655573265e-30
KLLA0C14234g5.10ON14545543221e-29
TPHA0F004104.52ON15705583231e-29
YLL015W (BPT1)4.52ON15595523212e-29
YKR104WsingletonON3062763012e-29
Kwal_26.95325.10ON14715423202e-29
KNAG0I009908.303ON15355543193e-29
KLTH0B09724g5.10ON14865413193e-29
ACL072C4.6ON16275043185e-29
Kpol_1041.45singletonOFF15965553168e-29
Kpol_YGOB_1041.454.52ON15685553159e-29
ZYRO0G22176g4.52ON15705823141e-28
KLTH0B00396gsingletonON15075553131e-28
ZYRO0D06160g8.303ON15252813104e-28
TBLA0C06400singletonON13775463014e-27
SAKL0H23958g4.52ON15582622917e-26
TBLA0A038008.303ON15465982882e-25
TBLA0A06840singletonON10582512835e-25
TBLA0C071005.10ON14855462845e-25
AGL346W5.10ON14002422731e-23
Ecym_56605.10ON15362572327e-19
YKR103W (NFT1)na 2ON12182692282e-18
Kpol_175.1singletonON13772832023e-15
SAKL0D10208g1.366ON7522361762e-12
NCAS0E004803.534ON6102271743e-12
Suva_5.1343.534ON6102281743e-12
ZYRO0E08800g3.534ON6102411744e-12
Ecym_11943.534ON6091871744e-12
KAFR0A037908.661ON8762151737e-12
SAKL0F01606g3.534ON6081771701e-11
YER036C (ARB1)3.534ON6102411701e-11
KLTH0G01452g3.534ON6072271691e-11
NDAI0I030203.534ON6092271692e-11
TDEL0D060203.534ON6101731682e-11
KNAG0C019601.366ON7522391682e-11
YPL147W (PXA1)8.661ON8702151682e-11
TBLA0C012201.366ON7512261673e-11
Kpol_1050.263.534ON6102281663e-11
Smik_5.1593.534ON6102421663e-11
Skud_5.1453.534ON6102421663e-11
Smik_6.3448.661ON8702151673e-11
Kwal_47.191163.534ON6072351654e-11
TPHA0A058903.534ON6101771654e-11
KLLA0A01452g3.534ON6071771645e-11
Suva_16.1638.661ON8702151656e-11
TPHA0A023101.366ON7522101646e-11
CAGL0K10472g1.366ON7522051646e-11
ZYRO0B14762gsingletonON15152441648e-11
ACR128C8.661ON8272341648e-11
NCAS0D005801.366ON7532281638e-11
NDAI0E012408.661ON8972131648e-11
KAFR0C045401.366ON7522111639e-11
TPHA0D011708.661ON9152161631e-10
NDAI0H035701.366ON7552031621e-10
AFR232C3.534ON6071871611e-10
Kpol_1043.431.366ON7522291611e-10
KNAG0I005301.427ON10472701612e-10
Skud_16.1358.661ON8702151612e-10
TBLA0I033303.534ON6102411602e-10
AEL032W1.366ON7532341593e-10
Kpol_1049.234.6ON110941433e-10
Kwal_26.87308.661ON8312531593e-10
SAKL0H21010gsingletonON14472381593e-10
CAGL0C02343g3.534ON7202451583e-10
Smik_7.3131.366ON7522041584e-10
KNAG0B004603.534ON6601771574e-10
ZYRO0A04114g3.220ON15182441584e-10
KAFR0J027003.534ON6081741574e-10
KNAG0A029808.661ON8712501574e-10
YFR009W (GCN20)1.366ON7522261575e-10
TBLA0D043501.427ON11192451575e-10
KLLA0A10857g1.366ON7522051566e-10
ZYRO0D11880g5.500ON14982241576e-10
TPHA0O010001.427ON10113001566e-10
ZYRO0G01144g1.366ON7522111558e-10
KLLA0F11484g8.661ON8452331559e-10
KAFR0C052205.500ON14992501559e-10
Suva_6.841.366ON7522041541e-09
YOR328W (PDR10)na 3ON15642341541e-09
ZYRO0E04092g1.427ON10622351541e-09
Kpol_1053.483.133ON12882481541e-09
Skud_14.404na 4ON14242381531e-09
Skud_4.2623.220ON15013021532e-09
KAFR0C05210na 5ON14932231532e-09
TPHA0A008403.133ON13122461532e-09
Skud_6.951.366ON7522261522e-09
KLTH0D10890g8.661ON8302001522e-09
ZYRO0B05588g3.133ON12702401522e-09
NCAS0B015308.661ON8682001522e-09
Suva_15.913.133ON13022481522e-09
ZYRO0F07018g8.661ON8612571512e-09
TBLA0D017805.500ON15952241522e-09
Ecym_24108.661ON8282431512e-09
KLLA0D03432g3.220ON14832431522e-09
ZYRO0D11836gna 6ON14622371513e-09
KNAG0B038705.500ON15132221513e-09
YDR011W (SNQ2)3.220ON15012431513e-09
Skud_4.6805.500ON14452541513e-09
Skud_4.681na 5ON14452541513e-09
CAGL0I04862g3.220ON15072391513e-09
Skud_15.495na 3ON15642201513e-09
TBLA0C017808.661ON8881911503e-09
TDEL0D040403.220ON15002331513e-09
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E00748g
         (774 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON...  1400   0.0  
KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} simila...   981   0.0  
Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON...   963   0.0  
KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON...   945   0.0  
Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON} s...   896   0.0  
ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic ho...   888   0.0  
Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON} (1930...   881   0.0  
TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5...   870   0.0  
CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} simila...   862   0.0  
ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON...   852   0.0  
TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON...   851   0.0  
NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {O...   840   0.0  
YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}  MDL2Mitocho...   837   0.0  
NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5      833   0.0  
Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON...   829   0.0  
TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa] ...   830   0.0  
Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W (...   828   0.0  
Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)   823   0.0  
KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5...   778   0.0  
KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa] ...   706   0.0  
SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} simila...   561   0.0  
TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa] ...   557   0.0  
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...   556   0.0  
KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} simila...   555   0.0  
TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa] ...   555   0.0  
Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar t...   552   0.0  
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...   551   0.0  
NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {O...   551   0.0  
Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa] ...   547   0.0  
YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}  MDL1Mitoc...   537   0.0  
AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}...   534   e-180
Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188...   535   e-180
Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188...   533   e-180
KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} simila...   530   e-178
Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188...   527   e-177
Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188...   520   e-175
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...   514   e-172
CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar ...   499   e-168
SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly...   207   1e-56
Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa] ...   202   1e-54
KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.2...   202   1e-54
NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20     198   3e-53
Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {...   197   6e-53
AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homo...   196   1e-52
KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {O...   196   1e-52
KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {...   195   4e-52
Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}...   195   4e-52
NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {O...   195   4e-52
CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa...   194   6e-52
TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20 ...   193   2e-51
Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {...   192   2e-51
TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa] ...   192   3e-51
KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {...   192   3e-51
Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {...   191   6e-51
YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON} ...   191   8e-51
TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {...   186   3e-49
ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} simila...   185   1e-48
Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON} (46...   187   2e-48
Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {O...   184   2e-48
KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON...   185   7e-48
KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON...   183   3e-47
TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON...   180   4e-46
YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}  ...   179   9e-46
ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} simil...   178   2e-45
SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} simil...   177   3e-45
Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON...   174   2e-44
TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {O...   174   2e-44
Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON...   174   2e-44
TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_...   174   4e-44
CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {...   173   6e-44
AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic...   173   6e-44
Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON...   171   3e-43
NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1....   167   4e-42
KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON} sim...   164   4e-41
Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL...   162   2e-40
KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {O...   161   5e-40
Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} simila...   160   1e-39
NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1....   159   1e-39
ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] ...   157   1e-38
TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_...   156   2e-38
KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4....   156   2e-38
NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10    155   6e-38
YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}  V...   154   9e-38
CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} simil...   154   1e-37
CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] ...   154   1e-37
Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON...   152   3e-37
TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4....   152   5e-37
Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar ...   152   5e-37
Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar ...   151   6e-37
CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {O...   151   7e-37
KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {O...   151   8e-37
SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} sim...   150   2e-36
NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10    149   3e-36
Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR28...   149   5e-36
YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}  ...   147   1e-35
CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} simil...   147   1e-35
NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {O...   147   2e-35
YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Pla...   146   3e-35
KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} sim...   146   4e-35
Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL01...   145   6e-35
Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON} Y...   144   1e-34
Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON...   144   1e-34
Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON...   144   2e-34
KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa]...   143   3e-34
KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] ...   143   4e-34
NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] ...   143   4e-34
TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8....   143   4e-34
Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..104...   142   5e-34
Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {O...   142   5e-34
Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR28...   141   1e-33
Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON} Y...   140   2e-33
CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} high...   140   2e-33
Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON} ...   140   2e-33
Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {O...   140   3e-33
Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015...   140   3e-33
NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_...   140   3e-33
TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4...   139   4e-33
Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON...   139   6e-33
KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] ...   139   6e-33
TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {...   139   8e-33
SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar...   138   1e-32
KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {O...   137   1e-32
TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4....   137   2e-32
KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] ...   137   2e-32
Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR10...   137   2e-32
Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {O...   137   3e-32
KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_...   136   3e-32
KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {...   136   4e-32
KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa...   136   4e-32
NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {...   135   7e-32
TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON...   135   7e-32
Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {O...   135   8e-32
Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] ...   135   9e-32
Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {...   135   1e-31
YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON} ...   134   2e-31
NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON...   134   2e-31
Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015...   134   3e-31
AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic h...   134   3e-31
Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {O...   134   3e-31
SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} sim...   133   4e-31
Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015...   133   4e-31
Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W...   132   8e-31
KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} hig...   132   9e-31
Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (R...   132   1e-30
TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_...   132   1e-30
KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {O...   131   2e-30
Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 a...   130   2e-30
TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON...   130   5e-30
KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} sim...   128   1e-29
TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.5...   129   1e-29
YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC ...   128   2e-29
YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative tr...   120   2e-29
Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa]...   127   2e-29
KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8....   127   3e-29
KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] ...   127   3e-29
ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON} ...   127   5e-29
Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]...   126   8e-29
Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 156...   125   9e-29
ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} sim...   125   1e-28
KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {O...   125   1e-28
ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highl...   124   4e-28
TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa]...   120   4e-27
SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa...   116   7e-26
TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {...   115   2e-25
TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_...   113   5e-25
TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON}           114   5e-25
AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic hom...   109   1e-23
Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {...    94   7e-19
YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}  NFT1Puta...    92   2e-18
Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON} comp...    82   3e-15
SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {...    72   2e-12
NCAS0E00480 Chr5 (81549..83381) [1833 bp, 610 aa] {ON}                 72   3e-12
Suva_5.134 Chr5 complement(199609..201441) [1833 bp, 610 aa] {ON...    72   3e-12
ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {...    72   4e-12
Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar t...    72   4e-12
KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {O...    71   7e-12
SAKL0F01606g Chr6 (133318..135144) [1827 bp, 608 aa] {ON} highly...    70   1e-11
YER036C Chr5 complement(223367..225199) [1833 bp, 610 aa] {ON}  ...    70   1e-11
KLTH0G01452g Chr7 (105741..107564) [1824 bp, 607 aa] {ON} highly...    70   1e-11
NDAI0I03020 Chr9 complement(713821..715650) [1830 bp, 609 aa] {O...    70   2e-11
TDEL0D06020 Chr4 complement(1087102..1088934) [1833 bp, 610 aa] ...    69   2e-11
KNAG0C01960 Chr3 complement(380896..383154) [2259 bp, 752 aa] {O...    69   2e-11
YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subun...    69   2e-11
TBLA0C01220 Chr3 complement(263093..265348) [2256 bp, 751 aa] {O...    69   3e-11
Kpol_1050.26 s1050 complement(62452..64284) [1833 bp, 610 aa] {O...    69   3e-11
Smik_5.159 Chr5 complement(228179..230011) [1833 bp, 610 aa] {ON...    69   3e-11
Skud_5.145 Chr5 complement(221173..223005) [1833 bp, 610 aa] {ON...    69   3e-11
Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON...    69   3e-11
Kwal_47.19116 s47 complement(1101559..1103382) [1824 bp, 607 aa]...    68   4e-11
TPHA0A05890 Chr1 complement(1334117..1335949) [1833 bp, 610 aa] ...    68   4e-11
KLLA0A01452g Chr1 (130078..131901) [1824 bp, 607 aa] {ON} highly...    68   5e-11
Suva_16.163 Chr16 (282462..285074) [2613 bp, 870 aa] {ON} YPL147...    68   6e-11
TPHA0A02310 Chr1 (483447..485705) [2259 bp, 752 aa] {ON} Anc_1.3...    68   6e-11
CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} hig...    68   6e-11
ZYRO0B14762g Chr2 (1201028..1205575) [4548 bp, 1515 aa] {ON} sim...    68   8e-11
ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON} S...    68   8e-11
NCAS0D00580 Chr4 (96350..98611) [2262 bp, 753 aa] {ON} Anc_1.366       67   8e-11
NDAI0E01240 Chr5 (244737..247430) [2694 bp, 897 aa] {ON} Anc_8.661     68   8e-11
KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {O...    67   9e-11
TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {O...    67   1e-10
NDAI0H03570 Chr8 complement(872905..875172) [2268 bp, 755 aa] {O...    67   1e-10
AFR232C Chr6 complement(859612..861435) [1824 bp, 607 aa] {ON} S...    67   1e-10
Kpol_1043.43 s1043 complement(86642..88900) [2259 bp, 752 aa] {O...    67   1e-10
KNAG0I00530 Chr9 (88076..91219) [3144 bp, 1047 aa] {ON} Anc_1.42...    67   2e-10
Skud_16.135 Chr16 (244860..247472) [2613 bp, 870 aa] {ON} YPL147...    67   2e-10
TBLA0I03330 Chr9 complement(806242..808074) [1833 bp, 610 aa] {O...    66   2e-10
AEL032W Chr5 (572196..574457) [2262 bp, 753 aa] {ON} Syntenic ho...    66   3e-10
Kpol_1049.23 s1049 complement(67726..68058) [333 bp, 110 aa] {ON...    60   3e-10
Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {O...    66   3e-10
SAKL0H21010g Chr8 (1835185..1839528) [4344 bp, 1447 aa] {ON} sim...    66   3e-10
CAGL0C02343g Chr3 (236112..236391,236790..238672) [2163 bp, 720 ...    65   3e-10
Smik_7.313 Chr7 (524077..526335) [2259 bp, 752 aa] {ON} YFR009W ...    65   4e-10
KNAG0B00460 Chr2 (76565..78547) [1983 bp, 660 aa] {ON} Anc_3.534...    65   4e-10
ZYRO0A04114g Chr1 complement(328582..333138) [4557 bp, 1518 aa] ...    65   4e-10
KAFR0J02700 Chr10 complement(515978..517804) [1827 bp, 608 aa] {...    65   4e-10
KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.6...    65   4e-10
YFR009W Chr6 (162488..164746) [2259 bp, 752 aa] {ON}  GCN20Posit...    65   5e-10
TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]...    65   5e-10
KLLA0A10857g Chr1 complement(941784..944042) [2259 bp, 752 aa] {...    65   6e-10
ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} sim...    65   6e-10
TPHA0O01000 Chr15 (185595..188630) [3036 bp, 1011 aa] {ON} Anc_1...    65   6e-10
ZYRO0G01144g Chr7 (89341..91599) [2259 bp, 752 aa] {ON} highly s...    64   8e-10
KLLA0F11484g Chr6 (1052991..1055528) [2538 bp, 845 aa] {ON} simi...    64   9e-10
KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_...    64   9e-10
Suva_6.84 Chr6 complement(145289..147547) [2259 bp, 752 aa] {ON}...    64   1e-09
YOR328W Chr15 (931803..936497) [4695 bp, 1564 aa] {ON}  PDR10ATP...    64   1e-09
ZYRO0E04092g Chr5 (308495..311683) [3189 bp, 1062 aa] {ON} simil...    64   1e-09
Kpol_1053.48 s1053 complement(92949..93236,93239..96817) [3867 b...    64   1e-09
Skud_14.404 Chr14 (733442..737716) [4275 bp, 1424 aa] {ON} YNR07...    64   1e-09
Skud_4.262 Chr4 (456192..460697) [4506 bp, 1501 aa] {ON} YDR011W...    64   2e-09
KAFR0C05210 Chr3 (1037177..1041658) [4482 bp, 1493 aa] {ON}            64   2e-09
TPHA0A00840 Chr1 complement(163812..167750) [3939 bp, 1312 aa] {...    64   2e-09
Skud_6.95 Chr6 complement(175462..177720) [2259 bp, 752 aa] {ON}...    63   2e-09
KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {...    63   2e-09
ZYRO0B05588g Chr2 (440556..444368) [3813 bp, 1270 aa] {ON} simil...    63   2e-09
NCAS0B01530 Chr2 complement(249743..252349) [2607 bp, 868 aa] {O...    63   2e-09
Suva_15.91 Chr15 complement(162469..166377) [3909 bp, 1302 aa] {...    63   2e-09
ZYRO0F07018g Chr6 complement(571276..573861) [2586 bp, 861 aa] {...    63   2e-09
TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {...    63   2e-09
Ecym_2410 Chr2 (797543..800029) [2487 bp, 828 aa] {ON} similar t...    63   2e-09
KLLA0D03432g Chr4 (287805..292256) [4452 bp, 1483 aa] {ON} simil...    63   2e-09
ZYRO0D11836g Chr4 (993707..998095) [4389 bp, 1462 aa] {ON} simil...    63   3e-09
KNAG0B03870 Chr2 complement(741637..746178) [4542 bp, 1513 aa] {...    63   3e-09
YDR011W Chr4 (465919..470424) [4506 bp, 1501 aa] {ON}  SNQ2Plasm...    63   3e-09
Skud_4.680 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    63   3e-09
Skud_4.681 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    63   3e-09
CAGL0I04862g Chr9 complement(438338..442861) [4524 bp, 1507 aa] ...    63   3e-09
Skud_15.495 Chr15 (871539..876233) [4695 bp, 1564 aa] {ON} YOR32...    63   3e-09
TBLA0C01780 Chr3 complement(421045..423711) [2667 bp, 888 aa] {O...    62   3e-09
TDEL0D04040 Chr4 complement(738550..743052) [4503 bp, 1500 aa] {...    63   3e-09
TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON}              62   4e-09
Kwal_0.327 s0 complement(154643..157702) [3060 bp, 1019 aa] {ON}...    62   4e-09
KAFR0C00820 Chr3 (157878..162431) [4554 bp, 1517 aa] {ON}              62   4e-09
YOL075C Chr15 complement(189658..193542) [3885 bp, 1294 aa] {ON}...    62   5e-09
CAGL0F02717g Chr6 (261361..265989) [4629 bp, 1542 aa] {ON}             62   5e-09
Smik_4.244 Chr4 (445916..450421) [4506 bp, 1501 aa] {ON} YDR011W...    62   5e-09
ZYRO0D11858g Chr4 (998646..1003157) [4512 bp, 1503 aa] {ON} high...    62   5e-09
TDEL0B05760 Chr2 (1017816..1020926) [3111 bp, 1036 aa] {ON} Anc_...    62   5e-09
TDEL0D02370 Chr4 (460691..462952) [2262 bp, 753 aa] {ON} Anc_1.3...    61   8e-09
Smik_4.678 Chr4 (1200036..1204637) [4602 bp, 1533 aa] {ON} YDR40...    61   9e-09
Smik_15.84 Chr15 complement(153969..157856) [3888 bp, 1295 aa] {...    61   9e-09
SAKL0D09394g Chr4 complement(780019..783102) [3084 bp, 1027 aa] ...    61   1e-08
Ecym_2737 Chr2 (1425670..1428726) [3057 bp, 1018 aa] {ON} simila...    61   1e-08
KAFR0C01200 Chr3 (240350..244171) [3822 bp, 1273 aa] {ON} Anc_3....    61   1e-08
YNR070W Chr14 (765375..769376) [4002 bp, 1333 aa] {ON}  PDR18Put...    61   1e-08
YDR406W Chr4 (1279210..1283799) [4590 bp, 1529 aa] {ON}  PDR15Pl...    61   1e-08
TPHA0A04220 Chr1 complement(948357..952811) [4455 bp, 1484 aa] {...    61   1e-08
Smik_15.508 Chr15 (881347..886047) [4701 bp, 1566 aa] {ON} YOR32...    61   1e-08
KNAG0K00950 Chr11 complement(186381..190235) [3855 bp, 1284 aa] ...    60   1e-08
NCAS0F00410 Chr6 (70678..75273) [4596 bp, 1531 aa] {ON}                60   1e-08
Ecym_2714 Chr2 (1380718..1382964) [2247 bp, 748 aa] {ON} similar...    60   2e-08
KLTH0H13442g Chr8 complement(1175860..1178118) [2259 bp, 752 aa]...    60   2e-08
YOR153W Chr15 (619840..624375) [4536 bp, 1511 aa] {ON}  PDR5Plas...    60   2e-08
Kwal_34.16240 s34 (257762..260020) [2259 bp, 752 aa] {ON} YFR009...    60   2e-08
Ecym_3604 Chr3 complement(1143009..1147433) [4425 bp, 1474 aa] {...    60   2e-08
NCAS0A08570 Chr1 (1693304..1696486) [3183 bp, 1060 aa] {ON} Anc_...    60   2e-08
Smik_15.333 Chr15 (575791..580323) [4533 bp, 1510 aa] {ON} YOR15...    60   2e-08
AGL142C Chr7 complement(434247..438740) [4494 bp, 1497 aa] {ON} ...    60   2e-08
CAGL0M01760g Chr13 (203616..208115) [4500 bp, 1499 aa] {ON} high...    60   2e-08
TDEL0A06070 Chr1 complement(1064071..1066689) [2619 bp, 872 aa] ...    60   2e-08
NDAI0C01220 Chr3 (246762..251291) [4530 bp, 1509 aa] {ON} Anc_5....    60   2e-08
CAGL0L07744g Chr12 (851958..855125) [3168 bp, 1055 aa] {ON} simi...    60   2e-08
Suva_2.583 Chr2 (1030711..1035324) [4614 bp, 1537 aa] {ON} YDR40...    60   2e-08
KAFR0F01460 Chr6 (284981..288154) [3174 bp, 1057 aa] {ON} Anc_1....    60   3e-08
NCAS0A12060 Chr1 (2388467..2393098) [4632 bp, 1543 aa] {ON} Anc_...    59   3e-08
KNAG0K01350 Chr11 complement(265564..270069) [4506 bp, 1501 aa] ...    59   4e-08
Kpol_1012.10 s1012 complement(20013..20741,21318..21326,21750..2...    59   4e-08
Kwal_23.5161 s23 (1040608..1045077) [4470 bp, 1489 aa] {ON} YDR0...    59   4e-08
ZYRO0D17710g Chr4 complement(1466189..1470649) [4461 bp, 1486 aa...    59   4e-08
TDEL0A03640 Chr1 (646252..650781) [4530 bp, 1509 aa] {ON} Anc_5....    59   4e-08
Suva_8.379 Chr8 (672487..677184) [4698 bp, 1565 aa] {ON} YPL058C...    59   4e-08
CAGL0M02387g Chr13 (280372..282942) [2571 bp, 856 aa] {ON} simil...    59   5e-08
TPHA0D04700 Chr4 (1026978..1031510) [4533 bp, 1510 aa] {ON}            59   5e-08
KLLA0D04554g Chr4 complement(385733..388801) [3069 bp, 1022 aa] ...    59   6e-08
AER190W Chr5 (994534..997569) [3036 bp, 1011 aa] {ON} Syntenic h...    59   6e-08
Skud_15.317 Chr15 (568579..573117) [4539 bp, 1512 aa] {ON} YOR15...    59   6e-08
NCAS0B05300 Chr2 (980856..984677) [3822 bp, 1273 aa] {ON} Anc_3....    59   6e-08
Smik_14.399 Chr14 (709641..713906) [4266 bp, 1421 aa] {ON} YNR07...    58   7e-08
SAKL0C11616g Chr3 complement(1041794..1046248) [4455 bp, 1484 aa...    58   8e-08
TBLA0A02440 Chr1 complement(582029..586894) [4866 bp, 1621 aa] {...    58   8e-08
NCAS0E01630 Chr5 complement(308563..313260) [4698 bp, 1565 aa] {...    58   8e-08
TPHA0L01500 Chr12 (311715..316274) [4560 bp, 1519 aa] {ON} Anc_8...    58   9e-08
KLTH0G19448g Chr7 (1676895..1681355) [4461 bp, 1486 aa] {ON} sim...    58   9e-08
KAFR0G03010 Chr7 (623976..628094) [4119 bp, 1372 aa] {ON}  YIL013C     58   9e-08
NDAI0A04200 Chr1 complement(948224..952879) [4656 bp, 1551 aa] {...    58   1e-07
Smik_3.97 Chr3 complement(133624..136773) [3150 bp, 1049 aa] {ON...    58   1e-07
KAFR0C03470 Chr3 (707203..708039) [837 bp, 278 aa] {ON} Anc_8.42...    56   1e-07
NDAI0B02870 Chr2 complement(726822..730625) [3804 bp, 1267 aa] {...    57   1e-07
Kpol_1035.32 s1035 (76084..76926) [843 bp, 280 aa] {ON} (76084.....    55   1e-07
Kpol_1037.47 s1037 (114295..118818) [4524 bp, 1507 aa] {ON} (114...    57   1e-07
NCAS0H02420 Chr8 (477754..482316) [4563 bp, 1520 aa] {ON} Anc_5....    57   2e-07
Suva_8.204 Chr8 (368920..373455) [4536 bp, 1511 aa] {ON} YOR153W...    57   2e-07
KNAG0C04500 Chr3 complement(882896..887563) [4668 bp, 1555 aa] {...    57   2e-07
Smik_17.26 Chr17 complement(23946..28454) [4509 bp, 1502 aa] {ON...    57   2e-07
SAKL0H06908g Chr8 (605838..608348) [2511 bp, 836 aa] {ON} simila...    57   2e-07
CAGL0D00352g Chr4 complement(42946..45531) [2586 bp, 861 aa] {ON...    56   2e-07
KLTH0A01914g Chr1 complement(165071..169570) [4500 bp, 1499 aa] ...    57   2e-07
SAKL0G16280g Chr7 (1408229..1410607) [2379 bp, 792 aa] {ON} simi...    56   2e-07
KAFR0E03480 Chr5 complement(701160..705818) [4659 bp, 1552 aa] {...    57   2e-07
YCR011C Chr3 complement(133724..136873) [3150 bp, 1049 aa] {ON} ...    56   3e-07
Suva_3.37 Chr3 complement(47453..50614) [3162 bp, 1053 aa] {ON} ...    56   3e-07
KAFR0E03450 Chr5 complement(689571..694232) [4662 bp, 1553 aa] {...    57   3e-07
TBLA0G02820 Chr7 (745762..750297) [4536 bp, 1511 aa] {ON} Anc_3....    56   3e-07
KLLA0C04477g Chr3 complement(409543..413304) [3762 bp, 1253 aa] ...    56   3e-07
NDAI0G01840 Chr7 complement(404289..408797) [4509 bp, 1502 aa] {...    56   3e-07
TPHA0M00640 Chr13 complement(117604..122076) [4473 bp, 1490 aa] ...    56   3e-07
KLTH0H12760g Chr8 complement(1083450..1086512) [3063 bp, 1020 aa...    56   4e-07
KAFR0E03460 Chr5 complement(695361..700001) [4641 bp, 1546 aa] {...    56   4e-07
KNAG0A02100 Chr1 complement(177773..182290) [4518 bp, 1505 aa] {...    56   4e-07
KAFR0C00830 Chr3 (163830..168284) [4455 bp, 1484 aa] {ON} Anc_3....    56   4e-07
SAKL0G08008g Chr7 complement(673391..678040) [4650 bp, 1549 aa] ...    55   5e-07
KLLA0F21692g Chr6 complement(2014152..2018729) [4578 bp, 1525 aa...    55   5e-07
NCAS0F00790 Chr6 complement(158502..162704) [4203 bp, 1400 aa] {...    55   5e-07
NDAI0G01850 Chr7 complement(409416..413918) [4503 bp, 1500 aa] {...    55   5e-07
Ecym_8014 Chr8 (37756..42309) [4554 bp, 1517 aa] {ON} similar to...    55   6e-07
KAFR0K01230 Chr11 (254346..258488) [4143 bp, 1380 aa] {ON}  YIL013C    55   6e-07
ZYRO0B13266g Chr2 (1074171..1076639) [2469 bp, 822 aa] {ON} simi...    55   6e-07
KNAG0L00680 Chr12 complement(105318..109460) [4143 bp, 1380 aa] ...    55   7e-07
NDAI0G05020 Chr7 (1217458..1220751) [3294 bp, 1097 aa] {ON} Anc_...    55   8e-07
KAFR0E03440 Chr5 complement(684043..688692) [4650 bp, 1549 aa] {...    55   8e-07
NCAS0E01640 Chr5 complement(313479..317987) [4509 bp, 1502 aa] {...    55   8e-07
Kpol_513.9 s513 (23141..27682) [4542 bp, 1513 aa] {ON} (23141..2...    55   9e-07
TDEL0B01210 Chr2 complement(219068..223606) [4539 bp, 1512 aa] {...    55   9e-07
ZYRO0F08866g Chr6 (709888..714450) [4563 bp, 1520 aa] {ON} highl...    55   9e-07
ABR125C Chr2 complement(623888..628354) [4467 bp, 1488 aa] {ON} ...    55   9e-07
NCAS0E01650 Chr5 complement(319448..323914) [4467 bp, 1488 aa] {...    55   1e-06
Kpol_1050.16 s1050 complement(38346..41489) [3144 bp, 1047 aa] {...    54   1e-06
KLTH0E15796g Chr5 (1400194..1403937) [3744 bp, 1247 aa] {ON} sim...    54   1e-06
CAGL0M07293g Chr13 complement(733072..737619) [4548 bp, 1515 aa]...    54   1e-06
Skud_15.174 Chr15 (310212..314393) [4182 bp, 1393 aa] {ON} YALI0...    54   2e-06
SAKL0H10670g Chr8 complement(918091..922620) [4530 bp, 1509 aa] ...    54   2e-06
NDAI0E02950 Chr5 complement(620841..625379) [4539 bp, 1512 aa] {...    54   2e-06
Kwal_33.15623 s33 (1193685..1195373) [1689 bp, 562 aa] {ON} YFR0...    54   2e-06
SAKL0C05654g Chr3 complement(532258..536787) [4530 bp, 1509 aa] ...    54   2e-06
YIL013C Chr9 complement(328207..332442) [4236 bp, 1411 aa] {ON} ...    54   2e-06
ABR126W Chr2 (628624..633162) [4539 bp, 1512 aa] {ON} Non-synten...    53   3e-06
KLLA0B09702g Chr2 complement(842245..846801) [4557 bp, 1518 aa] ...    53   3e-06
Smik_15.185 Chr15 (316883..321064) [4182 bp, 1393 aa] {ON} YNR07...    53   3e-06
TBLA0H03470 Chr8 (847762..852312) [4551 bp, 1516 aa] {ON} Anc_8....    53   3e-06
KLLA0D03476g Chr4 (296287..300969) [4683 bp, 1560 aa] {ON} simil...    53   3e-06
Skud_3.76 Chr3 complement(116029..119199) [3171 bp, 1056 aa] {ON...    52   4e-06
Kwal_27.9666 s27 complement(9636..14060) [4425 bp, 1474 aa] {ON}...    52   4e-06
Kwal_27.12711 s27 (1342807..1346547) [3741 bp, 1246 aa] {ON} YOL...    52   4e-06
ZYRO0F08888g Chr6 (716318..720880) [4563 bp, 1520 aa] {ON} highl...    52   4e-06
Smik_9.181 Chr9 complement(302896..307125) [4230 bp, 1409 aa] {O...    52   5e-06
TBLA0F01040 Chr6 (252002..255817) [3816 bp, 1271 aa] {ON} Anc_3....    52   5e-06
NCAS0C02250 Chr3 complement(418244..422770) [4527 bp, 1508 aa] {...    52   5e-06
CAGL0I08019g Chr9 complement(783133..786990) [3858 bp, 1285 aa] ...    52   6e-06
KAFR0A01180 Chr1 (225692..230218) [4527 bp, 1508 aa] {ON} Anc_8....    52   6e-06
TBLA0A08720 Chr1 complement(2139184..2140668) [1485 bp, 494 aa] ...    51   7e-06
NDAI0A08370 Chr1 complement(1924865..1929079) [4215 bp, 1404 aa]...    52   8e-06
TBLA0I01760 Chr9 (392252..397147) [4896 bp, 1631 aa] {ON} Anc_3....    51   9e-06
Kpol_1036.28 s1036 (70446..70928,73046..77023) [4461 bp, 1486 aa...    51   1e-05
Smik_12.322 Chr12 (581596..584730) [3135 bp, 1044 aa] {ON} YLR24...    51   1e-05
SAKL0C06996g Chr3 complement(649424..654061) [4638 bp, 1545 aa] ...    51   1e-05
Suva_15.188 Chr15 (324904..329088) [4185 bp, 1394 aa] {ON} YOR01...    51   1e-05
CAGL0F01419g Chr6 complement(142623..146819) [4197 bp, 1398 aa] ...    51   1e-05
KNAG0E03270 Chr5 complement(655376..656218) [843 bp, 280 aa] {ON...    49   1e-05
KNAG0G01040 Chr7 (221426..225631) [4206 bp, 1401 aa] {ON}  YIL013C     50   2e-05
Skud_16.225 Chr16 complement(410106..414641) [4536 bp, 1511 aa] ...    50   2e-05
TBLA0A01150 Chr1 (262829..266992) [4164 bp, 1387 aa] {ON}              50   2e-05
Suva_16.256 Chr16 complement(448846..453387) [4542 bp, 1513 aa] ...    50   2e-05
SAKL0C11704g Chr3 (1050447..1054979) [4533 bp, 1510 aa] {ON} sim...    50   2e-05
Skud_12.330 Chr12 (583354..586488) [3135 bp, 1044 aa] {ON} YLR24...    50   2e-05
YOR011W Chr15 (349679..353863) [4185 bp, 1394 aa] {ON}  AUS1Plas...    50   2e-05
Ecym_1312 Chr1 complement(630006..633140) [3135 bp, 1044 aa] {ON...    50   2e-05
YLR249W Chr12 (636780..639914) [3135 bp, 1044 aa] {ON}  YEF3Gamm...    50   2e-05
NCAS0I00670 Chr9 (111140..115240) [4101 bp, 1366 aa] {ON}              50   2e-05
YPL058C Chr16 complement(445842..450377) [4536 bp, 1511 aa] {ON}...    50   3e-05
Smik_16.179 Chr16 complement(321239..325774) [4536 bp, 1511 aa] ...    50   3e-05
TPHA0L00810 Chr12 (157823..161944) [4122 bp, 1373 aa] {ON}             50   3e-05
Skud_15.78 Chr15 complement(148836..152720) [3885 bp, 1294 aa] {...    50   3e-05
KLTH0D15246g Chr4 (1257193..1259589) [2397 bp, 798 aa] {ON} simi...    49   3e-05
Ecym_3605 Chr3 (1148339..1152817) [4479 bp, 1492 aa] {ON} simila...    49   4e-05
AAL028W Chr1 (291808..294942) [3135 bp, 1044 aa] {ON} Syntenic h...    49   4e-05
NDAI0H01280 Chr8 complement(308593..312771) [4179 bp, 1392 aa] {...    49   4e-05
SAKL0C08074g Chr3 complement(747926..751699) [3774 bp, 1257 aa] ...    49   4e-05
Suva_9.192 Chr9 complement(316679..320920) [4242 bp, 1413 aa] {O...    49   4e-05
TDEL0E00840 Chr5 complement(172712..175192) [2481 bp, 826 aa] {O...    49   5e-05
Kwal_0.167 s0 (88989..92123) [3135 bp, 1044 aa] {ON} YNL014W (HE...    49   5e-05
Kpol_487.13 s487 complement(50878..54012) [3135 bp, 1044 aa] {ON...    49   5e-05
SAKL0B01518g Chr2 complement(148745..149542) [798 bp, 265 aa] {O...    47   5e-05
Suva_7.3 Chr7 complement(6379..10671) [4293 bp, 1430 aa] {ON} YN...    49   5e-05
YFL028C Chr6 complement(79344..80213) [870 bp, 289 aa] {ON}  CAF...    47   6e-05
AER091W Chr5 (809767..812172) [2406 bp, 801 aa] {ON} Syntenic ho...    48   7e-05
TBLA0D02530 Chr4 complement(629614..630444) [831 bp, 276 aa] {ON...    47   8e-05
TBLA0D04410 Chr4 complement(1093035..1096169) [3135 bp, 1044 aa]...    48   8e-05
KLLA0B02563g Chr2 complement(222951..225377) [2427 bp, 808 aa] {...    48   9e-05
NCAS0D03950 Chr4 (737216..740788) [3573 bp, 1190 aa] {ON} Anc_6....    48   9e-05
NDAI0A03750 Chr1 complement(849511..851118) [1608 bp, 535 aa] {O...    48   9e-05
KNAG0F01740 Chr6 (326444..329950) [3507 bp, 1168 aa] {ON} Anc_6....    48   1e-04
KNAG0I01340 Chr9 complement(258887..262024) [3138 bp, 1045 aa] {...    48   1e-04
CAGL0B03487g Chr2 complement(345399..348536) [3138 bp, 1045 aa] ...    48   1e-04
YPL226W Chr16 (121767..125357) [3591 bp, 1196 aa] {ON}  NEW1ATP ...    48   1e-04
Skud_16.52 Chr16 (95317..98853) [3537 bp, 1178 aa] {ON} YPL226W ...    48   1e-04
KAFR0H03200 Chr8 complement(610545..613694) [3150 bp, 1049 aa] {...    47   1e-04
KAFR0I02110 Chr9 (433759..436896) [3138 bp, 1045 aa] {ON} Anc_1....    47   1e-04
SAKL0H19294g Chr8 complement(1703651..1705213) [1563 bp, 520 aa]...    47   1e-04
Suva_10.346 Chr10 (604006..607140) [3135 bp, 1044 aa] {ON} YLR24...    47   1e-04
Skud_9.159 Chr9 complement(298165..302388) [4224 bp, 1407 aa] {O...    47   2e-04
NCAS0A06310 Chr1 complement(1243683..1246823) [3141 bp, 1046 aa]...    47   2e-04
NDAI0G03160 Chr7 complement(744284..745141) [858 bp, 285 aa] {ON...    46   2e-04
Smik_6.50 Chr6 complement(94583..95452) [870 bp, 289 aa] {ON} YF...    46   2e-04
KAFR0A07090 Chr1 complement(1427525..1431157) [3633 bp, 1210 aa]...    47   2e-04
Suva_6.30 Chr6 complement(52879..53748) [870 bp, 289 aa] {ON} YF...    46   2e-04
Ecym_3232 Chr3 complement(431386..433830) [2445 bp, 814 aa] {ON}...    47   2e-04
NDAI0I00960 Chr9 complement(226758..230396) [3639 bp, 1212 aa] {...    47   2e-04
Suva_16.80 Chr16 (131166..134702) [3537 bp, 1178 aa] {ON} YPL226...    47   2e-04
NCAS0B04350 Chr2 complement(786960..788561) [1602 bp, 533 aa] {O...    46   2e-04
TBLA0A05970 Chr1 (1471379..1474975) [3597 bp, 1198 aa] {ON} Anc_...    47   2e-04
ZYRO0E05148g Chr5 complement(387268..390405) [3138 bp, 1045 aa] ...    47   3e-04
Smik_6.431 Chr6 complement(699005..702574) [3570 bp, 1189 aa] {O...    47   3e-04
Kwal_23.4045 s23 complement(543590..545875) [2286 bp, 761 aa] {O...    46   3e-04
Kwal_26.6702 s26 complement(29426..31279) [1854 bp, 617 aa] {ON}...    46   3e-04
TPHA0D00450 Chr4 complement(76541..77377) [837 bp, 278 aa] {ON} ...    45   3e-04
TPHA0O00680 Chr15 (128579..131713) [3135 bp, 1044 aa] {ON} Anc_1...    47   3e-04
Skud_14.314 Chr14 (573040..576174) [3135 bp, 1044 aa] {ON} YNL01...    46   3e-04
Kpol_1048.72 s1048 complement(202581..205715) [3135 bp, 1044 aa]...    46   3e-04
KLTH0H11902g Chr8 (1017096..1020230) [3135 bp, 1044 aa] {ON} hig...    46   3e-04
KLLA0C16115g Chr3 (1405766..1409317) [3552 bp, 1183 aa] {ON} sim...    46   3e-04
NCAS0A08760 Chr1 complement(1729600..1732737) [3138 bp, 1045 aa]...    46   3e-04
Kwal_56.24221 s56 complement(908983..912147) [3165 bp, 1054 aa] ...    46   3e-04
Kwal_YGOB_56.24219 s56 complement(908618..909109,909112..912147)...    46   4e-04
KLTH0H03300g Chr8 (295271..298801) [3531 bp, 1176 aa] {ON} simil...    46   4e-04
TDEL0B06150 Chr2 complement(1083103..1086237) [3135 bp, 1044 aa]...    46   4e-04
NDAI0G05180 Chr7 complement(1254531..1257665) [3135 bp, 1044 aa]...    46   4e-04
NDAI0G00810 Chr7 (169366..172515) [3150 bp, 1049 aa] {ON} Anc_1....    46   4e-04
TBLA0G02050 Chr7 complement(537114..540098) [2985 bp, 994 aa] {O...    46   4e-04
Kpol_1002.29 s1002 (89520..93068) [3549 bp, 1182 aa] {ON} (89520...    46   4e-04
Smik_14.315 Chr14 (564639..567773) [3135 bp, 1044 aa] {ON} YNL01...    46   5e-04
Suva_14.333 Chr14 (585838..588972) [3135 bp, 1044 aa] {ON} YNL01...    46   5e-04
YNL014W Chr14 (606319..609453) [3135 bp, 1044 aa] {ON}  HEF3Tran...    45   5e-04
KLLA0F08833g Chr6 (822039..822860) [822 bp, 273 aa] {ON} similar...    44   6e-04
Suva_2.220 Chr2 (374470..376092) [1623 bp, 540 aa] {ON} YDR061W ...    45   6e-04
SAKL0D08316g Chr4 (695101..698235) [3135 bp, 1044 aa] {ON} highl...    45   6e-04
TDEL0F01870 Chr6 (348408..351950) [3543 bp, 1180 aa] {ON} Anc_6....    45   6e-04
TPHA0H01820 Chr8 complement(415382..418765) [3384 bp, 1127 aa] {...    45   6e-04
CAGL0D03674g Chr4 (370066..373626) [3561 bp, 1186 aa] {ON} highl...    45   7e-04
SAKL0A03586g Chr1 (328346..331885) [3540 bp, 1179 aa] {ON} simil...    45   7e-04
NCAS0A02680 Chr1 (510902..513559) [2658 bp, 885 aa] {ON} Anc_4.287     45   7e-04
KAFR0G03410 Chr7 (702624..705056) [2433 bp, 810 aa] {ON} Anc_4.2...    45   8e-04
KAFR0C02740 Chr3 complement(537867..539465) [1599 bp, 532 aa] {O...    45   8e-04
NCAS0C03820 Chr3 complement(774039..774923) [885 bp, 294 aa] {ON...    44   8e-04
TDEL0C00680 Chr3 complement(110674..111519) [846 bp, 281 aa] {ON...    44   0.001
KLLA0F12210g Chr6 (1125630..1128764) [3135 bp, 1044 aa] {ON} hig...    45   0.001
YDR061W Chr4 (574164..575783) [1620 bp, 539 aa] {ON} Protein wit...    44   0.001
CAGL0K12474g Chr11 (1218012..1218896) [885 bp, 294 aa] {ON} simi...    44   0.001
Ecym_1500 Chr1 (1027467..1028318) [852 bp, 283 aa] {ON} similar ...    43   0.002
ZYRO0E07634g Chr5 complement(593495..597025) [3531 bp, 1176 aa] ...    44   0.002
Ecym_2164 Chr2 (314802..318317) [3516 bp, 1171 aa] {ON} similar ...    43   0.003
ZYRO0G09130g Chr7 (732487..734034) [1548 bp, 515 aa] {ON} simila...    43   0.003
KNAG0D04550 Chr4 (824870..827338) [2469 bp, 822 aa] {ON} Anc_4.2...    43   0.003
Kpol_1055.54 s1055 complement(131851..134565) [2715 bp, 904 aa] ...    43   0.003
AFL131W Chr6 (186656..190225) [3570 bp, 1189 aa] {ON} Syntenic h...    43   0.003
NDAI0D04610 Chr4 (1084921..1087599) [2679 bp, 892 aa] {ON} Anc_4...    43   0.004
Kpol_1002.105 s1002 complement(266533..268176) [1644 bp, 547 aa]...    42   0.004
TPHA0H00120 Chr8 complement(11464..13092) [1629 bp, 542 aa] {ON}...    42   0.004
TPHA0B01940 Chr2 (434881..437436) [2556 bp, 851 aa] {ON} Anc_4.2...    42   0.005
KNAG0D02010 Chr4 complement(335815..337413) [1599 bp, 532 aa] {O...    42   0.006
KLTH0H07942g Chr8 complement(696683..698269) [1587 bp, 528 aa] {...    42   0.006
Smik_4.299 Chr4 (540966..542588) [1623 bp, 540 aa] {ON} YDR061W ...    42   0.007
Skud_11.38 Chr11 complement(72504..75071) [2568 bp, 855 aa] {ON}...    42   0.008
Skud_4.316 Chr4 (550218..551840) [1623 bp, 540 aa] {ON} YDR061W ...    41   0.009
Suva_11.36 Chr11 complement(70977..73538) [2562 bp, 853 aa] {ON}...    41   0.013
TDEL0B04340 Chr2 complement(764357..766018) [1662 bp, 553 aa] {O...    41   0.014
YKL188C Chr11 complement(86225..88786) [2562 bp, 853 aa] {ON}  P...    41   0.016
Kwal_YGOB_56.23429 s56 complement(532059..532313,532316..533998)...    40   0.016
Kwal_56.23429 s56 complement(532382..533998) [1617 bp, 539 aa] {...    40   0.016
Smik_11.42 Chr11 complement(71610..74165) [2556 bp, 851 aa] {ON}...    40   0.021
Suva_51.1 Chr51 (3..968) [966 bp, 322 aa] {ON} YDR011W (REAL)          39   0.029
Skud_6.42 Chr6 complement(82602..83471) [870 bp, 289 aa] {ON} YF...    39   0.032
SAKL0H17996g Chr8 (1607260..1609323) [2064 bp, 687 aa] {ON} high...    39   0.040
KLTH0G18326g Chr7 complement(1579374..1580183) [810 bp, 269 aa] ...    39   0.046
YDR091C Chr4 complement(626708..628534) [1827 bp, 608 aa] {ON}  ...    39   0.047
CAGL0G08041g Chr7 complement(758811..760634) [1824 bp, 607 aa] {...    39   0.057
CAGL0G05093g Chr7 complement(483230..484864) [1635 bp, 544 aa] {...    39   0.062
TDEL0A01370 Chr1 (248469..250292) [1824 bp, 607 aa] {ON} Anc_8.2...    39   0.065
ZYRO0F03234g Chr6 complement(273742..274569) [828 bp, 275 aa] {O...    38   0.070
KLLA0C17556g Chr3 complement(1544404..1546227) [1824 bp, 607 aa]...    39   0.075
Kwal_14.1242 s14 (250275..251084) [810 bp, 269 aa] {ON} YFL028C ...    37   0.088
Ecym_5557 Chr5 (1126965..1128539) [1575 bp, 524 aa] {ON} similar...    38   0.095
Smik_4.334 Chr4 complement(592554..594380) [1827 bp, 608 aa] {ON...    38   0.10 
Skud_4.351 Chr4 complement(602770..604596) [1827 bp, 608 aa] {ON...    38   0.13 
KLTH0G14520g Chr7 (1276585..1278411) [1827 bp, 608 aa] {ON} high...    37   0.19 
Kwal_14.2052 s14 complement(589149..590720) [1572 bp, 523 aa] {O...    37   0.21 
Suva_2.252 Chr2 complement(426492..428318) [1827 bp, 608 aa] {ON...    37   0.21 
AGR125W Chr7 (987077..988900) [1824 bp, 607 aa] {ON} Syntenic ho...    37   0.22 
ZYRO0B11616g Chr2 complement(910480..912303) [1824 bp, 607 aa] {...    37   0.29 
KNAG0H02970 Chr8 complement(548970..550802) [1833 bp, 610 aa] {O...    37   0.30 
KLLA0D02156g Chr4 complement(184520..186085) [1566 bp, 521 aa] {...    36   0.33 
Skud_2.358 Chr2 complement(642328..643905) [1578 bp, 525 aa] {ON...    35   0.52 
AFR152C Chr6 complement(710014..710826) [813 bp, 270 aa] {ON} Sy...    35   0.61 
ADR011C Chr4 complement(721693..724926) [3234 bp, 1077 aa] {ON} ...    35   0.61 
TBLA0F03760 Chr6 complement(924333..926159) [1827 bp, 608 aa] {O...    35   0.69 
Ecym_5560 Chr5 complement(1134384..1136207) [1824 bp, 607 aa] {O...    35   0.77 
Smik_5.344 Chr5 complement(529147..535632) [6486 bp, 2161 aa] {O...    35   1.00 
Smik_2.369 Chr2 complement(659801..661306) [1506 bp, 501 aa] {ON...    35   1.0  
NCAS0B04030 Chr2 (730062..731888) [1827 bp, 608 aa] {ON} Anc_8.2...    35   1.1  
KAFR0A02430 Chr1 (508632..510455) [1824 bp, 607 aa] {ON} Anc_8.2...    35   1.1  
CAGL0G08712g Chr7 complement(824549..827584) [3036 bp, 1011 aa] ...    35   1.2  
KLLA0B08888g Chr2 (781251..781766) [516 bp, 171 aa] {ON} similar...    33   1.3  
Suva_4.482 Chr4 complement(843869..845419) [1551 bp, 516 aa] {ON...    34   1.8  
YBR227C Chr2 complement(673572..675134) [1563 bp, 520 aa] {ON}  ...    34   1.9  
TPHA0A01980 Chr1 (400671..402494) [1824 bp, 607 aa] {ON} Anc_8.2...    34   1.9  
Kpol_1032.48 s1032 complement(108249..110072) [1824 bp, 607 aa] ...    33   3.1  
CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} si...    33   4.2  
TPHA0A03200 Chr1 (700189..703593) [3405 bp, 1134 aa] {ON} Anc_7....    33   4.3  
NCAS0B02520 Chr2 (422176..422730) [555 bp, 184 aa] {ON} Anc_8.47...    32   4.4  
Skud_3.19 Chr3 complement(35187..36437) [1251 bp, 416 aa] {ON} Y...    32   4.6  
SAKL0A06908g Chr1 (612325..613836) [1512 bp, 503 aa] {ON} simila...    32   4.8  
KLLA0F05401g Chr6 (529272..532355) [3084 bp, 1027 aa] {ON} highl...    32   5.3  
Kwal_27.11050 s27 (619413..620450) [1038 bp, 345 aa] {ON} YFR007...    32   5.8  
TBLA0D04500 Chr4 (1116012..1117865) [1854 bp, 617 aa] {ON} Anc_7...    32   6.3  
Smik_3.31 Chr3 complement(48547..49797) [1251 bp, 416 aa] {ON} Y...    32   6.4  
NDAI0F01880 Chr6 complement(456673..458262) [1590 bp, 529 aa] {O...    32   6.6  
ADR102W Chr4 (889284..891137) [1854 bp, 617 aa] {ON} Syntenic ho...    32   6.8  
KLTH0H02398g Chr8 (214364..216220) [1857 bp, 618 aa] {ON} unipro...    32   6.9  
YCL044C Chr3 complement(47111..48364) [1254 bp, 417 aa] {ON}  MG...    32   7.0  
KLTH0H06380g Chr8 (559500..561026) [1527 bp, 508 aa] {ON} simila...    32   7.4  
Suva_4.63 Chr4 (115250..117103) [1854 bp, 617 aa] {ON} YDL185W (...    32   7.4  
TPHA0C00140 Chr3 (14138..14818) [681 bp, 226 aa] {ON} Anc_4.388 ...    31   7.5  
NCAS0A13840 Chr1 complement(2715649..2719053) [3405 bp, 1134 aa]...    32   7.6  
Skud_4.74 Chr4 (124231..126084) [1854 bp, 617 aa] {ON} YDL185W (...    32   7.7  
Smik_4.55 Chr4 (105044..106897) [1854 bp, 617 aa] {ON} YDL185W (...    32   7.8  
CAGL0I03960g Chr9 (346238..349339) [3102 bp, 1033 aa] {ON} simil...    32   8.4  
KNAG0C04050 Chr3 (794273..797551) [3279 bp, 1092 aa] {ON} Anc_7....    32   8.7  
Suva_3.168 Chr3 complement(257274..258395) [1122 bp, 373 aa] {ON...    32   8.7  
YDL185W Chr4 (126787..130002) [3216 bp, 1071 aa] {ON}  VMA1Subun...    32   8.8  

>SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 774

 Score = 1400 bits (3624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 696/774 (89%), Positives = 696/774 (89%)

Query: 1   MGNQNXXXXXXXXXXXXXXYAKLAPRSVRLAAVSADRILLSHCRNAYXXXXXXXXXXXXX 60
           MGNQN              YAKLAPRSVRLAAVSADRILLSHCRNAY             
Sbjct: 1   MGNQNLLSPARLLLALHRPYAKLAPRSVRLAAVSADRILLSHCRNAYKPLPTLRLFTTKR 60

Query: 61  XXXGYPSQNKLCDQQCFTKSPISYNFKRSYXXXXXXXXXXXXXXXXXXXXXXQESTSGNS 120
              GYPSQNKLCDQQCFTKSPISYNFKRSY                      QESTSGNS
Sbjct: 61  TLLGYPSQNKLCDQQCFTKSPISYNFKRSYSTTEEKSTATTTSTPTPEQKKEQESTSGNS 120

Query: 121 GAGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAITSDEKPK 180
           GAGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAITSDEKPK
Sbjct: 121 GAGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAITSDEKPK 180

Query: 181 DLRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIH 240
           DLRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIH
Sbjct: 181 DLRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIH 240

Query: 241 QDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXX 300
           QDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISS     
Sbjct: 241 QDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSTLATA 300

Query: 301 XXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRY 360
                    VGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRY
Sbjct: 301 LFLFAPPLLVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRY 360

Query: 361 NHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLY 420
           NHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLY
Sbjct: 361 NHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLY 420

Query: 421 TEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKFENVSF 480
           TEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKFENVSF
Sbjct: 421 TEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKFENVSF 480

Query: 481 SYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDIS 540
           SYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDIS
Sbjct: 481 SYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDIS 540

Query: 541 KISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSD 600
           KISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSD
Sbjct: 541 KISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSD 600

Query: 601 GYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMK 660
           GYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMK
Sbjct: 601 GYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMK 660

Query: 661 SRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKDTT 720
           SRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKDTT
Sbjct: 661 SRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKDTT 720

Query: 721 SKMNAETVEKNDPSPKTEKLNDXXXXXXXXXXXXVLNQVLDDMNYDQKSTSLRP 774
           SKMNAETVEKNDPSPKTEKLND            VLNQVLDDMNYDQKSTSLRP
Sbjct: 721 SKMNAETVEKNDPSPKTEKLNDEEKEEQRRIEEQVLNQVLDDMNYDQKSTSLRP 774

>KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270W MDL2
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane
          Length = 740

 Score =  981 bits (2537), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/661 (73%), Positives = 547/661 (82%), Gaps = 16/661 (2%)

Query: 114 ESTSGNSGAGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAI 173
           EST   S   Y+EI RL RLARHDWKLL VAI LLTIS ++GM +PKVIG+VLD  KNA 
Sbjct: 96  ESTEEKSKTNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNAS 155

Query: 174 TSDEKPKDLRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSN 233
                P  L DLPP+++GLG++DFLA+FAG LV  T ANFGR+VLLR+LGEKLVARLRSN
Sbjct: 156 GGFSGPMTLEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSN 215

Query: 234 VIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHI 293
           VIKK IHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQN+SDGFKAIICGGVGIGMM +I
Sbjct: 216 VIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAIICGGVGIGMMINI 275

Query: 294 SSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAE 353
           S+              VGA IYG+KIR ISR+LQ+STGNLTKV+EEQLSGVKT+Q+FVAE
Sbjct: 276 SASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAE 335

Query: 354 QKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGD 413
            KE+ RYN+AIRKVF  GK+EALTNATFFSST +LGD SFLIVLAYGSHLVLQG LS+GD
Sbjct: 336 GKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGD 395

Query: 414 LTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEI 473
           LTAFMLYTEY+GSAVFGLSNFYSELMKGAGAASRLFE+TDH   I  + G PYVP  GEI
Sbjct: 396 LTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVPSWGEI 455

Query: 474 KFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRIT 533
           KFE+VSFSYPTR  NQIFN LNFTI+ GSNVCVVGPSGRGKSTIASLLL+YY+P SGRI 
Sbjct: 456 KFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIM 515

Query: 534 IDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHN 593
           IDGQ+ISK+S KSLRRHLGVVQQEP+LMSGSIR N+TYG+    T+DEIRSV+KKCFCH 
Sbjct: 516 IDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHG 575

Query: 594 FITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINY 653
           FITKF +GYETVIGP+GA LSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINY
Sbjct: 576 FITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINY 635

Query: 654 TLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLN 713
           TLG+LM+SR++TIISIAHRLSTIRRSENVIVLG+DGSVVEMGKFKELYA+ +S+L+KLLN
Sbjct: 636 TLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLN 695

Query: 714 EKAKDTTSKMNAETVEKNDPSPKTEKLNDXXXXXXXXXXXXVLNQVLDDMNYDQKSTSLR 773
           +K        +  +VE      K  +++D            VL QV +D N DQKS+ L 
Sbjct: 696 DKKPTQLQSQSRNSVET-----KENEVDD-----------QVLEQVANDFNLDQKSSKLT 739

Query: 774 P 774
           P
Sbjct: 740 P 740

>Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON}
           YPL270W (MDL2) - ATP-binding cassette (ABC) transporter
           family member [contig 186] FULL
          Length = 776

 Score =  963 bits (2489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/652 (72%), Positives = 541/652 (82%), Gaps = 13/652 (1%)

Query: 123 GYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAITSDEKPKDL 182
           GYKE+ RLF+LA HDWKLL  AI LL IS  IGM++PKVIGMVLD  KN  +S   P  L
Sbjct: 138 GYKEVIRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGMVLDAIKNTYSSATGPVGL 197

Query: 183 RDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQD 242
            DLPP+V  L +Y+FL +FAGALV+ T ANFGR+VLLR+LGEKLVARLRSNVI+K IHQD
Sbjct: 198 DDLPPIVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQD 257

Query: 243 AEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXX 302
           AEFFDRNKVGDLISRLSSDAYVVSRSMTQN+SDGFKAIICGGVGIGMM +IS        
Sbjct: 258 AEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAIICGGVGIGMMVNISISLTSALL 317

Query: 303 XXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNH 362
                  +GA IYG++IR ISRDLQ+STGNLT+V+EEQLSGVKT+QSFVAE KE++RYN 
Sbjct: 318 MFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNT 377

Query: 363 AIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTE 422
           AIRKVF  GK+EALTNATFFSST+VLGD SFLIVLAYGSHLVLQG L++GDLTAFMLYTE
Sbjct: 378 AIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTE 437

Query: 423 YSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKFENVSFSY 482
           Y+GSAVFGLSNFYSELMKGAGAASRLFE+TDH PSI  T G PYVPG G+I F++VSFSY
Sbjct: 438 YTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPYVPGSGKISFKDVSFSY 497

Query: 483 PTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKI 542
           PTR  NQIFN LNFTI+ GSNVC+VGPSGRGKSTI SLLL+YYNP+SG+ITID QDIS++
Sbjct: 498 PTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRL 557

Query: 543 SAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGY 602
           S KSLRRHLGVVQQEP+LMSGSI+ N+TYG+    ++DEIRSV+KKCFCH F+TKF +GY
Sbjct: 558 SCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGY 617

Query: 603 ETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSR 662
           +T+IGP+GA LSGGQKQRIAIARAL+KKP ILILDEATSALDVESEGAINYTLG+LMKS+
Sbjct: 618 DTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSK 677

Query: 663 DITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKDTTSK 722
           ++TIISIAHRLSTIRRSENVIVLG+DGSVVE+GKFK+LYA ++S+LYKLLN+K +D    
Sbjct: 678 ELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKRD---- 733

Query: 723 MNAETVEKNDPSPKTEKLNDXXXXXXXXXXXXVLNQVLDDMNYDQKSTSLRP 774
                     P+P+ +   +            V  QV +D N DQKS+ L P
Sbjct: 734 ---------KPTPRVQSDPEKDREQEHQIDNQVREQVANDFNLDQKSSKLTP 776

>KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 789

 Score =  945 bits (2442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/680 (67%), Positives = 555/680 (81%), Gaps = 27/680 (3%)

Query: 122 AGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAIT------- 174
            G  ++ RLF LARHDWK+L++A+SLLT+SC+IGMAVPKVIG+VLD  KNA++       
Sbjct: 110 GGLADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPKVIGLVLDATKNALSGSNTNNG 169

Query: 175 ----SDEKPKDLRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARL 230
                D K   L DLPP+V  + LYDF  +F GAL++ T ANFGRVVLL+ILGE+LVARL
Sbjct: 170 NGGLEDSKSLTLDDLPPIVGDIQLYDFFLLFGGALLIGTMANFGRVVLLKILGERLVARL 229

Query: 231 RSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMM 290
           RSNVIKKT+H D EF+DRNKVGDL+SRL +DAY+VSRSMTQNISDGFKA+ICGGVGIGMM
Sbjct: 230 RSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMM 289

Query: 291 FHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSF 350
           FHISS              VGATIYG KIR+ISR+LQQ++GNLTKVAEEQLSG+KTVQSF
Sbjct: 290 FHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSF 349

Query: 351 VAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLS 410
           VAE KE+ RYN+A+R+VF+VGK+EA TNATFFSST+VLGDFSFL+VLAYGSHLVLQG+L+
Sbjct: 350 VAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLT 409

Query: 411 IGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGK 470
           IGDLTAFMLYTEY+GSAVFGLS FYSELMKGAGAA+RLFEL D++P+I +T G  + P  
Sbjct: 410 IGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLN 469

Query: 471 GEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSG 530
           G+++F++VSFSYPTR  NQIF +LNFTI+ GSNVC+VGPSGRGKSTIASLLL+YYNPTSG
Sbjct: 470 GKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSG 529

Query: 531 RITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCF 590
           +I +DGQDI+K+S+KSLRR LGVVQQEPILMSG+IR+NITYGV   P+++EIRSV+KKCF
Sbjct: 530 KILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCF 589

Query: 591 CHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGA 650
           CH FI+KF +GYET+IGP+GALLSGGQKQRIAIARAL+ KP ILILDEATSALDVESEGA
Sbjct: 590 CHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGA 649

Query: 651 INYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYK 710
           INYTLG+LMKS+++TIISIAHRLSTIRRSENVIVLG DGSVVEMGKFK+LYA+ +S L+K
Sbjct: 650 INYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHK 709

Query: 711 LLNEK-----------AKDTTSKMNAETVEKNDPSPKTEKLN-----DXXXXXXXXXXXX 754
           LL E            A    ++ +    E+N      E  N     +            
Sbjct: 710 LLTEPSEQQHSQHQQYAPPAITQESEPQTEENGKDDSGEDQNSDHEENSQDQNEKRLQEE 769

Query: 755 VLNQVLDDMNYDQKSTSLRP 774
           V++QVL+D+++DQK+++LRP
Sbjct: 770 VIHQVLEDISHDQKTSTLRP 789

>Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON}
           similar to Ashbya gossypii ACR022W
          Length = 769

 Score =  896 bits (2315), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/678 (65%), Positives = 537/678 (79%), Gaps = 24/678 (3%)

Query: 120 SGAGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAITS--DE 177
           +  G++E+ RL  LA+HDWKLL VAI LL++SC+IGMAVPKVIG+VLD  KN + S  ++
Sbjct: 93  TSVGWREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSSYEK 152

Query: 178 KPKDLRD------------------LPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLL 219
             +DL                    LPP+V  L +  F+ +FAGALV+   ANFGRVVLL
Sbjct: 153 GSQDLEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLL 212

Query: 220 RILGEKLVARLRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKA 279
           +I+GE+LV+RLRS VIK+T+H D EFFDRNKVGDLISR  SDAYVVSRSMTQN+SDGFKA
Sbjct: 213 KIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKA 272

Query: 280 IICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEE 339
           IICGGVG+GMMFHISS              VGA IYG+KI +ISR LQQS+GNLT+VAEE
Sbjct: 273 IICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEE 332

Query: 340 QLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAY 399
           QL+G++T++SFVAE+KEI+RYN AIR++F VGKREA TNATFFSST++LGD SF+IVL Y
Sbjct: 333 QLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREAFTNATFFSSTTILGDMSFVIVLLY 392

Query: 400 GSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIY 459
           G++LVLQG+LSIGDLTAFMLYTEY+GS+VFGLS FYSELMKGAGAASRLFEL DH+ S+ 
Sbjct: 393 GANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVR 452

Query: 460 ATKGVPYVPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIAS 519
           +       P +G+I+F +VSFSYPTR +NQIF +++FTI+ GSNVC+VGPSG+GKSTI S
Sbjct: 453 SNISHALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITS 512

Query: 520 LLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTI 579
           LLL++Y+P  G I ID  DISK + KSLRRHLGVVQQEP LMSG+IRDNITYG+ YTPT+
Sbjct: 513 LLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTM 572

Query: 580 DEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEA 639
           DEIR VSK+CFCH FITKF DGY+TVIGP+GA LSGGQ+QRIAIARALIKKP ILILDEA
Sbjct: 573 DEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEA 632

Query: 640 TSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKE 699
           TSALDVESEGAINYTLG LM+S+++TIISIAHRLSTIRRSEN+IV+G+DGSVVE+GKF +
Sbjct: 633 TSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDK 692

Query: 700 LYASKESKLYKLLNEKAKDTTSKMNAETVEKNDPSPKTEK---LNDXXXXXXXXXXXXVL 756
           LY ++ES+L+KLLNEK  D  SK +  T +    SPK +    L              V+
Sbjct: 693 LYRNEESELFKLLNEKDHDLVSK-SENTSDIPPDSPKNDDASGLEHLVAEDVASINDKVV 751

Query: 757 NQVLDDMNYDQKSTSLRP 774
             VL+D+ +D+ S++LRP
Sbjct: 752 KNVLNDITHDKNSSTLRP 769

>ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL270W (MDL2)
          Length = 754

 Score =  888 bits (2294), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/623 (69%), Positives = 519/623 (83%), Gaps = 12/623 (1%)

Query: 122 AGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAITSDEK--- 178
           AG+ E+FRL RL + DWKLLL A+ LLTISCSIGMAVPKVIG+VLD  K+A+   EK   
Sbjct: 101 AGWHEVFRLLRLVKPDWKLLLAALGLLTISCSIGMAVPKVIGLVLDATKDAVAQAEKNET 160

Query: 179 --PKDLRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIK 236
             P  L D+P ++    L D LA FAGAL++ + ANFGR+ LL++LGE+LVARLR+ VIK
Sbjct: 161 GAPMSLLDMPSIIGNFTLVDVLAAFAGALLVGSAANFGRMFLLKMLGERLVARLRAQVIK 220

Query: 237 KTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSX 296
           KT+H DAEFFDRNKVGDLISRL SDAY+VSRSMT NISDG KA +CGGVG+GMMFHISS 
Sbjct: 221 KTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISST 280

Query: 297 XXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKE 356
                        + ATIYG++IR+ISR+LQQSTGNLT+V+EEQ +G+KT++SFVAE KE
Sbjct: 281 LTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKE 340

Query: 357 IKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTA 416
           ++RYN A+R++F+V KRE +T+ATFFS T+VLGD SFL+VLAYGSHLVLQG LS+G LTA
Sbjct: 341 MRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTA 400

Query: 417 FMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKFE 476
           FMLYTEY+GS+VFGLSNFYSELMKGAGAASRLFELTD++ S+ +T G  +VP  G I+F+
Sbjct: 401 FMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGRIEFK 460

Query: 477 NVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDG 536
           +VSFSYPTR  +QIF  L  TI  GSNVC+VGPSGRGKSTIASLLL++Y+  SG I IDG
Sbjct: 461 DVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDG 520

Query: 537 QDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFIT 596
           QDISK+SAKSLR+HLGVVQQEP+LMSG+IRDNITYG+ YTP++DEIR+V+KKCFCHNFIT
Sbjct: 521 QDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFIT 580

Query: 597 KFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLG 656
           KF DGY+TVIGP+GALLSGGQ+QRIAIARALIKKP ILILDEATSALDVESEGAINYTLG
Sbjct: 581 KFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLG 640

Query: 657 QLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKA 716
           +LM+S++ITI+SIAHRLSTIRRSEN++VLG+DGSV+E GKF +LY  ++S+L+KLLNE A
Sbjct: 641 RLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNEHA 700

Query: 717 KDTTSKMNAETVEKNDPSPKTEK 739
            +           +  P+P  E+
Sbjct: 701 SEPAKP-------EASPAPAQEE 716

>Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON}
           (193072..195318) [2247 nt, 749 aa]
          Length = 748

 Score =  881 bits (2277), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/625 (68%), Positives = 520/625 (83%), Gaps = 6/625 (0%)

Query: 113 QESTSGNSGAGYK----EIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDV 168
           QES++   G+  K    ++ RL RLA+ DWKLLL AISLL++SC IGM++PK+IG+VLD 
Sbjct: 84  QESSTHTDGSNDKFELSDLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDE 143

Query: 169 AKNAITSDEKPKDLRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVA 228
            K  +++ +   D  D+P + +GL LY+F+++   +L++ T AN+GRV+LLR+L E++VA
Sbjct: 144 LKQIMSNPDFTVD--DVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVA 201

Query: 229 RLRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIG 288
           RLR+NVIKKT+HQDAEFFD NKVGDLISRLSSDAYVVSRS+TQ +SDGFKA++CG VGIG
Sbjct: 202 RLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIG 261

Query: 289 MMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQ 348
           MM  IS               + A+ +GR IR+ SRDLQ++TG+LTKVAEEQ SG+KTVQ
Sbjct: 262 MMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQ 321

Query: 349 SFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGS 408
           SFVAEQKEIKRYNHAIR +F+VGK+ A  NA FFS T+VLGD SFL+VLAYGS+LVL GS
Sbjct: 322 SFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGS 381

Query: 409 LSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVP 468
           LSIGDLTA+M+YTEY+GS++FGLS FYSE+M+GAGAASRLFELTD  PSI  T G  +VP
Sbjct: 382 LSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVP 441

Query: 469 GKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPT 528
            KGEI+F+NVSFSYPTR++NQIF NL+F ID+GSNVC+VGPSGRGKSTIASLLL+YYNPT
Sbjct: 442 NKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPT 501

Query: 529 SGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKK 588
           +G+I +DGQDISK+S+KSLRRH+ +VQQEP+LMSG+IRDNITYG+   PT DE+RS++KK
Sbjct: 502 TGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKK 561

Query: 589 CFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESE 648
           CFCHNFITKF + Y+T++GP G LLSGGQKQRIAIARALIKKP ILILDEATSALDVESE
Sbjct: 562 CFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESE 621

Query: 649 GAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKL 708
           GAINYT G+LMKS+ ITIISIAHRLSTIRRSENVIVLG+DGSV E+GKFKELYA   S+L
Sbjct: 622 GAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSEL 681

Query: 709 YKLLNEKAKDTTSKMNAETVEKNDP 733
            KLL+EKA  +  + N    ++ DP
Sbjct: 682 SKLLHEKATRSERQQNTAEDQEIDP 706

>TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5
           YPL270W
          Length = 739

 Score =  870 bits (2248), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/597 (69%), Positives = 498/597 (83%), Gaps = 3/597 (0%)

Query: 122 AGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAITSDEK--- 178
           +G K++ RL  LA+ DWKLL++AI+LLT+SC IGM +PKVIGM+LDV K  + ++E    
Sbjct: 89  SGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTGLETNEGKDG 148

Query: 179 PKDLRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKT 238
           P  + D+PP+  G  +Y+FL  FA  +V    AN+GR+VLLRIL E++VARLR+NVIKKT
Sbjct: 149 PISMADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRANVIKKT 208

Query: 239 IHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXX 298
           IHQD+EFFDR+KVGDLISRL SDAYVVSRSMTQ +SDGFKA+ICGGVG+GMM  IS    
Sbjct: 209 IHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGVGMMVSISPQLS 268

Query: 299 XXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIK 358
                        A+I+GRKIR  S DLQ++TG LT+V+EEQLSGV+TVQSFVAEQKEI 
Sbjct: 269 GLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIH 328

Query: 359 RYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFM 418
           RY+HAIR +F+VGKR A  NA FF++TS LGD SFL+VLAYGS+LVLQG L+IGDLTAFM
Sbjct: 329 RYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFM 388

Query: 419 LYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKFENV 478
           LYTEY+GS+VFGL++FYSELM+G GAA+RLFELTD  PSI  T G  +VPGKGEI F++V
Sbjct: 389 LYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVPGKGEIVFKDV 448

Query: 479 SFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQD 538
           +FSYPTR  N IF +++  I +GSNVCVVGPSGRGKSTIA LLL++YNP+SG+I IDGQD
Sbjct: 449 TFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQD 508

Query: 539 ISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKF 598
           ISK++ KSLRRH+G+VQQEP+LMSG++RDNITYG+  TP+ +EIR V+K+CFCHNFI KF
Sbjct: 509 ISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKF 568

Query: 599 SDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQL 658
             GY+TVIGP+GALLSGGQKQRIAIARALIKKP IL+LDEATSALDVESEGAINYT GQL
Sbjct: 569 PHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQL 628

Query: 659 MKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEK 715
           MKS+ +TI+SIAHRLSTIRRSEN+IVLG+DGSVVE GKFKEL+A   S+L KLLNEK
Sbjct: 629 MKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADPSSELSKLLNEK 685

>CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 801

 Score =  862 bits (2226), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/607 (67%), Positives = 500/607 (82%), Gaps = 3/607 (0%)

Query: 113 QESTSGNSGAGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNA 172
           ++S +  + + +++I RL  L R DWKLLL A+ LLTISCSIGM +PKVIG++LD  KNA
Sbjct: 106 EQSETKENHSEFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNA 165

Query: 173 ITS---DEKPKDLRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVAR 229
           + +   D +P  +  LPP+V+GL  Y+FL  FA AL++   AN+GR++LLR+L E+LVAR
Sbjct: 166 LAANSVDGQPVSIDKLPPIVFGLSFYEFLGGFALALLVGIAANYGRIILLRVLSERLVAR 225

Query: 230 LRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGM 289
           LR+ VIKKTIHQDAEFFD +KVGDLISRL SDAYVVSRSMTQ +SDGFKA+ICG VGIGM
Sbjct: 226 LRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGM 285

Query: 290 MFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQS 349
           M  +S               + A+++G++I + SR+LQ++TG+LTKVAEEQLSG+KTVQS
Sbjct: 286 MLALSPQLSCLLLVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQS 345

Query: 350 FVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSL 409
           FVAEQ+EI RYN AIR +F++GK+ A+ NA FFSSTS +GD SFL VL +GS+LVLQ SL
Sbjct: 346 FVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSL 405

Query: 410 SIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPG 469
           +IGDLTAFM+YTEY+G+++FGLS FYSE+M+GAGAASRLFELTD  PSI  TKGV Y PG
Sbjct: 406 TIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPG 465

Query: 470 KGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTS 529
            GEI+F+NVSF+YPTR +N IF NLNF I++GSNVC+VGPSGRGKST+A LL KYY P+S
Sbjct: 466 NGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSS 525

Query: 530 GRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKC 589
           G I IDGQ+I+ +++KSLRRH+G+VQQEPILMSG+IRDNI YG+   PT DEIR V+K+C
Sbjct: 526 GEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQC 585

Query: 590 FCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEG 649
           FCHNFIT+F   Y+TVIGP G LLSGGQKQRIAIARALIKKP ILILDEATSALDVESEG
Sbjct: 586 FCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEG 645

Query: 650 AINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLY 709
           AINYT GQLMK +++TI+SIAHRLSTIRRSENVIVLG DGSVVEMGKFKEL+    S+L 
Sbjct: 646 AINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELS 705

Query: 710 KLLNEKA 716
           +LLNEK+
Sbjct: 706 QLLNEKS 712

>ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 732

 Score =  852 bits (2201), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/596 (68%), Positives = 498/596 (83%), Gaps = 1/596 (0%)

Query: 122 AGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAITS-DEKPK 180
           + YK+  RLF LA+ DW+LL  AI+LLTISC IGM++PKVIG+VLDV +  I   D +  
Sbjct: 75  SSYKDAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGIEGKDLQNV 134

Query: 181 DLRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIH 240
           ++ DL P+ +GL +Y FL VFAG L++ T ANF R+V+LRIL E++VARLRS V+ KT+H
Sbjct: 135 NMDDLGPIAFGLTIYQFLGVFAGLLLVGTAANFARIVMLRILSERVVARLRSGVMNKTLH 194

Query: 241 QDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXX 300
           QD+EF+D +KVGDLISRL SDAYVVSRSMTQ +SDGFKA+ICGGVGIGMM  IS      
Sbjct: 195 QDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGV 254

Query: 301 XXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRY 360
                      A+++G+KIR  S+DLQ++TG LT+VAEEQLSGVKTVQSFVAEQ+E+ RY
Sbjct: 255 LLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRY 314

Query: 361 NHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLY 420
           N AIR +++VG++ A  NA FF+ST++LGD SF++VL YGS+LVLQGSL+IGDLTAFMLY
Sbjct: 315 NGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLY 374

Query: 421 TEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKFENVSF 480
           TEY+GS+VFGL+ FYSELM+G GAASRLF+LTDH  SI  TKG  Y+PGKG+I+F+NVSF
Sbjct: 375 TEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKGDIEFKNVSF 434

Query: 481 SYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDIS 540
           SYPTR  NQIF ++N  +  GSNVC+VGPSGRGKSTIA LLL+YYNPT+G+I +DGQDIS
Sbjct: 435 SYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDIS 494

Query: 541 KISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSD 600
           K++ K+LRRH+G+VQQEPILMSG+IRDNITYG+    T +EIRSV+K+CFCHNFITKF D
Sbjct: 495 KVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPD 554

Query: 601 GYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMK 660
           GY+T+IG +GALLSGGQ+QRIAIARALIKKPNIL+LDEATSALDVESEGAINYT GQLMK
Sbjct: 555 GYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMK 614

Query: 661 SRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKA 716
           S  +TI+SIAHRLSTI+RSENVIVLG DGSV+E GKFKEL+A+  S+L KLL EK+
Sbjct: 615 SGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKS 670

>TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON}
           Anc_6.5 YPL270W
          Length = 740

 Score =  851 bits (2198), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/622 (66%), Positives = 500/622 (80%), Gaps = 10/622 (1%)

Query: 126 EIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAITSDEKPK----D 181
           +I RL  LA+ DWKLL +A+ LLT+SC+IGM++PKVIGMVLD+ KNAI+  E  +    D
Sbjct: 76  DIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDLLKNAISKSEDAELGSAD 135

Query: 182 LR----DLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKK 237
           L     +LPP+ +GL LY+FL     AL++ T ANFGRVVLLR+L E++VARLRS VIKK
Sbjct: 136 LSIESSELPPIAFGLSLYEFLGCIGAALLIGTAANFGRVVLLRVLSERVVARLRSQVIKK 195

Query: 238 TIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXX 297
           TIHQDAEFFD NKVGDLISRL SDAYVVSRSMTQ +SDGFKA++CGGVG+GMM  IS   
Sbjct: 196 TIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCGGVGVGMMVSISPEL 255

Query: 298 XXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEI 357
                       + +  +GR IR  SR LQ++TG LT+V+EEQ SGVKTVQ+FVAEQ+EI
Sbjct: 256 SAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREI 315

Query: 358 KRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAF 417
           KRYN+ I+ V++VGK  A  NA  F+ TS LGD SFL+VLAYGS+LVL G LSIGDLTA+
Sbjct: 316 KRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAY 375

Query: 418 MLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKFEN 477
           M+YTE +GSAVFGLS+FYSE+M+G GAASRLFELTD  P I  T G  Y+PGKGEI+F+N
Sbjct: 376 MMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIPGKGEIEFKN 435

Query: 478 VSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQ 537
           VSF+YPTR  +QIF +LNF I+ GSNVC+VGPSGRGKSTIASLLLKYY PT+G IT+DGQ
Sbjct: 436 VSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQ 495

Query: 538 DISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITK 597
           DISK+++KSLRRH+G+VQQEPILMSGSIRDNITYG+ Y  T +EIR V+K+CFCHNFITK
Sbjct: 496 DISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITK 555

Query: 598 FSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQ 657
           F D Y+T++GP G LLSGGQKQRIAIARAL+KKPN+LILDEATSALDVESE AINYT G+
Sbjct: 556 FPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGK 615

Query: 658 LMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAK 717
           LMK +++TIISIAHRLSTIRRSE VIVLG+DGSVVE+GKFK L+ +  S+L +LLNEK+ 
Sbjct: 616 LMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKS- 674

Query: 718 DTTSKMNAETVEKNDPSPKTEK 739
            T ++ N        P  +++K
Sbjct: 675 -TINERNPNEKPAETPEQESQK 695

>NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {ON}
           Anc_6.5
          Length = 832

 Score =  840 bits (2171), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/596 (67%), Positives = 496/596 (83%), Gaps = 4/596 (0%)

Query: 122 AGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAITSDEKPKD 181
           + +K++FRLF L + D+KLL+V+++LLTISC+IGM +PK+IG++LD  K+  T+   P  
Sbjct: 158 SNFKDVFRLFLLVKKDYKLLIVSLTLLTISCTIGMMIPKIIGLILDALKSVATT---PDG 214

Query: 182 LRDLPP-VVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIH 240
               PP +++GL LY+FL  F+ AL +   AN+GR++LLRIL E+LVARLRS V+K T+H
Sbjct: 215 GSSPPPTIMFGLTLYEFLGGFSVALFIGCAANYGRLILLRILSERLVARLRSVVMKHTLH 274

Query: 241 QDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXX 300
           QD+EFFD +KVGDLISRL +D+Y+VSRS+TQ ISDG K++ICGGVGIGMM  +S      
Sbjct: 275 QDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSV 334

Query: 301 XXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRY 360
                    + A+I+G++IR  SR+LQ +TG LT+V+EEQL+GV+TVQSFVAEQ+EIKR+
Sbjct: 335 LVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRF 394

Query: 361 NHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLY 420
           NH+IR++FDVGKR A  NA FF+STS++GD SFL VL YGS+LVL GSL+IGDLTAFMLY
Sbjct: 395 NHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLY 454

Query: 421 TEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKFENVSF 480
           TEY+G+A+FGLS FYSE+M+GAGAASRLFELTD  P+I  T G  Y PGKGEI+F+NVSF
Sbjct: 455 TEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKGEIEFKNVSF 514

Query: 481 SYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDIS 540
           +YPTR +NQIF +LNF I  GSNVC+VGPSG+GKSTIA LLL YYNPTSG+I IDGQDI+
Sbjct: 515 AYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDIT 574

Query: 541 KISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSD 600
           K+++KSLRR + VVQQEP+LMSG+IRDNITYG+   PT +EIR+V+K+CFCHNFI KF  
Sbjct: 575 KLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPY 634

Query: 601 GYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMK 660
            Y+T IGP G LLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYT GQLMK
Sbjct: 635 TYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMK 694

Query: 661 SRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKA 716
           S+ +TI+SIAHRLSTIRRSEN+IVLG+DGSVVEMGKFKEL+A   S+L KLLNEK+
Sbjct: 695 SKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADPTSELSKLLNEKS 750

>YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}
           MDL2Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, required for respiratory
           growth at high temperature; similar to human TAP1 and
           TAP2 implicated in bare lymphocyte syndrome and
           Wegener-like granulomatosis
          Length = 773

 Score =  837 bits (2162), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/612 (69%), Positives = 495/612 (80%), Gaps = 8/612 (1%)

Query: 124 YKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAITSDEKPKDLR 183
           YK+I RLF LA+ DWKLLL AI LLTISCSIGM++PKVIG+VLD  K +  SD       
Sbjct: 102 YKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLKTSSGSD-----FF 156

Query: 184 DLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDA 243
           DL   ++ L LY+FL+ F  AL++   ANFGR +LLRIL E++VARLR+NVIKKT+HQDA
Sbjct: 157 DLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQDA 216

Query: 244 EFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXX 303
           EFFD +KVGDLISRL SDAYVVSRSMTQ +SDG KA+ICG VG+GMM  +S         
Sbjct: 217 EFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLF 276

Query: 304 XXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHA 363
                   A+++G++IR+ S+DLQ++TG LT+VAEEQLSG+KTVQSFVAE  E+ RYN A
Sbjct: 277 FTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVA 336

Query: 364 IRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEY 423
           IR +F VGK  A TNA FF++TS+LGD SFL VLAYGS+LVLQ  LSIGDLTAFMLYTEY
Sbjct: 337 IRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEY 396

Query: 424 SGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKFENVSFSYP 483
           +G+AVFGLS FYSE+M+GAGAASRLFELTD +PSI  T G  Y P +G I+F++VSFSYP
Sbjct: 397 TGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYP 456

Query: 484 TRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKIS 543
           TR + QIF NLNF I  GS+VC+VGPSGRGKSTIA LLL+YYNPT+G ITID QDISK++
Sbjct: 457 TRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLN 516

Query: 544 AKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYE 603
            KSLRRH+G+VQQEP+LMSG+IRDNITYG+ YTPT +EIRSV+K+CFCHNFITKF + Y+
Sbjct: 517 CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYD 576

Query: 604 TVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRD 663
           TVIGP G LLSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYT GQLMKS+ 
Sbjct: 577 TVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKS 636

Query: 664 ITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKDTTSKM 723
           +TI+SIAHRLSTIRRSENVIVLG DGSVVEMGKFKELYA+  S L +LLNEKA    S  
Sbjct: 637 MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNEKAAPGPSDQ 696

Query: 724 NAE---TVEKND 732
             +    +EK D
Sbjct: 697 QLQIEKVIEKED 708

>NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5
          Length = 773

 Score =  833 bits (2153), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/634 (65%), Positives = 506/634 (79%), Gaps = 16/634 (2%)

Query: 115 STSGNSGAGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAIT 174
           STS    + + ++ RLF L + DWKLLLVA++LLTISC IGM +PKVIG++LD  K    
Sbjct: 115 STSEEPKSNFSDVIRLFLLVKTDWKLLLVALTLLTISCVIGMMIPKVIGIILDSLKVQTA 174

Query: 175 SDEKPKDLRDLPPVV-WGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSN 233
           +  + ++    PP++ +GL +Y+FL  F+ AL+    ANFGR++LLRIL E+LVARLRS 
Sbjct: 175 TQSEGEEAP--PPIMMFGLTIYEFLGGFSIALLAGCMANFGRLILLRILSERLVARLRST 232

Query: 234 VIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHI 293
           VIK+TIHQDA+F+D +K GDLISRL +DAY+VSRS+TQ ISDGFK++ICGGVG+GMM  +
Sbjct: 233 VIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSL 292

Query: 294 SSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAE 353
           S               + A+I+G++IR  SR+LQ +TG LT+V+EEQL+GVKTVQSFVAE
Sbjct: 293 SLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAE 352

Query: 354 QKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGD 413
           Q+EIKR+N AIR +F VGKR A  NA FF+STS++GD SFL VL YGS+LVL GSL+IGD
Sbjct: 353 QREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGD 412

Query: 414 LTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEI 473
           LTAFMLYTEY+G+++FGLS FYSE+M+GAGAASRLFELTD+ P I  T G  Y+PGKGEI
Sbjct: 413 LTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGEI 472

Query: 474 KFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRIT 533
           +F+NVSFSYPTR  NQIF NLNF I+ GSNVC+VGPSG+GKSTIA LLL YYNPTSG+I 
Sbjct: 473 EFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQIL 532

Query: 534 IDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHN 593
           IDGQDI+K+++KSLRR LG+VQQEP+LMSGSIRDNITYG+ YTPT +EIR V+K+CFCHN
Sbjct: 533 IDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHN 592

Query: 594 FITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINY 653
           FITKF   Y+T IGP G LLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINY
Sbjct: 593 FITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINY 652

Query: 654 TLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLN 713
           T GQLMK++ +TI+SIAHRLSTIRRSENVIVLG+DGSV+EMGKFKEL++   S+L KLLN
Sbjct: 653 TFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSDPSSELSKLLN 712

Query: 714 EK-------------AKDTTSKMNAETVEKNDPS 734
           EK             A +  +    E VE  DP+
Sbjct: 713 EKSSRKKTKSDPISSAPEVDADATGEPVEPIDPA 746

>Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON}
           YPL270W (REAL)
          Length = 773

 Score =  829 bits (2142), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/628 (67%), Positives = 502/628 (79%), Gaps = 7/628 (1%)

Query: 114 ESTSGNSGAGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAI 173
            ST  +    YK+I RLF LA+ DWKLLL AI LLTISCSIGM++PKVIG+VLD  K + 
Sbjct: 92  HSTEQSKTDDYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLKTSS 151

Query: 174 TSDEKPKDLRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSN 233
            SD       DL   ++ L LY+FL+ F  AL++   ANFGR +LLRIL E++VARLR++
Sbjct: 152 GSD-----FFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAH 206

Query: 234 VIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHI 293
           VIKKT+HQDAEFFD +KVGDLISRL SDAYVVSRSMTQ +SDG KA+ICG VG+GMM  +
Sbjct: 207 VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSL 266

Query: 294 SSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAE 353
           S                 A+++G++IR+ S+DLQ++TG LT+VAEEQLSG+KTVQSFVAE
Sbjct: 267 SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 326

Query: 354 QKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGD 413
             E+ RYN AIR +F VGK  A TNA FF++TS+LGD SFL VLAYGS+LVLQ  LSIGD
Sbjct: 327 GNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGD 386

Query: 414 LTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEI 473
           LTAFMLYTEY+G+AVFGLS FYSE+M+GAGAASRLFELTD +PSI  T G  Y P +G I
Sbjct: 387 LTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERGVI 446

Query: 474 KFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRIT 533
           +F++VSFSYPTR + QIF +LNF I  GS+VC+VGPSGRGKSTIA LLL+YYNPT+G I 
Sbjct: 447 EFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIM 506

Query: 534 IDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHN 593
           ID QDI+K++ KSLRR +G+VQQEP+LMSG+IRDNITYG+ YTPT +EIRSV+K+CFCHN
Sbjct: 507 IDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHN 566

Query: 594 FITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINY 653
           FITKF + Y+TVIGP G LLSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINY
Sbjct: 567 FITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINY 626

Query: 654 TLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLN 713
           T GQLMKS+ +TI+SIAHRLSTIRRSENVIVLG DGSVVEMGKFKELYA+  S L +LLN
Sbjct: 627 TFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLN 686

Query: 714 EKAKDTTS--KMNAETVEKNDPSPKTEK 739
           E+A    S  ++  E VE+ + + + EK
Sbjct: 687 ERAAPGPSDQQLQIEKVEEKEDTNEGEK 714

>TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa]
           {ON} Anc_6.5 YPL270W
          Length = 794

 Score =  830 bits (2143), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/600 (67%), Positives = 489/600 (81%)

Query: 123 GYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAITSDEKPKDL 182
           G  E+ RL  +   DWKLLL+AI+LLTISCSIGMA+PKVIG+VLD  KN +T      + 
Sbjct: 144 GRSELARLVLMTLRDWKLLLLAITLLTISCSIGMAIPKVIGLVLDALKNVMTDSPSSLET 203

Query: 183 RDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQD 242
            DLPP+ +GL LY FL  FAGALV+ T  N+GR +LLR+L E++VARLRS+VIKKT+HQD
Sbjct: 204 SDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQD 263

Query: 243 AEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXX 302
           AEFFD+NKVGDLISRL SDAYVVSRS+TQ +SDGFKAI+CGG GIGMM  IS        
Sbjct: 264 AEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCGGAGIGMMISISPQLSSFLV 323

Query: 303 XXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNH 362
                  + A+I+G+KIR IS  LQ++TG LT+V+EEQL+GVKTVQSFVAEQKEI+RYN+
Sbjct: 324 IFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNN 383

Query: 363 AIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTE 422
           AIR ++++GK  A+ N+ F +STSV+GD SFL+VLAYGS+LVL GSL+IGDLTAFMLYT+
Sbjct: 384 AIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTD 443

Query: 423 YSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKFENVSFSY 482
           Y+ +++FGLSNFYSE+M+G GAA RLF+LTD  P+I  T G  ++PG G I+F N+ F+Y
Sbjct: 444 YTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIPGDGCIEFRNLGFAY 503

Query: 483 PTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKI 542
           PTR  NQ+F NLNF I+ G++VC+VGPSGRGKSTIA LLL+YYNP+SG+I ID QDI K+
Sbjct: 504 PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKL 563

Query: 543 SAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGY 602
           + KSLR+++G+VQQEP+LMSGSIRDNITYG+    T DEIR VSK+CFCHNFITKF D Y
Sbjct: 564 NPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAY 623

Query: 603 ETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSR 662
           ET+IGP G LLSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYT G+LMKS+
Sbjct: 624 ETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSK 683

Query: 663 DITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKDTTSK 722
            +TI+SIAHRLSTIRRSE +IVLG+DGSVVE GKFKELYA   S+L KLLNEK      K
Sbjct: 684 SVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQSRANKK 743

>Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W
           (REAL)
          Length = 767

 Score =  828 bits (2138), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/618 (67%), Positives = 495/618 (80%), Gaps = 5/618 (0%)

Query: 124 YKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAITSDEKPKDLR 183
           YK+I RLF LA+ DWKLLL AI LLTISCSIGM++PKVIG+VLD  K +  SD       
Sbjct: 99  YKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLKTSSGSD-----FF 153

Query: 184 DLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDA 243
           DL   ++ L LY+FL+ F  AL++   ANFGR +LLRIL E++VARLR++VIKKT+HQDA
Sbjct: 154 DLKIPIFSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDA 213

Query: 244 EFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXX 303
           EFFD +KVGDLISRL SDAYVVSRSMTQ +SDG KA+ICG VG+GMM  +S         
Sbjct: 214 EFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSVLLLF 273

Query: 304 XXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHA 363
                   A+++G++IR+ S+DLQ++TG LT+VAEEQLSG+KTVQSFVAE  E+ RYN A
Sbjct: 274 FTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVA 333

Query: 364 IRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEY 423
           IR +F VGK  A TNA FF++TS+LGD SFL VLAYGS+LVLQ  LSIGDLTAFMLYTEY
Sbjct: 334 IRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEY 393

Query: 424 SGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKFENVSFSYP 483
           +G+AVFGLS FYSE+M+GAGAASRLFELTD +PSI  T G  Y P +G I+F++VSFSYP
Sbjct: 394 TGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYP 453

Query: 484 TRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKIS 543
           TR + QIF +LNF I  GS+VC+VGPSGRGKSTIA LLL+YYNPT+G I ID QDI+K++
Sbjct: 454 TRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMN 513

Query: 544 AKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYE 603
            KSLRRH+G+VQQEP+LMSG+IRDNITYG+ YTPT +EIRSV+K+CFCHNFITKF + Y+
Sbjct: 514 CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYD 573

Query: 604 TVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRD 663
           TVIGP G LLSGGQKQRIAIARALIKKP +LILDEATSALDVESEGAINYT GQLMKS+ 
Sbjct: 574 TVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKS 633

Query: 664 ITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKDTTSKM 723
           +TI+SIAHRLSTIRRSENVIVLG DGSVVEMGKFKELY++  S L +LLNE+     S+ 
Sbjct: 634 MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNERTAPVPSEQ 693

Query: 724 NAETVEKNDPSPKTEKLN 741
             +  + N+     E  N
Sbjct: 694 QQQVEKDNEKEEPNEDEN 711

>Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)
          Length = 773

 Score =  823 bits (2126), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/616 (67%), Positives = 495/616 (80%), Gaps = 5/616 (0%)

Query: 124 YKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAITSDEKPKDLR 183
           YK+I RLF LA+ DWKLLL AI LLTISCSIGM++PKVIG+VLD  K +  SD       
Sbjct: 102 YKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLKTSSGSD-----FF 156

Query: 184 DLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDA 243
           +L   ++ L LY+FL+ F  AL++   ANFGR +LLRIL E++VARLR++VIKKT+HQDA
Sbjct: 157 ELKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDA 216

Query: 244 EFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXX 303
           EFFD +KVGDLISRL SDAYVVSRSMTQ +SDG KA+ICG VG+GMM  +S         
Sbjct: 217 EFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLF 276

Query: 304 XXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHA 363
                   A+++G++IR+ S+DLQ++TG LT+VAEEQLSG+KTVQSFVAE  E+ RYN A
Sbjct: 277 FTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVA 336

Query: 364 IRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEY 423
           IR +F VGK  A TNA FF++TS+LGD SFL VLAYGS+LVLQ  LSIGDLTAFMLYTEY
Sbjct: 337 IRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEY 396

Query: 424 SGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKFENVSFSYP 483
           +G+AVFGLS FYSE+M+GAGAASRLFELTD +PSI  T G  Y P +G ++F++VSFSYP
Sbjct: 397 TGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHRGVVEFKDVSFSYP 456

Query: 484 TRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKIS 543
           TR + QIF NLNF I  GS+VC+VGPSGRGKSTIA LLL+YYNP++G I ID QDI+K++
Sbjct: 457 TRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMN 516

Query: 544 AKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYE 603
            KSLRRH+G+VQQEP+LMSG+IRDNITYG+ YTPT +EIRSV+K+CFCHNFITKF + Y+
Sbjct: 517 CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYD 576

Query: 604 TVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRD 663
           TVIG +G LLSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYT G LMKS+ 
Sbjct: 577 TVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKS 636

Query: 664 ITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKDTTSKM 723
           +TIISIAHRLSTIRRSENVIVLG DGSVVEMGKFK+LYA+  S L +LLNE+A    S  
Sbjct: 637 MTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLNERAAPGPSDQ 696

Query: 724 NAETVEKNDPSPKTEK 739
             +  + N+    TE+
Sbjct: 697 QQQIEKDNENEESTEE 712

>KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5
           YPL270W
          Length = 741

 Score =  778 bits (2008), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/619 (62%), Positives = 481/619 (77%), Gaps = 16/619 (2%)

Query: 124 YKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAITSDEKPKDLR 183
           YK+I+RLF L + DWKLL+ A++LLT+SC IGM +PKVIG VLD  K     D + K+  
Sbjct: 88  YKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIGTVLDSLK-----DIQGKEFS 142

Query: 184 DLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDA 243
           +L  ++W + L  F    +G L+L   AN+ RV+LLRIL E LVA+LR+NVIK  IHQDA
Sbjct: 143 EL--MIWDMSLKHFFYGLSGLLLLGCGANYVRVILLRILSENLVAKLRANVIKHIIHQDA 200

Query: 244 EFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHIS-SXXXXXXX 302
           +FFD  KVGDLISR+ +DA++VSRS+TQ ISDG KA+  G  G+GMM  IS         
Sbjct: 201 QFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMLSISIPLSCSILI 260

Query: 303 XXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNH 362
                  + A ++G++IR  S+ LQ+ T NLT+V+EEQ +G+KT+QSFVAEQ E+ ++N 
Sbjct: 261 LMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNG 320

Query: 363 AIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTE 422
           +IRK+F VGK  A  NA FF++ S++GD SFL+VL+YGS LV Q  LS+GDLTAFMLYTE
Sbjct: 321 SIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTE 380

Query: 423 YSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKG-EIKFENVSFS 481
           Y+G+A+F LS F+SE+M+GAGAASR+FELTD +P I  T+G  ++P KG EI+F+NVSF+
Sbjct: 381 YTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIEFKNVSFN 440

Query: 482 YPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISK 541
           YPTR    IF NLNF I+ GSNVC+VGPSG+GKSTIA LLL YYNP+ G+I IDGQDIS 
Sbjct: 441 YPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISA 500

Query: 542 ISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDG 601
           +S KSLRRH+G+VQQEPILMSG+IRDNITYG+ YTPT +EIRSV+K+CFCHNFIT+F D 
Sbjct: 501 LSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDT 560

Query: 602 YETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKS 661
           Y+T IGP G LLSGGQKQRIAIARALIKKP +LILDEATSALDVESEGAINYT GQLMKS
Sbjct: 561 YDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKS 620

Query: 662 RDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEK------ 715
           + +TI+SIAHRLSTIRRSENVIVLG+DGSVVE GKFKEL+A+  S+L KLL EK      
Sbjct: 621 KSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANPASELSKLLREKSSGNNA 680

Query: 716 AKDTTSKMNAETVEKNDPS 734
           A +   +  ++T+E+ DPS
Sbjct: 681 APEIQPQEISQTIEE-DPS 698

>KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa]
           {ON} Anc_6.5 YPL270W
          Length = 751

 Score =  706 bits (1823), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/630 (57%), Positives = 466/630 (73%), Gaps = 19/630 (3%)

Query: 114 ESTSGNSGAGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAI 173
           ++ S ++G+ ++++ RL  L + D KLL++AI LLTISCSIGMA+PK+IG +LD  +N  
Sbjct: 73  KTASTDNGSSWRDLKRLTVLIKKDIKLLVLAIVLLTISCSIGMAIPKIIGTILDTLRNNY 132

Query: 174 TSDEKPKDLRDLPPV-VWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRS 232
                 ++L  L  + +  + L  FL      L+   FANFGRVV+LRI+ E+LV+RLRS
Sbjct: 133 ------ENLTSLSQIKILNIPLSTFLMGVGITLIFGCFANFGRVVILRIISERLVSRLRS 186

Query: 233 NVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFH 292
            V+K  IH+D EFFD  KVGDL+SR+ +DA+VVSRS+T  ++DG ++   G  GIG+M  
Sbjct: 187 QVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSGFIGIFGIGLMLT 246

Query: 293 ISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVA 352
           +S                  +++G++IR  S+ LQ  TG+LT+V EEQ +G++TVQ FVA
Sbjct: 247 LSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVA 306

Query: 353 EQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIG 412
           E+ EIKR+N+ +R++F VGK  A  N  FF+S S++GD  FLIVL YGS+LV+ GS+SIG
Sbjct: 307 ERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIG 366

Query: 413 DLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKG-VPYVP--- 468
           DLTAFMLYTEY+G+A+FGLS+FYSELM+G GAASR+FE+ D +P I +T G   + P   
Sbjct: 367 DLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNE 426

Query: 469 -GKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNP 527
            G  EI+F+NVSF YPTR  NQIF NLNF + +GSNVC+VGPSGRGKSTIASLLL +YN 
Sbjct: 427 VGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNA 486

Query: 528 TSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSK 587
            SG+I IDGQDI+ ++ KSLRR +G+VQQEPILMSG+IRDNITYG+   P+ +EIR V+K
Sbjct: 487 VSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAK 546

Query: 588 KCFCHNFITKFSDGYE--TVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDV 645
           +CFCHNFITKF D Y+     G  G  LSGGQKQRIAIARALIKKPNILILDEATSALDV
Sbjct: 547 QCFCHNFITKFPDTYDTTIGSGSSGTSLSGGQKQRIAIARALIKKPNILILDEATSALDV 606

Query: 646 ESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKE 705
           ESEGAINYT GQ+MKS+ +TI+SIAHRLSTIRR E+VIVLG+DGSVVEMGKFKELY +  
Sbjct: 607 ESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNPT 666

Query: 706 SKLYKLLNEKAKDTTSKMNAETVEKNDPSP 735
           S+L KLLNEK     S     T +  +P P
Sbjct: 667 SELSKLLNEK-----SSTKEATPQPVNPPP 691

>SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 712

 Score =  561 bits (1447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/609 (48%), Positives = 409/609 (67%), Gaps = 22/609 (3%)

Query: 122 AGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKN---------- 171
           +G+K+I RLF LA+ +   +++A+  + IS ++ M +P VIG +LD AK           
Sbjct: 100 SGFKDIKRLFLLAKPETNSMILALVFILISGAVSMTIPSVIGKLLDAAKEGHLAGVSASG 159

Query: 172 ----AITSDEKPKDLRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLV 227
               +  S +  +D  D   +++GL    F        V+  FAN GR+VLL++ GEKLV
Sbjct: 160 EGVGSSDSSDNQEDSSDR--LIYGLTFPQFYTALGTIFVVGAFANMGRIVLLKVTGEKLV 217

Query: 228 ARLRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGI 287
           ARLR+  +K  + QDA F D N+VGDLISRLSSDA +VS+S+TQN+SDG +A+I G VG 
Sbjct: 218 ARLRTRTMKAALQQDATFLDNNRVGDLISRLSSDASIVSKSVTQNLSDGARAVIQGAVGF 277

Query: 288 GMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTV 347
           GMM  IS               V A +YG+KIR++SR LQ S G LTKVAEEQLS  +TV
Sbjct: 278 GMMSFISWKLTCVMTLMAPPLAVMAMVYGKKIRNLSRQLQTSVGGLTKVAEEQLSAARTV 337

Query: 348 QSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQG 407
           Q++  E++EI+RY   +R VF++G +EALT+  FF  T  +G+ + L +L  G+ ++  G
Sbjct: 338 QAYGGEKQEIRRYAGEVRNVFNIGLKEALTSGVFFGVTGFVGNVALLALLLTGTSMIRSG 397

Query: 408 SLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYV 467
           ++++GDL++FM+Y  Y+GS++FGLS+FYSELMKGAGAA+R+FEL D +P I+ TKGV  V
Sbjct: 398 AITVGDLSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTKGVDPV 457

Query: 468 PGKGE-IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYN 526
             +G+ I+F NV+F+YPTR  N+IF+ L+  I  G +VC+VGPSG GKSTIASLLL+YY+
Sbjct: 458 TLQGKTIEFRNVAFAYPTRRENRIFDGLSLDIQPGEHVCIVGPSGGGKSTIASLLLRYYD 517

Query: 527 PTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVS 586
             +GRI I GQDI + + +  RR LGVVQQEP+L +G+I DNITY VP     D+ R VS
Sbjct: 518 VDAGRIAIGGQDIRRFNLRKYRRLLGVVQQEPLLFNGTILDNITYAVPGELAGDDSR-VS 576

Query: 587 K---KCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSAL 643
           +   +  C  F+  F DG ET++GP+GA +SGGQKQRIA+ARA +  P +LILDEATSAL
Sbjct: 577 RAIGQANCTKFLANFPDGLETLVGPRGAQMSGGQKQRIALARAFLLDPAVLILDEATSAL 636

Query: 644 DVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYAS 703
           D +SE  +  +L +    R  T +SIAHRLSTI+ S  VIVL   G V E G F+EL + 
Sbjct: 637 DSQSEEVVAQSL-RSRSRRGKTTVSIAHRLSTIQHSSRVIVLDRHGGVGETGSFRELISD 695

Query: 704 KESKLYKLL 712
            +S L +LL
Sbjct: 696 PDSHLTQLL 704

>TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa]
           {ON} Anc_1.67 YLR188W
          Length = 693

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/615 (47%), Positives = 410/615 (66%), Gaps = 6/615 (0%)

Query: 115 STSGNSGAGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAIT 174
           S S  +G+G+K+I RLFRLA+ +   + +A+ L+ IS ++ M +P ++G +LD+AK+   
Sbjct: 81  SPSDLNGSGFKDIKRLFRLAKPETLQIALALVLILISSAVSMTIPTIVGKLLDIAKD--R 138

Query: 175 SDEKPKDLRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNV 234
            D       D  P ++G+    F        ++   AN GR+V+L+I GE+LVARLR+  
Sbjct: 139 KDADDTTEDDEGPKIFGMTTKQFCTALLAVFLVGAAANAGRIVILKITGERLVARLRTRT 198

Query: 235 IKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHIS 294
           +K  + QDA F D N+VGDLIS LSSDA +V++S+TQN+SDG +A+I G VG GMM +IS
Sbjct: 199 MKAALDQDATFLDTNRVGDLISCLSSDASIVAKSVTQNVSDGTRAVIQGFVGFGMMGYIS 258

Query: 295 SXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQ 354
                          + A +YGRKIR++SR LQ S G LTKV+EEQL  VKT+QS+V E+
Sbjct: 259 WQLTSVMILMIPPLGIMAVVYGRKIRNLSRQLQTSVGGLTKVSEEQLGAVKTIQSYVGEK 318

Query: 355 KEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDL 414
           KEI RY   +R VF++G +EALT+  FF ST ++G+ S L +L  G++++  G +++GDL
Sbjct: 319 KEIHRYATEVRNVFNIGLKEALTSGVFFGSTGLVGNISLLALLMVGTNMIQNGLITVGDL 378

Query: 415 TAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGV-PYVPGKGEI 473
           ++FM+Y  Y+GS++FGLS+FYSELMKGAGAA+R+FEL D +P I  T G  P       I
Sbjct: 379 SSFMMYAVYTGSSMFGLSSFYSELMKGAGAAARVFELKDRKPLIPPTIGQDPVTLANKTI 438

Query: 474 KFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRIT 533
           +FENVSF+YPTR   +IF+ L+ T++ G +VC+VGPSG GKST+ASLLL+YY+   GRI 
Sbjct: 439 RFENVSFTYPTRLNQKIFDGLDITVEPGEHVCIVGPSGSGKSTVASLLLRYYDTNEGRIM 498

Query: 534 IDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVP--YTPTIDEIRSVSKKCFC 591
           I   +I+  + +  RR LG+VQQEP L +G+I DNI Y VP       D I +   +  C
Sbjct: 499 IGDHNINSFNVRKYRRLLGIVQQEPQLFNGTILDNILYTVPPERADNDDLISTAIGQANC 558

Query: 592 HNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI 651
             F+  F DG +T++GP+GA LSGGQKQRIA+ARA +  P++LILDEATSALD +SE  +
Sbjct: 559 SKFLANFPDGLQTLVGPRGAQLSGGQKQRIALARAFLLDPSLLILDEATSALDSQSEEIV 618

Query: 652 NYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKL 711
             TL ++   R +T ISIAHRLSTI+    V+VLG  G VVE G F+EL  +  S+L  L
Sbjct: 619 AQTL-RVRVQRGLTTISIAHRLSTIKNCTRVVVLGKCGQVVESGPFEELLRNPLSELSIL 677

Query: 712 LNEKAKDTTSKMNAE 726
           L+++  +  +   A 
Sbjct: 678 LSQQQDEPETSTPAH 692

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]
           {ON} similar to uniprot|P33310 Saccharomyces cerevisiae
           YLR188W MDL1 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane mediates
           export of peptides generated upon proteolysis of
           mitochondrial proteins plays a role in the regulation of
           cellular resistance to oxidative stress
          Length = 714

 Score =  556 bits (1433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/634 (45%), Positives = 416/634 (65%), Gaps = 13/634 (2%)

Query: 115 STSGNSGAGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAIT 174
           S++  + +G+++I RL  LAR +   ++ A+ L+ IS ++ M +P VIG +LD+AK++  
Sbjct: 81  SSNEKNSSGFRDITRLLGLARPEVWYIMGALCLIVISSTVSMLLPSVIGKLLDLAKSSSP 140

Query: 175 SDEKPKD--------LRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKL 226
           S+ + ++               ++G     F  +  G  V   FAN GR+++L++ GE+L
Sbjct: 141 SENEKQESGDGDDKDKDKEEGTIYGFTPKQFCVIMGGIFVAGAFANCGRIIILKVTGERL 200

Query: 227 VARLRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVG 286
           VARLR+  +K  + QD+ F DRN+VGDLISRLSSD+ +V++S+TQN+SDG +A+I G VG
Sbjct: 201 VARLRTRTMKAALDQDSAFLDRNRVGDLISRLSSDSSIVAKSLTQNVSDGTRAVIQGFVG 260

Query: 287 IGMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKT 346
            GMM +IS                 A IYG+KIR++S+ LQ S G LTKVAEEQL   KT
Sbjct: 261 FGMMTYISWQLTCVMGLMLPPIGAMAIIYGKKIRNLSKQLQTSVGGLTKVAEEQLGATKT 320

Query: 347 VQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQ 406
           +QS+V E+KEI+RY   +R+VFD+G +EALT+  FF ST  +G+ S L +L  G+ ++  
Sbjct: 321 IQSYVGEKKEIRRYAKEVRQVFDIGLKEALTSGMFFGSTGFVGNISLLALLMSGASMIQS 380

Query: 407 GSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGV-P 465
           G +++GDL++FM+Y  Y+G ++FGLSNFYSELMKGAGAA+R+FEL D +P+I  T G  P
Sbjct: 381 GLITVGDLSSFMMYAVYTGGSMFGLSNFYSELMKGAGAAARVFELNDRKPAIAPTLGKGP 440

Query: 466 YVPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYY 525
                  I F++VSF+YPTR   +IFN+LN TI  G ++C+ GPSG GKSTIASLL++YY
Sbjct: 441 TSIRNLPISFKDVSFTYPTRLNKKIFNHLNLTIQPGEHICIAGPSGSGKSTIASLLVRYY 500

Query: 526 NPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIR-- 583
           +   G I+I   D+   + +  RR +GVV QEP+L +G+I +NI Y VP +   DE R  
Sbjct: 501 DVDQGGISIGDTDLRTFNLRKYRRLIGVVHQEPVLFNGTILENILYAVPPSVAQDERRVS 560

Query: 584 SVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSAL 643
           +   K  C  F++ F DG ET++GP+GA LSGGQKQR+A+ARA +  P +L+LDEATSAL
Sbjct: 561 AAIGKANCSKFLSNFPDGLETLVGPRGAQLSGGQKQRVALARAFLLDPALLVLDEATSAL 620

Query: 644 DVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYAS 703
           D +SE  +  TL + ++ R +T ISIAHR+STI  S  V+VLG DG VVE G F+EL   
Sbjct: 621 DSQSEEIVARTLQERVR-RGLTTISIAHRISTIAHSTRVVVLGRDGFVVESGPFQELIDR 679

Query: 704 KESKLYKLLNEKAKDTTSKMNAETVEKNDPSPKT 737
             S+L  LL+ + +D   ++     E  +  P T
Sbjct: 680 PNSELNYLLSLQ-QDEREEIKENPSEPREIQPNT 712

>KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 706

 Score =  555 bits (1430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/604 (48%), Positives = 404/604 (66%), Gaps = 11/604 (1%)

Query: 115 STSGNSGAGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAIT 174
           S   +  +G+++I RLF LA+ + + + +A+ L+ +S ++ MAVP VIG +LD+A+    
Sbjct: 74  SPHDSKASGWQDIKRLFLLAKPETRSMFIALILIILSSAVSMAVPTVIGKLLDIARE--- 130

Query: 175 SDEKPKDLRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNV 234
             E+P+  ++   +++GL    F     G  V+   AN GR+V+L++ GE+LVARLR+  
Sbjct: 131 EHEQPETEKET--MIFGLTSTQFYTALGGVFVVGALANVGRIVILKVTGERLVARLRTRT 188

Query: 235 IKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHIS 294
           +K  + QDA F D N+VGDLISRLSSDA +VS+S+TQN+SDG +A+I G VG GMM  IS
Sbjct: 189 MKAALEQDATFLDHNRVGDLISRLSSDAGIVSKSVTQNLSDGTRAVIQGFVGFGMMSFIS 248

Query: 295 SXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQ 354
                          V A +YG++IR++SR LQ S G LTKV+EEQLS  KT+Q++  E+
Sbjct: 249 WKLTCVMMLLAPPLGVMALVYGKRIRNLSRQLQTSVGELTKVSEEQLSATKTIQAYCGEK 308

Query: 355 KEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDL 414
           KEI RY   +RKVF VG +EALT+  FF  T  +G+ + L +L  G+ ++  G +++GDL
Sbjct: 309 KEIHRYADEVRKVFHVGLKEALTSGAFFGVTGFVGNVALLALLLTGTSMIKTGLMTVGDL 368

Query: 415 TAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGV-PYVPGKGEI 473
           ++FM+Y  Y+GS++FGLS+FYSELMKGAGAA+R+FEL D +P I+ T G  P       I
Sbjct: 369 SSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTIGKDPVTLENKSI 428

Query: 474 KFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRIT 533
            F +V FSYPTR  + IF +LNFT+  G +VC+VGPSG GKST+ASLLL+YY+  SG I 
Sbjct: 429 HFNHVKFSYPTRPQHHIFEDLNFTVRPGEHVCIVGPSGGGKSTVASLLLRYYDIGSGEIK 488

Query: 534 IDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSK---KCF 590
           +   +I   + +  RR LGVVQQEP+L SG+I DNITY VP     DE R +S+   +  
Sbjct: 489 LGNDNIRDFNLRKYRRLLGVVQQEPMLFSGTILDNITYAVPQELVNDETR-ISRAIGQAN 547

Query: 591 CHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGA 650
           C  F+  F DG +T +GP+G  LSGGQKQRIA+ARA +  P+ILILDEATSALD +SE  
Sbjct: 548 CTKFLANFPDGLQTTVGPRGTQLSGGQKQRIALARAFLLDPSILILDEATSALDSQSEEV 607

Query: 651 INYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYK 710
           +  +L Q   +R  T ISIAHR+STI+ S  VIVL   G+V E G F +L A  +S L K
Sbjct: 608 VAQSLQQ-RSARGKTTISIAHRVSTIQHSSRVIVLNRHGTVAETGSFDKLIAIPDSSLNK 666

Query: 711 LLNE 714
           LL++
Sbjct: 667 LLSK 670

>TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa]
           {ON} Anc_1.67 YLR188W
          Length = 720

 Score =  555 bits (1430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/620 (47%), Positives = 414/620 (66%), Gaps = 22/620 (3%)

Query: 115 STSGNSGAGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAI- 173
           S+  ++  G+K++ RLF LA+ +   +++A+ L+ IS ++ M VP VIG +LD++ N   
Sbjct: 84  SSEESTNTGFKDVKRLFTLAKPETAYIVLALVLILISSTVSMVVPSVIGKLLDLSSNTSN 143

Query: 174 --TSDEKPKDLRDLPP-----VVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKL 226
             T D K K+  D         ++G     F A      V+   AN GR+V+L++ GEKL
Sbjct: 144 DDTGDAKSKEKVDNKEDRDNNTIYGFTHTQFFAGLGIVFVIGAIANTGRIVILKVTGEKL 203

Query: 227 VARLRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVG 286
           VARLR+  +K  + QDA F D N+VGDLISRLSSDA +V++S+T N+SDG +AI+ G VG
Sbjct: 204 VARLRTRTMKAALDQDATFLDSNRVGDLISRLSSDASIVAKSVTMNVSDGTRAILQGFVG 263

Query: 287 IGMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKT 346
             MM +IS               + A +YG+KIR++SR LQ + G LTKVAEEQL+  KT
Sbjct: 264 FSMMSYISFKLTSVMVLLIPPLGIMALVYGKKIRNLSRQLQTAVGGLTKVAEEQLNATKT 323

Query: 347 VQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQ 406
           +Q++  E+KEI+RY   +R VFDVG +EA+T+  FF ST ++G+ + L +L  G++++  
Sbjct: 324 IQAYGGEKKEIRRYASEVRDVFDVGLKEAITSGIFFGSTGLVGNAALLSLLLVGTNMISS 383

Query: 407 GSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPY 466
           GSL++GDL++FM+Y  Y+GS++FGLS+FYSELMKGAGAA+R+FEL D +P I  T G   
Sbjct: 384 GSLTVGDLSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELDDRKPLIKPTIGKDP 443

Query: 467 VPGKGE-IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYY 525
           V  KG+ I F++VSF YPTR  +++FN ++F I+ G ++C VGPSG GKST++ LLL+YY
Sbjct: 444 VTLKGKAIIFQDVSFHYPTRPNHRVFNKISFKIEPGEHICFVGPSGSGKSTVSQLLLRYY 503

Query: 526 NPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRS- 584
           + T G I I   +I  +S +  R+ LGVVQQEP+L +G+I DNI Y VP     DEI S 
Sbjct: 504 DATEGNILIGEDNIKSLSLRKYRKLLGVVQQEPMLFNGTIIDNILYNVP-----DEIASQ 558

Query: 585 ------VSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDE 638
                   KK  C  F+  F DG  T++GP+G  LSGGQKQRIAIAR+ +  P+IL+LDE
Sbjct: 559 KNKVDLAIKKSNCTKFLANFPDGLNTIVGPRGTQLSGGQKQRIAIARSFLLDPSILLLDE 618

Query: 639 ATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFK 698
           ATSALD +SE  I  TL +  ++  +T ISIAHRLSTI+ S  V+VL  +GSVVE GKF 
Sbjct: 619 ATSALDTQSEDIIAMTLKK-REAEGLTTISIAHRLSTIKYSSRVVVLNKNGSVVETGKFT 677

Query: 699 ELYASKESKLYKLLNEKAKD 718
           EL A+  S+L  LL+++ ++
Sbjct: 678 ELIANPTSELNLLLSKEGQE 697

>Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar to
           Ashbya gossypii AFR683C
          Length = 683

 Score =  552 bits (1422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/598 (49%), Positives = 402/598 (67%), Gaps = 11/598 (1%)

Query: 123 GYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKN--AITSDEKPK 180
           G+K + RLF+LAR + K L  A+ L+ IS ++ M +P VIG +LD++K   A    ++ +
Sbjct: 79  GFKNVRRLFQLARPEAKSLAFALLLIVISGAVSMTIPSVIGKLLDISKEKEAGGDGDEEQ 138

Query: 181 DLRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIH 240
           + R     ++GL    F     G  V+   AN GR+V+L++ GEKLVARLR+  +K  + 
Sbjct: 139 ETR-----IYGLTEKQFYTALGGVFVIGACANVGRIVILKVTGEKLVARLRTKTMKAALQ 193

Query: 241 QDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXX 300
           QDA F D N+VGDLISRLSSDA +VS+S+TQN SDG +A+I G VG GMM +IS+     
Sbjct: 194 QDAAFLDYNRVGDLISRLSSDASIVSKSITQNTSDGARAVIQGMVGFGMMGYISAQLTGV 253

Query: 301 XXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRY 360
                    + A +YGR+IR+++R+LQ   G LTKVAEEQL+  +T+QS+  E+KEI+RY
Sbjct: 254 MLLLAPPLVLMAMVYGRRIRNLTRELQTRVGGLTKVAEEQLNATRTIQSYCGERKEIRRY 313

Query: 361 NHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLY 420
              +R VF VG REA+T+  FF +T ++G+ + L +L  G+ ++  G++++G+L++FM+Y
Sbjct: 314 AEEVRSVFRVGLREAVTSGAFFGTTGLMGNMALLALLLTGTSMIRSGAITVGELSSFMMY 373

Query: 421 TEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGV-PYVPGKGEIKFENVS 479
             Y+GS++FGLS+FYSELMKGAGAASR+FEL D  P I+ TKG  P      EI+F+NV 
Sbjct: 374 AVYTGSSLFGLSSFYSELMKGAGAASRVFELNDRVPLIHPTKGKDPISLAAKEIEFKNVK 433

Query: 480 FSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDI 539
           FSYP+RS + +F  LN  I  G +VCVVGPSG GKSTI+SLLL++Y+  SG ITI GQ+I
Sbjct: 434 FSYPSRSNHTVFTELNLKIIPGEHVCVVGPSGGGKSTISSLLLRFYDVDSGVITIGGQNI 493

Query: 540 SKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIR--SVSKKCFCHNFITK 597
              + +  RR LG+VQQEP+L +GSI+DNI Y +P     D+ R     +   C  FI+ 
Sbjct: 494 KDFNLRKYRRSLGIVQQEPLLFNGSIKDNICYALPPHIISDKHRVNRALEAANCTRFISN 553

Query: 598 FSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQ 657
           F DG +T++GP+G  LSGGQKQRIAIARA I  P+ILILDEATSALD +SE  I   L  
Sbjct: 554 FPDGLDTMVGPRGTQLSGGQKQRIAIARAFILDPSILILDEATSALDSQSEDIIAQALRA 613

Query: 658 LMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEK 715
             +S  IT ISIAHR+STI  S  VIVL  +G V E G F +L     S L KLL+++
Sbjct: 614 RSESGKIT-ISIAHRISTIEHSNRVIVLSRNGGVSETGAFCDLINQPNSNLNKLLSKE 670

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score =  551 bits (1419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/603 (47%), Positives = 406/603 (67%), Gaps = 12/603 (1%)

Query: 123 GYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAITSDEKPKDL 182
           G K+I RLF+LA+ + K +L+A+  + IS S+ M +P +IG +LD+AK     ++   + 
Sbjct: 92  GMKDIKRLFKLAKPEAKYILLALLFIVISSSVSMTIPTIIGKLLDLAKADNDDEDGDNNA 151

Query: 183 RDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQD 242
           +    +++GL    F     G  +    AN  R+V+L++ GE+LVARLR+  +K  ++QD
Sbjct: 152 KKEKLMIFGLTKPQFYTALGGLFLAGAIANASRIVILKVTGERLVARLRTRTMKAALYQD 211

Query: 243 AEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXX 302
           A F D N+VGDLISRLSSDA +V++++TQN+SDG +A+I G VG GMM  IS        
Sbjct: 212 ASFLDTNRVGDLISRLSSDASIVAKAVTQNVSDGSRAVIQGFVGFGMMSFISWKLTCVMM 271

Query: 303 XXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNH 362
                  V A +YGRKIR++SR LQ S G LTKVAEEQL+  +T+Q++  E  EI RY  
Sbjct: 272 IMVPPLGVMALVYGRKIRTLSRQLQASVGGLTKVAEEQLNATRTIQAYGGEALEIHRYAT 331

Query: 363 AIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTE 422
            +RKVFDVG +EA+T+  FF ST ++G+ + + +L  G+ ++  G+L++GDL++FM+Y  
Sbjct: 332 EVRKVFDVGLKEAVTSGLFFGSTGLVGNIAMISLLLVGTSMIQYGTLTVGDLSSFMMYAV 391

Query: 423 YSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVP----GKGEIKFENV 478
           Y+GS++FGLS FYSELMKGAGAA+R+FEL D +P I  T G  Y P    GK  I+F+NV
Sbjct: 392 YTGSSLFGLSGFYSELMKGAGAATRVFELNDRKPLIKPTIG--YDPKSLLGK-SIEFQNV 448

Query: 479 SFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQD 538
           SF+YPTR  + I NNL+ +I  G +VC+VGPSG GKST++SLLL+YY+ ++G I IDGQ+
Sbjct: 449 SFAYPTRPTHSILNNLSISIQPGEHVCIVGPSGSGKSTVSSLLLRYYDVSTGSIKIDGQN 508

Query: 539 ISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTID----EIRSVSKKCFCHNF 594
           I + + +  RR LGVVQQEP+L +G+I DNI Y V    T+     +++   ++  C  F
Sbjct: 509 IKEFNLRKYRRLLGVVQQEPMLFNGTILDNILYAVLSKETLTANSPDVKRALEQANCTKF 568

Query: 595 ITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYT 654
           +  F +G  T++GP+G  LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +   
Sbjct: 569 LKNFPEGVNTLVGPRGTQLSGGQKQRIALARAFLLHPALLILDEATSALDSQSEEIVAKN 628

Query: 655 LGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNE 714
           L + ++   +T ISIAHRLSTI+ S  VIVL   GSVVE G F+EL     S+L  LL++
Sbjct: 629 LSERVE-LGLTTISIAHRLSTIKHSTRVIVLDKSGSVVETGPFEELVDYSRSELNMLLSQ 687

Query: 715 KAK 717
           + K
Sbjct: 688 QHK 690

>NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {ON}
           Anc_1.67
          Length = 714

 Score =  551 bits (1419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/617 (46%), Positives = 412/617 (66%), Gaps = 7/617 (1%)

Query: 122 AGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAITSDEKPKD 181
           +G+K+I RLF LAR + + + +A+  + IS S+ M VP +IG +LD AK     +E+   
Sbjct: 92  SGFKDIQRLFSLARPELRYIALALLFILISSSVSMTVPSIIGKLLDAAKKGQKENEEEDS 151

Query: 182 LRDLPPVVW-GLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIH 240
              +P + + GL    F        ++   AN GR+++L++ GE+LVARLR+  +K  + 
Sbjct: 152 KTIVPDITFFGLTRTQFYTALGVLFLVGAIANTGRIIILKVTGERLVARLRTRTMKAALD 211

Query: 241 QDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXX 300
           QDA F D N+VGDLISRLSSDA +VS+++TQN+SDG +AII G VG GMM ++S      
Sbjct: 212 QDATFLDANRVGDLISRLSSDAAIVSKAVTQNVSDGTRAIIQGFVGFGMMGYLSWKLTGV 271

Query: 301 XXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRY 360
                    + A +YGRKIR++S+ LQ+S G L+KVAEEQL+  KT+Q++V E+ EI RY
Sbjct: 272 MMLMVPPLGIMALVYGRKIRNLSKQLQESVGGLSKVAEEQLNATKTIQAYVGERLEIHRY 331

Query: 361 NHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLY 420
              +R VF +G +EA+T+  FF ST ++G+ + + +L  G++++  G+L++G+L++FM+Y
Sbjct: 332 ATEVRNVFRIGLKEAVTSGLFFGSTGLVGNIAMISLLLVGTNMIQSGTLTVGELSSFMMY 391

Query: 421 TEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGV-PYVPGKGEIKFENVS 479
             Y+GS++FGLS+FYSELMKGAGAASR+FEL D +P I +T G+ P       IKFENVS
Sbjct: 392 AVYTGSSLFGLSSFYSELMKGAGAASRVFELNDRKPLIKSTVGIDPKTLFGKSIKFENVS 451

Query: 480 FSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDI 539
           F+YP+R  ++IF+NLN  I+ G +VC+VG SG GKSTIASLLL+YY+  +G I I   DI
Sbjct: 452 FTYPSRPNHKIFDNLNLEINPGEHVCIVGFSGSGKSTIASLLLRYYDVNNGSIRIGDNDI 511

Query: 540 SKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDE----IRSVSKKCFCHNFI 595
              S +  RR +G VQQEP L +GSI DNI Y +P   T ++    ++   K+  C+ F+
Sbjct: 512 RNFSLRKYRRLIGTVQQEPSLFNGSILDNIIYAIPPELTSEKQHERVQLAIKQANCNIFL 571

Query: 596 TKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTL 655
            KF DG +T++GP+GA LSGGQKQRIA+ARA +  P +LILDE+TSALD  SE  +  TL
Sbjct: 572 GKFPDGLQTLVGPRGAQLSGGQKQRIALARAFLLDPTLLILDESTSALDSLSEELVAKTL 631

Query: 656 GQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEK 715
            Q   +R +T ISIAHRLSTI+ S  VIV+G  GSVVE G F  L  + +S+L  LL+++
Sbjct: 632 -QARSARGLTTISIAHRLSTIKHSSRVIVIGKYGSVVESGPFDRLIDNPKSELNMLLSQQ 690

Query: 716 AKDTTSKMNAETVEKND 732
            +      + E  E  +
Sbjct: 691 NEHIDEDPSQEKQEPEE 707

>Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa]
           {ON} complement(175048..177171) [2124 nt, 708 aa]
          Length = 707

 Score =  547 bits (1410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/614 (47%), Positives = 402/614 (65%), Gaps = 12/614 (1%)

Query: 113 QESTSGNSG-AGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAK- 170
           Q+ T   SG +G+K++ RLF LAR +   + +A+ L+ IS ++ M VP VIG +LD+AK 
Sbjct: 85  QKLTPDESGRSGFKDVKRLFELARPETFYISIALLLIFISSAVSMVVPSVIGKLLDIAKP 144

Query: 171 ------NAITSDEKPKDLRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGE 224
                 N     EK K+  D    ++GL    F         +   AN GR+++L++ GE
Sbjct: 145 PSADEENGKGVSEKLKEKEDEDKKIYGLTALQFYTALGVVFTVGALANTGRIIILKVTGE 204

Query: 225 KLVARLRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGG 284
           +LVARLR+  +K  + Q+A F D NKVGDLISRLS+DA +V++S+TQN+SDG +AI+ G 
Sbjct: 205 RLVARLRTRTMKAALEQEAAFLDSNKVGDLISRLSTDASIVAKSVTQNVSDGTRAILQGF 264

Query: 285 VGIGMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGV 344
           VG GMM +IS                 A IYGRKIR++SR LQ S G LTKVAEEQL+  
Sbjct: 265 VGFGMMSYISWQLTSVMLLLIPPLGAMAIIYGRKIRNLSRQLQTSVGGLTKVAEEQLNAT 324

Query: 345 KTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLV 404
           +T+Q++  E+KEI RY   +R VFD+G +EA+T+  FF ST ++G+ + L +L  G++++
Sbjct: 325 RTIQAYGGEKKEIHRYATEVRNVFDIGYKEAVTSGLFFGSTGLVGNTALLSLLVVGTNMI 384

Query: 405 LQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGV 464
             G+L++G+L++FM+Y  Y+GS++FGLS FYSELMKGAGAA+R+FEL+D +P+I  T G 
Sbjct: 385 SSGALTVGELSSFMMYAVYTGSSLFGLSTFYSELMKGAGAAARVFELSDRKPAIKPTIGK 444

Query: 465 PYVPGKGE-IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLK 523
             +   G+ ++F+NVSF YPTR   QIF + +  I+ G +VC VGPSG GKST++SLLL+
Sbjct: 445 DPITLFGKTVEFKNVSFWYPTRPKQQIFQDFSIKIEPGEHVCFVGPSGSGKSTVSSLLLR 504

Query: 524 YYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTID--E 581
           YY+   G I + G+DI   S +  RR LGVVQQEP+L +G+I +NI Y VP     +   
Sbjct: 505 YYDVAKGSILVGGEDIKNFSLRKYRRLLGVVQQEPMLFNGTILENILYSVPEEIANEPGR 564

Query: 582 IRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATS 641
           I    +   C  F+  F DG  T++GP+G  LSGGQKQRIA+AR  +  P+ILILDEATS
Sbjct: 565 IERAIESANCSKFLNNFPDGLNTLVGPRGTQLSGGQKQRIALARTFLLDPSILILDEATS 624

Query: 642 ALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELY 701
           ALD +SE  I   L Q    +  T ISIAHRLSTI+ S  V+VLG +G VVE G F+EL 
Sbjct: 625 ALDSQSEDIIAQNL-QARNEKGQTTISIAHRLSTIKHSSRVVVLGKNGCVVETGTFQELI 683

Query: 702 ASKESKLYKLLNEK 715
           ++  S L  LL ++
Sbjct: 684 SNPSSGLNILLTQE 697

>YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}
           MDL1Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, mediates export of peptides
           generated upon proteolysis of mitochondrial proteins,
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 695

 Score =  537 bits (1383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/609 (47%), Positives = 398/609 (65%), Gaps = 12/609 (1%)

Query: 115 STSGNSGAGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAIT 174
           S + +  +G+K+I RLF L++ + K + +A+ L+ IS S+ MAVP VIG +LD+A  +  
Sbjct: 77  SNANSKSSGFKDIKRLFVLSKPESKYIGLALLLILISSSVSMAVPSVIGKLLDLASESDG 136

Query: 175 SDEKPKDLRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNV 234
            DE+      L    +G     F        ++   AN  R+++L++ GE+LVARLR+  
Sbjct: 137 EDEEGSKSNKL----YGFTKKQFFTALGAVFIIGAVANASRIIILKVTGERLVARLRTRT 192

Query: 235 IKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHIS 294
           +K  + QDA F D N+VGDLISRLSSDA +V++S+TQN+SDG +AII G VG GMM  +S
Sbjct: 193 MKAALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLS 252

Query: 295 SXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQ 354
                            A IYGRKIR++SR LQ S G LTKVAEEQL+  +T+Q++  E+
Sbjct: 253 WKLTCVMMILAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEK 312

Query: 355 KEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDL 414
            E++RY   +R VF +G +EA+T+  FF ST ++G+ + L +L  G+ ++  GS+++G+L
Sbjct: 313 NEVRRYAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTSMIQSGSMTVGEL 372

Query: 415 TAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGV-PYVPGKGEI 473
           ++FM+Y  Y+GS++FGLS+FYSELMKGAGAA+R+FEL D +P I  T G  P    +  I
Sbjct: 373 SSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVSLAQKPI 432

Query: 474 KFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRIT 533
            F+NVSF+YPTR  +QIF +LN TI  G +VC VGPSG GKSTIASLLL+YY+  SG I 
Sbjct: 433 VFKNVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIE 492

Query: 534 IDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTI----DEIRSVSKKC 589
              +DI   + +  RR +G VQQEP+L +G+I DNI Y +P  P I    D IR    K 
Sbjct: 493 FGDEDIRNFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIP--PEIAEQDDRIRRAIGKA 550

Query: 590 FCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEG 649
            C  F+  F DG +T++G +GA LSGGQKQRIA+ARA +  P +LILDEATSALD +SE 
Sbjct: 551 NCTKFLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEE 610

Query: 650 AINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLY 709
            +   L Q    R  T ISIAHRLSTI+ S  VIVLG  GSVVE G F++L A   S+L 
Sbjct: 611 IVAKNL-QRRVERGFTTISIAHRLSTIKHSTRVIVLGKHGSVVETGSFRDLIAIPNSELN 669

Query: 710 KLLNEKAKD 718
            LL E+  +
Sbjct: 670 ALLAEQQDE 678

>AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR188W
           (MDL1)
          Length = 677

 Score =  534 bits (1375), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 279/604 (46%), Positives = 399/604 (66%), Gaps = 8/604 (1%)

Query: 115 STSGNSGAGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAIT 174
           ST+  + +G K++ RLF+LAR + K L+ A+ L+ IS ++ M +P VIG +LDVA+  + 
Sbjct: 73  STATGNASGAKDVRRLFQLARPELKSLVCALVLIVISGAVSMTIPSVIGKLLDVAREDVE 132

Query: 175 SDEKPKDLRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNV 234
            +   ++      V++GL    F    +G   +   AN GR+V+L+  GE+LVARLR+  
Sbjct: 133 QESGDEE----EAVLYGLPEKQFYLALSGIFAVGALANMGRIVVLKTTGERLVARLRTRT 188

Query: 235 IKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHIS 294
           +K  + Q+  F D N+VGDLISRLSSDA +VS+S+TQN SDG +A+I G VG GMM +IS
Sbjct: 189 MKAALEQEGAFLDSNRVGDLISRLSSDASIVSKSITQNTSDGARAVIQGAVGFGMMSYIS 248

Query: 295 SXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQ 354
                          + A  YGR++R++SR+LQ   G LTKVAEEQL+  +TVQ++  E+
Sbjct: 249 WQLTAVMTLLAPPLVLMAAFYGRRVRNLSRELQTKVGGLTKVAEEQLNATRTVQAYCGER 308

Query: 355 KEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDL 414
           +EI+RY   +R VFDVG +EAL + +FF +T  +G+ + L +L  G+ ++  G +S+G+L
Sbjct: 309 REIRRYATEVRNVFDVGLKEALISGSFFGATGFVGNATLLALLLTGTSMIKGGGISVGEL 368

Query: 415 TAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGE-I 473
           ++FM+Y  Y+GS++F LS+FYSELMKGAGAA R+FEL D +P I+ T G   V   G+ I
Sbjct: 369 SSFMMYAVYTGSSLFNLSSFYSELMKGAGAAVRVFELNDRKPLIHPTIGKDPVSLTGKTI 428

Query: 474 KFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRIT 533
            F +V+F+YPTR  +Q+F  ++ +I  G +VC+VGPSG GKST+ASLLL++Y+P SG IT
Sbjct: 429 AFNSVNFAYPTRPHHQVFAGMDLSICPGEHVCIVGPSGGGKSTVASLLLRFYDPISGSIT 488

Query: 534 IDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIR--SVSKKCFC 591
           I G+DI   +    RR +G+VQQEP+L + SI +NITY +P   T D  R     +   C
Sbjct: 489 IGGEDIRLFNLSKYRRMMGIVQQEPVLFNASILENITYALPLHLTKDPARIDRALRLSNC 548

Query: 592 HNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI 651
             F+  F +G +T +GP+G  LSGGQKQR+A+ARA ++ P ILILDEATSALD +SE  +
Sbjct: 549 SAFVGSFPEGLQTAVGPRGTQLSGGQKQRVALARAFLQDPAILILDEATSALDSKSEDIV 608

Query: 652 NYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKL 711
             TL Q  +   IT ISIAHR STI+ S  VIVL   G V+E G +++L     S L  L
Sbjct: 609 ASTLLQRCQEAKIT-ISIAHRKSTIQHSTRVIVLDKLGHVLETGTYQQLIGDPGSSLSGL 667

Query: 712 LNEK 715
           L+++
Sbjct: 668 LSKE 671

>Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188W
           (MDL1) - ATP-binding cassette (ABC) transporter family
           member [contig 118] FULL
          Length = 706

 Score =  535 bits (1377), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 286/609 (46%), Positives = 408/609 (66%), Gaps = 18/609 (2%)

Query: 119 NSGAGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAITSDEK 178
           ++ + +K+I RLF+LAR + + +  A++L+ IS S+ M VP VIG ++D AK+    D++
Sbjct: 79  HNSSSWKDIKRLFQLARPESRSMFFALALIIISSSVSMLVPGVIGKLMDAAKD----DQQ 134

Query: 179 PKDLRD----------LPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVA 228
              L +              ++GL +  F  V     V+   AN GR+V+L++ GEKLVA
Sbjct: 135 ASKLVENDSDAAAPDADGRQIFGLTMPQFYGVLFSVFVVGAAANMGRIVILKVTGEKLVA 194

Query: 229 RLRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIG 288
           RLR+  +K ++ QDA F D NKVGDLISRLSSDA +VS+S+TQN+SDG +++I G VG G
Sbjct: 195 RLRTRTLKASLQQDASFLDNNKVGDLISRLSSDASIVSKSLTQNMSDGTRSLIQGFVGFG 254

Query: 289 MMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQ 348
           MM +IS                 A IYG++IR++SR LQ S G LTK AEEQLS  +T+Q
Sbjct: 255 MMSYISWKLTCVMMLLAPPLAAMALIYGKRIRNLSRTLQASVGGLTKAAEEQLSATRTIQ 314

Query: 349 SFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGS 408
           ++  E+  I +Y   +R+V+ VG +EALT+  FF  T ++G+ + L +L  G+ ++  G+
Sbjct: 315 AYGGEKHAIHQYAKEVRQVYQVGLKEALTSGAFFGLTGLVGNVAVLALLLTGTSMIRTGA 374

Query: 409 LSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVP 468
           +++GDL++FM+Y  Y+GS++FG+S+FYSELMKGAGAA+R+FEL D +P+I+ T+G+  V 
Sbjct: 375 MTLGDLSSFMIYAVYTGSSLFGMSSFYSELMKGAGAAARVFELNDRRPAIHPTRGIDPVS 434

Query: 469 GKGE-IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNP 527
             G+ ++F+NV F+YPTR  + IF NL F I++G +VC+VGPSG GKST+ASLLL++Y+ 
Sbjct: 435 LAGKPVEFQNVKFAYPTRHQHTIFENLTFRINAGEHVCIVGPSGGGKSTVASLLLRFYDV 494

Query: 528 TSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSK 587
            +G ITI GQ I+  + +  RR LGVVQQEP+L +G+I DNI Y VP +   DE R    
Sbjct: 495 DTGAITIGGQSIASFNLRKYRRMLGVVQQEPMLFNGTILDNIVYSVPQSLLNDENRVARA 554

Query: 588 --KCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDV 645
             +  C  F++ F DG +T++GP+G  LSGGQKQRIA+ARA +  P++LILDEATSALD 
Sbjct: 555 IGQANCSAFLSSFPDGLQTLVGPRGTQLSGGQKQRIALARAFLLDPDLLILDEATSALDS 614

Query: 646 ESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKE 705
            SE  +   L     +R  T ISIAHR+STI+ S  VIVLG  G VVE G F EL +  +
Sbjct: 615 RSEEVVARALYS-RSTRGKTTISIAHRVSTIQHSSRVIVLGRSGYVVETGTFDELISDPD 673

Query: 706 SKLYKLLNE 714
           S+L  LL +
Sbjct: 674 SQLNLLLRK 682

>Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188W
           (REAL)
          Length = 692

 Score =  533 bits (1373), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 291/618 (47%), Positives = 409/618 (66%), Gaps = 11/618 (1%)

Query: 115 STSGNSGAGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAIT 174
           S + +  +G+K+I RLF L+R + K + +A+ L+ IS S+ MAVP VIG +LDVA  +  
Sbjct: 77  SDANSKSSGFKDIKRLFVLSRPESKYIGLALLLILISSSVSMAVPSVIGKLLDVASESDD 136

Query: 175 SDEKPKDLRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNV 234
            +++ K  RD    ++GL    F        V+   AN  R+++L+I GE+LVARLR+  
Sbjct: 137 EEDEEKA-RD--SKLYGLTKKQFFTALGLVFVIGAVANASRIIILKITGERLVARLRTRT 193

Query: 235 IKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHIS 294
           +K  + QDA F D N+VGDLISRLSSDA +V++S+TQN+SDG +AII G VG GMM  +S
Sbjct: 194 MKAALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLS 253

Query: 295 SXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQ 354
                            A +YG+KIR++SR LQ S G LTKVAEEQL+  +T+Q++  E+
Sbjct: 254 WKLTCVMMLLAPPLGAMALVYGKKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEK 313

Query: 355 KEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDL 414
            E+ RY   +R VF +G +EA+T+  FF ST ++G+ + L +L  G++++  G ++IG+L
Sbjct: 314 NEVHRYAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTNMIQSGVMTIGEL 373

Query: 415 TAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGV-PYVPGKGEI 473
           ++FM+Y  Y+GS++FGLS+FYSELMKGAGAA+R+FEL D +P I+ T G  P       +
Sbjct: 374 SSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTIGKDPISLAHKPV 433

Query: 474 KFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRIT 533
            F+NVSF+YPTR  +QIF +LN TI  G +VC VGPSG GKSTIASLLL+YY+  SG I 
Sbjct: 434 VFKNVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIE 493

Query: 534 IDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVP--YTPTIDEIRSVSKKCFC 591
            D +D+   + +  RR +G VQQEP+L +G+I DNI Y +P       D +    ++  C
Sbjct: 494 FDDEDVRNFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPSEIAEREDRVARAIEQANC 553

Query: 592 HNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI 651
             F+  F DG +T++G +GA LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +
Sbjct: 554 TKFLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPALLILDEATSALDSQSEEIV 613

Query: 652 NYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKL 711
              L Q    R +T ISIAHRLSTI+ S  +IVLG  GSVVE G F++L A  +S+L  L
Sbjct: 614 AKNL-QKRVERGLTTISIAHRLSTIKHSTRIIVLGKHGSVVETGSFRDLIAIPDSELNAL 672

Query: 712 L----NEKAKDTTSKMNA 725
           L    +E+ K+ T+ ++A
Sbjct: 673 LAEQHDEEGKEKTANLDA 690

>KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 734

 Score =  530 bits (1365), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 287/611 (46%), Positives = 406/611 (66%), Gaps = 20/611 (3%)

Query: 124 YKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAITSDEKPKDLR 183
           +K+I RLF+LAR + K +  A+ L+ +S S+ M VP VIG ++DVAK   TS  +    R
Sbjct: 84  WKDIKRLFQLARPESKSMFFALVLIILSSSVSMLVPGVIGKLMDVAKEDGTSSSEADGKR 143

Query: 184 ---------------DLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVA 228
                          D   ++ GL L  F        V+   AN GR+V+L++ GEKLVA
Sbjct: 144 GDATDKTDGSTAADTDSEKLILGLTLPQFYGGLFSLFVVGAAANMGRIVILKVTGEKLVA 203

Query: 229 RLRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIG 288
           RLR+  +K  + QDA F D NKVGDLISRLSSDA +VS+S+TQN+SDG +++I G VG G
Sbjct: 204 RLRTRTLKAALQQDASFLDNNKVGDLISRLSSDASIVSKSLTQNMSDGTRSLIQGFVGFG 263

Query: 289 MMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQ 348
           MM +IS               V A +YGRKIR++SR LQ S G LTK AEEQLS  +T+Q
Sbjct: 264 MMSYISWKLTCVMMLLAPPLAVMALVYGRKIRNLSRTLQASVGGLTKAAEEQLSATRTIQ 323

Query: 349 SFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGS 408
           ++  E++ I+ Y   +R+V+ VG +EALT+  FF  T ++G+ + L +L  G+ ++  G+
Sbjct: 324 AYGGEKQAIRHYAKEVRQVYQVGLKEALTSGGFFGLTGLVGNSAVLALLLTGTSMISTGA 383

Query: 409 LSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGV-PYV 467
           +++GDL++FM+Y  Y+GS++FG+S+FYSELMKGAGAA+R+FEL D +P+I+ TKG  P  
Sbjct: 384 MTVGDLSSFMIYAVYTGSSLFGMSSFYSELMKGAGAAARVFELNDRKPAIHPTKGRDPVS 443

Query: 468 PGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNP 527
             +  ++F+ V F+YPTR  + IF +L+  ID G +VC+VGPSG GKST+ASLLL++Y+ 
Sbjct: 444 LARKPVEFKKVHFAYPTRRQHVIFEDLSLRIDPGEHVCIVGPSGGGKSTVASLLLRFYDV 503

Query: 528 TSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSK 587
            +G I I GQ+I+  + +  RR +G+VQQEP+L +G+I +NI Y VP     +E   V++
Sbjct: 504 DAGAILIGGQNIADFNLRKYRRLVGIVQQEPMLFNGTILENILYTVPQRLLNEEDGRVAR 563

Query: 588 ---KCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALD 644
              +  C  F++ F DG +T++GP+G  LSGGQKQRIA+ARA +  P++LILDEATSALD
Sbjct: 564 AIGQANCSAFLSSFPDGLQTMVGPRGTQLSGGQKQRIALARAFLLDPDLLILDEATSALD 623

Query: 645 VESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASK 704
             SE  I  TL     +R  T ISIAHR+STI+ S  VIVLG +G VVE G F EL ++ 
Sbjct: 624 SRSEEVIARTL-HSRTTRGKTTISIAHRVSTIQHSTRVIVLGRNGGVVETGTFDELASNT 682

Query: 705 ESKLYKLLNEK 715
           +S+L KLL ++
Sbjct: 683 DSQLNKLLRKE 693

>Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188W
           (REAL)
          Length = 696

 Score =  527 bits (1357), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 289/617 (46%), Positives = 403/617 (65%), Gaps = 11/617 (1%)

Query: 115 STSGNSGAGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAIT 174
           S + +  +G+K+I RLF L++ + K + +A+ L+ IS S+ MAVP VIG +LD+A     
Sbjct: 77  SDANSKSSGFKDIKRLFVLSKPESKYIGLALLLILISSSVSMAVPSVIGKLLDLASETED 136

Query: 175 SDEKPKDLRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNV 234
            +++ K   +    ++GL    F        ++   AN  R+++L++ GE+LVARLR+  
Sbjct: 137 EEKEEKAKSN---KLYGLTKRQFFTALGLVFIIGAVANASRIIILKVTGERLVARLRTRT 193

Query: 235 IKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHIS 294
           +K  + QDA F D N+VGDLISRLSSDA +V++S+TQN+SDG +AII G VG GMM  +S
Sbjct: 194 MKAALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLS 253

Query: 295 SXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQ 354
                            A IYGRKIR++SR LQ S G LTKVAEEQL+  +T+Q++  E+
Sbjct: 254 WKLTCVMMVLAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEK 313

Query: 355 KEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDL 414
            E++RY   +R VF +G +EA+T+  FF ST ++G+ + L +L  G+ ++  GS+++G+L
Sbjct: 314 NEVRRYAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTSMIQSGSMTVGEL 373

Query: 415 TAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGV-PYVPGKGEI 473
           ++FM+Y  Y+GS++FGLS+FYSELMKGAGAA+R+FEL D +P I  T G  P    +  I
Sbjct: 374 SSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVSLAQKPI 433

Query: 474 KFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRIT 533
            F+NVSF+YPTR  +QIF +LN TI+ G +VC VGPSG GKSTIASLLL+YY+  SG I 
Sbjct: 434 VFKNVSFTYPTRPKHQIFKDLNITINPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIE 493

Query: 534 IDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTI----DEIRSVSKKC 589
              +DI   + +  RR +G VQQEP+L +G+I DNI Y +P  P I    D I     + 
Sbjct: 494 FGDEDIRSFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIP--PEIAEQEDRIGRAIGQA 551

Query: 590 FCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEG 649
            C  F+  F DG +T +G +GA LSGGQKQRIA+ARA +  P +LILDEATSALD +SE 
Sbjct: 552 NCTKFLANFPDGLQTTVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEE 611

Query: 650 AINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLY 709
            +   L Q    R +T ISIAHRLSTI+ S  V+VLG  GSVVE G F++L A   S+L 
Sbjct: 612 IVAKNL-QRRVERGLTTISIAHRLSTIKHSTRVVVLGKHGSVVETGSFQDLIAIPNSELN 670

Query: 710 KLLNEKAKDTTSKMNAE 726
            LL E+  +   +  A+
Sbjct: 671 ALLAEQQDEEQKEGTAD 687

>Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188W
           (REAL)
          Length = 693

 Score =  520 bits (1339), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 289/616 (46%), Positives = 401/616 (65%), Gaps = 25/616 (4%)

Query: 115 STSGNSGAGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAI- 173
           S + +  +G+K+I RLF L+R +   + +A+ L+ IS S+ MAVP VIG +LD+A +   
Sbjct: 76  SDADSKSSGFKDIKRLFVLSRPESGYIGLALLLILISSSVSMAVPSVIGKLLDLASDDDD 135

Query: 174 ------TSDEKPKDLRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLV 227
                 T D K          ++GL    F        ++   AN  R+++L++ GE+LV
Sbjct: 136 EEDAKETKDNK----------LYGLSKRQFFTALGAVFLIGAIANASRIIILKVTGERLV 185

Query: 228 ARLRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGI 287
           ARLR+  +K  + QDA F D N+VGDLISRLSSDA +V++S+TQN+SDG +AII G VG 
Sbjct: 186 ARLRTRTMKAALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGF 245

Query: 288 GMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTV 347
           GMM  +S                 A IYGRKIR++SR LQ S G LTKVAEEQL+  +T+
Sbjct: 246 GMMSFLSWKLTCVMMVLAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTI 305

Query: 348 QSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQG 407
           Q++  E+ E++RY   +R VF VG +EA+T+  FF ST ++G+ + L +L  G++++  G
Sbjct: 306 QAYGGEKNEVRRYAKEVRNVFHVGLKEAVTSGLFFGSTGLVGNAAMLSLLLVGTNMIQSG 365

Query: 408 SLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGV-PY 466
           ++++G+LT+FM+Y  Y+GS++FGLS+FYSELMKGAGAA+R+FEL D +P I  T G  P 
Sbjct: 366 AMTVGELTSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPV 425

Query: 467 VPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYN 526
                 I F++VSF+YPTR  +QIF +LN TI  G +VC VGPSG GKSTIASLLL+YY+
Sbjct: 426 SLAHKPIVFKDVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYD 485

Query: 527 PTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTI----DEI 582
            ++G I    +DI   + +  RR +G VQQEP+L +G+I DNI Y +P  P I    D +
Sbjct: 486 TSAGSIDFGDEDIKNFNLRKYRRLMGYVQQEPLLFNGTILDNILYCIP--PEIAEQEDRV 543

Query: 583 RSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSA 642
                +  C  F+  F DG +T++G +GA LSGGQKQRIA+ARA +  P +LILDEATSA
Sbjct: 544 ARAIGQANCTKFLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSA 603

Query: 643 LDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYA 702
           LD +SE  +   L + +K R +T ISIAHRLSTI+ S  VIVLG  GSVVE G F++L +
Sbjct: 604 LDSQSEEVVAKNLQRRVK-RGLTTISIAHRLSTIKHSTRVIVLGKHGSVVETGSFQDLIS 662

Query: 703 SKESKLYKLLNEKAKD 718
              S+L  LL E+  D
Sbjct: 663 IPGSELNALLAEQQDD 678

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
           YLR188W
          Length = 707

 Score =  514 bits (1324), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 276/620 (44%), Positives = 409/620 (65%), Gaps = 24/620 (3%)

Query: 113 QESTSGNSGAGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDV---- 168
           + +++   G   ++I+ LF+LA+ +   ++ ++ L+ I+ ++ M VP VIG +LD+    
Sbjct: 85  KSNSTNTKGKTREDIYNLFKLAKPEKWYIIASMGLIFITSAVSMLVPSVIGKLLDISTGI 144

Query: 169 --AKNAITSDEKPKDLRDL--------PPVVWGLGLYDFLAVFAG---ALVLSTFANFGR 215
             A N   +DE  K+ ++           +++G   Y  L  F+G     V+   AN GR
Sbjct: 145 EFASNKDENDESSKEDKNENENENENKQTLIYG---YTPLVFFSGLGVIFVVGAIANTGR 201

Query: 216 VVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISD 275
           +++L++ GE++VARLR+  +K  + QD +F D NKVGDLISRLSSD+ +VS ++T+N+SD
Sbjct: 202 IIILKLTGERIVARLRTRTMKNILKQDGKFQDSNKVGDLISRLSSDSSIVSNAVTRNVSD 261

Query: 276 GFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTK 335
           G +A+I G VG+GMM  IS               V A IYGRKIR+IS+ LQ+S G+LTK
Sbjct: 262 GARAVIQGCVGVGMMSFISLKLSGVMLFMVPPIGVLAMIYGRKIRNISKKLQESVGSLTK 321

Query: 336 VAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLI 395
           ++EEQL+G +T+QS+V E+ EI +Y   +RKV+ VG  EA+ +  FF  T ++G+ + L 
Sbjct: 322 ISEEQLNGTRTIQSYVGEKLEIHKYAKEVRKVYHVGLNEAVASGLFFGVTGLIGNGAMLS 381

Query: 396 VLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQ 455
           +L  G +++  G+LSIG L++FM+Y  Y+GS++FGLS+FYSE+MKG+GAASR+FE+  + 
Sbjct: 382 LLYVGCNMISNGTLSIGGLSSFMMYAVYTGSSLFGLSSFYSEIMKGSGAASRIFEINKYV 441

Query: 456 PSIYATKGV-PYVPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGK 514
           P I ATKG+ P       I+FE++ F+YPTRS + IF +LN  I+ G +VC++GPSG GK
Sbjct: 442 PDINATKGIDPISFQDKPIEFEHIKFAYPTRSGHMIFQDLNIKINPGEHVCIIGPSGSGK 501

Query: 515 STIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVP 574
           STI+SLLL+YY+P +G I+I G+DI + S +  R+ +GVV QEP+L +G+I +NI Y VP
Sbjct: 502 STISSLLLRYYDPLAGTISIGGKDIKEYSLRKYRKLMGVVHQEPVLFNGTILENILYNVP 561

Query: 575 YTPTIDEIR--SVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPN 632
                D+ R  +  +   C+ F+     G ET +GP+G  LSGGQKQR+A+ARA + +P 
Sbjct: 562 EEIANDKERLSNAIESSNCNKFLNTLPLGLETPVGPRGTQLSGGQKQRVALARAFLLEPT 621

Query: 633 ILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVV 692
           +L+LDEATSALD  SE  +  TL Q   ++  T ISIAHR+STI+ S  V+VL   G VV
Sbjct: 622 LLVLDEATSALDPRSESIVAQTLKQRC-AKGFTTISIAHRVSTIKHSSRVVVLDKVGHVV 680

Query: 693 EMGKFKELYASKESKLYKLL 712
           E G ++EL   K+S L KLL
Sbjct: 681 ETGPYEELLGIKDSALNKLL 700

>CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar to
           uniprot|P33310 Saccharomyces cerevisiae YLR188w MDL1 or
           uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 608

 Score =  499 bits (1285), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 271/593 (45%), Positives = 389/593 (65%), Gaps = 23/593 (3%)

Query: 124 YKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAITSDEKPKDLR 183
           + ++ +L RLA+ + K +  A+ L+ +S ++ M++P VIG ++D A              
Sbjct: 31  WTQVKQLLRLAKPERKYIAGAVGLIAVSSAVSMSLPSVIGTLIDHASTP----------- 79

Query: 184 DLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDA 243
           D P  ++GL    FL       V+   AN GR+++L+I GEKLVARLR+  +K  + QDA
Sbjct: 80  DAP--IYGLTRNQFLLALGSVFVVGAIANSGRIIILKITGEKLVARLRTKTMKSMLSQDA 137

Query: 244 EFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXX 303
            F D+++VGDLISRLSSDA +VS+S+T N+SDG +A + G VGIGMM +IS         
Sbjct: 138 TFLDKHRVGDLISRLSSDASIVSKSVTSNLSDGCRATLQGVVGIGMMTYISLKLTTVMTM 197

Query: 304 XXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHA 363
                 + A +YG KI+ ISR LQ   G L+K +EEQL+ +KTVQ++  E+KE++RY++ 
Sbjct: 198 MVPPLGILAMLYGGKIKKISRQLQDKVGQLSKTSEEQLNSLKTVQAYAGERKELQRYSNE 257

Query: 364 IRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEY 423
           +R VF++G +EA+ +A FF ST ++G+ + + +L  G+      S+++G+L++FM+Y  Y
Sbjct: 258 VRSVFNIGVKEAVASALFFGSTGLIGNIAMIGLLLVGTA---DSSITLGELSSFMMYGVY 314

Query: 424 SGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGV-PYVPGKG-EIKFENVSFS 481
           +GS+VFGL+ FYSELMKG GAA R+ EL + +  I  TKG+ P    KG  I F NVSF+
Sbjct: 315 TGSSVFGLTGFYSELMKGCGAAERVLELQNMKTKISPTKGISPPKTLKGLPITFNNVSFA 374

Query: 482 YPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISK 541
           Y   +   + + +NF I  G +VC VG SG GKSTI+SLLL+YY   SG I+I   DIS 
Sbjct: 375 YS--NGKSVLSEMNFQIHPGEHVCFVGGSGCGKSTISSLLLRYYRTGSGNISIGNYDISA 432

Query: 542 ISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDG 601
            + +  RR LGVVQQEP+L +G+I DNITYG+ +  ++ ++    K   C  FI +   G
Sbjct: 433 FNLRKYRRMLGVVQQEPLLFNGTILDNITYGL-HDKSLTDLNMALKAANCDQFIKESHMG 491

Query: 602 YETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKS 661
            +T++GP+GA LSGGQ+QRIA+AR  ++ P+ILILDEATSALD +SE  IN  L Q  + 
Sbjct: 492 LDTLVGPRGAQLSGGQRQRIALARVFLQNPDILILDEATSALDTKSEDIINKEL-QRRQE 550

Query: 662 RDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNE 714
             +T ISIAHRLSTIR S  VIV+ +DG VVE G F +L ++++S+L KLL E
Sbjct: 551 AGMTTISIAHRLSTIRHSSRVIVI-EDGRVVESGSFDQLRSTRDSELNKLLKE 602

>SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of
           iron-sulfur (Fe/S) clusters to the cytosol member of the
           ATP-binding cassette (ABC) transporter family
          Length = 700

 Score =  207 bits (528), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 142/393 (36%), Positives = 213/393 (54%), Gaps = 11/393 (2%)

Query: 324 RDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFS 383
           R   ++      VA + L   + V+ F  E+    +Y++++    +   + A + A   S
Sbjct: 292 RSANRADNKAASVALDSLINFEAVKYFNNERYLADKYHNSLTNYTNSQIKVAQSLAFLNS 351

Query: 384 STSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAF-MLYTEYSGSAVFGLSNFYSELMKGA 442
             +++   +   ++  G   V+ G LS+GDL     L  + S    F L + Y EL +  
Sbjct: 352 GQNLIFTSALTAMMYMGCTGVMSGDLSVGDLVLINQLVFQLSVPLNF-LGSVYRELKQSL 410

Query: 443 GAASRLFELTDHQPSIYATKGVPYVPGKG--EIKFENVSFSY-PTRSANQIFNNLNFTID 499
                LF+L  ++ +I  +K    +P     EIKFENV+F Y P R   +I  N NFT+ 
Sbjct: 411 IDMESLFKLQKNKVNIQNSKTPLMLPKDKPCEIKFENVTFGYHPDR---KILENANFTLP 467

Query: 500 SGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPI 559
           +G    +VGPSG GKSTI  L+ ++Y+P  GRI IDG+DI ++  KSLRR +GVV Q+  
Sbjct: 468 AGWKTAIVGPSGSGKSTILKLVFRFYDPQEGRILIDGKDIRELDLKSLRRAIGVVPQDTP 527

Query: 560 LMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQ 619
           L + +I +N+ +G   T T D+IR    K      I     G ET++G +G ++SGG+KQ
Sbjct: 528 LFNDTIWENVKFG-KITATDDDIRKAIDKAQLAPLIHSLPQGSETIVGERGLMISGGEKQ 586

Query: 620 RIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRS 679
           R+AIAR L+K   I+  DEATSALD  +E A+  T+ +       T I IAHRL TI  +
Sbjct: 587 RLAIARVLLKDTPIMFFDEATSALDTHTEQALLRTIKENFAGNSRTSIYIAHRLRTIADA 646

Query: 680 ENVIVLGDDGSVVEMGKFKELYASKESKLYKLL 712
           + ++VL ++G V E GK  EL  SK + LY  L
Sbjct: 647 DKIVVL-ENGRVKEEGKHAELL-SKPTSLYSEL 677

>Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa]
           {ON} YMR301C (ATM1) - mitochondrial ABC transporter
           protein [contig 73] FULL
          Length = 719

 Score =  202 bits (515), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 140/384 (36%), Positives = 209/384 (54%), Gaps = 14/384 (3%)

Query: 336 VAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLI 395
           VA + L   + V+ F  EQ    +Y+ ++ +  D   + A + A   S  +++   +   
Sbjct: 324 VAVDSLINFEAVKYFNNEQYLANKYHKSLAQYRDSQIKVAQSLAFLNSGQNLIFTSALTA 383

Query: 396 VLAYGSHLVLQGSLSIGDLTAF-MLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDH 454
           ++  G   V+ G LS+GDL     L  + S    F L + Y EL +       LF+L  +
Sbjct: 384 MMYMGCTGVMSGELSVGDLVLINQLVFQLSVPLNF-LGSVYRELKQSLIDMESLFQLQRN 442

Query: 455 QPSIYATKGV----PYVPGKGEIKFENVSFSY-PTRSANQIFNNLNFTIDSGSNVCVVGP 509
           + SI  +K      P VP   EI F+NVSF Y P R    I  N +FTI +GS   +VGP
Sbjct: 443 KVSIQNSKKPLMLPPNVPS--EIVFKNVSFGYDPDR---LILKNASFTIPTGSKTAIVGP 497

Query: 510 SGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNI 569
           SG GKSTI  L+ ++Y+P  GRI +DG+D+ ++  +SLRR +GVV Q+  L + SI DN+
Sbjct: 498 SGSGKSTILKLVFRFYDPIEGRILLDGKDVRELDIESLRRSIGVVPQDTPLFNESIWDNV 557

Query: 570 TYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIK 629
            +G     T  EI     +      I +   G +T++G +G ++SGG+KQR+AIAR L+K
Sbjct: 558 KFG-RIDATDQEIERAIDRAQLRALIRQLPKGRDTIVGERGLMISGGEKQRLAIARVLLK 616

Query: 630 KPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDG 689
              I+  DEATSALD  +E A+  T+ +   +   T + IAHRL TI  ++ +IVL + G
Sbjct: 617 DAPIMFFDEATSALDTHTEQALLRTIKENFTTGSKTSVYIAHRLRTIADADKIIVL-EHG 675

Query: 690 SVVEMGKFKELYASKESKLYKLLN 713
            V E GK  EL A+ +S   +L N
Sbjct: 676 RVKEEGKHAELLATPKSLYAELWN 699

>KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.20
           YMR301C
          Length = 695

 Score =  202 bits (513), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 136/382 (35%), Positives = 212/382 (55%), Gaps = 12/382 (3%)

Query: 336 VAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLI 395
           +A + L   + V+ F  E     +YN+A+    D   + + + A   S  +++   +   
Sbjct: 287 IALDSLINFEAVKYFNNESYLASKYNNALMTYRDAQIKVSQSLAFLNSGQNLIFTSALTA 346

Query: 396 VLAYGSHLVLQGSLSIGDLTAF-MLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDH 454
           ++  G   +L G+L++GDL     L  + S    F L + Y EL +       LF+L  +
Sbjct: 347 MMYMGCTGILGGNLTVGDLVLINQLVFQLSVPLNF-LGSVYRELKQSLIDMESLFKLRRN 405

Query: 455 QPSIYATKGVPYVPGKG---EIKFENVSFSY-PTRSANQIFNNLNFTIDSGSNVCVVGPS 510
           +  I   +    +P  G   EI+FENV+F Y P R+   I  N +F I +G  + +VGPS
Sbjct: 406 EVVIKNVEQPKMLPADGKPFEIRFENVTFGYEPDRT---ILKNASFVIAAGKKIAIVGPS 462

Query: 511 GRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNIT 570
           G GKSTI  L+ ++Y+P  GRI I+G D+ +I   SLR+ +GVV Q+  L + +I +N+ 
Sbjct: 463 GSGKSTILKLVFRFYDPQEGRILINGIDVKEIDLDSLRKVIGVVPQDTPLFNDTIWENVR 522

Query: 571 YGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKK 630
           +G     T +E+ +  +K      I+K S G +T++G +G ++SGG+KQR+AIAR L+K 
Sbjct: 523 FG-RIDATDEEVWAAVEKAHLSPLISKLSRGTDTIVGERGLMISGGEKQRLAIARVLLKN 581

Query: 631 PNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGS 690
            +I+  DEATSALD  +E  +  T+    K+   T I IAHRL TI  ++ +IVL +DGS
Sbjct: 582 ADIMFFDEATSALDTHTEQNLLKTIRANFKTGSKTSIYIAHRLRTIADADKIIVL-EDGS 640

Query: 691 VVEMGKFKELYASKESKLYKLL 712
           V E G   EL A ++  LYK L
Sbjct: 641 VKEEGTHTELLA-RDHSLYKDL 661

>NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20
          Length = 702

 Score =  198 bits (503), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 140/395 (35%), Positives = 209/395 (52%), Gaps = 11/395 (2%)

Query: 324 RDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFS 383
           RD  ++      VA + L   + V+ F  E+    +Y+ ++ K  D   + + + A   S
Sbjct: 284 RDANKADNKGASVALDSLINFEAVKYFNNEKYLADKYHTSLIKYRDSQIKVSQSLAYLNS 343

Query: 384 STSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAF-MLYTEYSGSAVFGLSNFYSELMKGA 442
             +++   +   ++  G   V+ G L++GDL     L  + S    F L + Y EL +  
Sbjct: 344 GQNLIFTSALTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNF-LGSVYRELKQSL 402

Query: 443 GAASRLFELTDHQPSIYATKGVPYV----PGKGEIKFENVSFSYPTRSANQIFNNLNFTI 498
                LF+L  ++  I      P V     G  EI FENV+F Y   S  +I NN +FTI
Sbjct: 403 IDMESLFQLRKNEIKIENGTN-PIVLKASDGPFEITFENVTFGY--DSKRKILNNASFTI 459

Query: 499 DSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEP 558
             G    VVGPSG GKSTI  L+ ++Y+P  GRI I+G D+ +    SLRR +GVV Q+ 
Sbjct: 460 PGGLKTAVVGPSGSGKSTILKLVFRFYDPEQGRILINGVDVKEYDVDSLRRVMGVVPQDT 519

Query: 559 ILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQK 618
            L + +I +N+ +G     T +E+ +V +K      I K   GYET++G +G ++SGG+K
Sbjct: 520 PLFNDTIWENVKFG-RIDATDEEVHTVIEKAQLAPLIKKLPQGYETIVGERGMMISGGEK 578

Query: 619 QRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRR 678
           QR+AIAR L+K   I+  DEATSALD  +E A+  T+    +S   T + IAHRL TI  
Sbjct: 579 QRLAIARVLLKNAKIMFFDEATSALDTHTEQALLTTIRANFESGSRTSVYIAHRLRTIAD 638

Query: 679 SENVIVLGDDGSVVEMGKFKELYASKESKLYKLLN 713
           ++ +IVL +DG+V E G    L A+  S    L N
Sbjct: 639 ADKIIVL-EDGAVKEEGTHSGLLATPGSLYANLWN 672

>Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {ON}
           YMR301C (REAL)
          Length = 691

 Score =  197 bits (500), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 141/410 (34%), Positives = 219/410 (53%), Gaps = 21/410 (5%)

Query: 324 RDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFS 383
           RD  ++      VA + L   + V+ F  E+    +YN ++    D   + + + A   S
Sbjct: 286 RDANRADNKAASVALDSLINFEAVKYFNNEKYLSSKYNSSLMNYRDSQIKVSQSLAFLNS 345

Query: 384 STSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAF-MLYTEYSGSAVFGLSNFYSELMKGA 442
             +++   +   ++  G   V+ G L++GDL     L  + S    F L + Y +L +  
Sbjct: 346 GQNLIFTTALTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNF-LGSVYRDLKQSL 404

Query: 443 GAASRLFELTDHQPSIYATK-------GVPYVPGKGEIKFENVSFSY-PTRSANQIFNNL 494
                LF+L  ++  I + +        VPY     EI FENV+F Y P R   +I  N 
Sbjct: 405 IDMETLFKLRKNEVKIKSVERPLMLPEHVPY-----EITFENVTFGYHPDR---KILKNA 456

Query: 495 NFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVV 554
           +FTI +G    +VG SG GKSTI  L+ ++Y+P SGRI I+G+DI +    +LRR +GVV
Sbjct: 457 SFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRRVIGVV 516

Query: 555 QQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLS 614
            Q+  L + +I +N+ +G     T +E+++  +K      I K   G+ET++G +G ++S
Sbjct: 517 PQDTPLFNDTIWENVKFG-RIDATDEEVKTAVQKAQLAPLIKKLPQGFETIVGERGLMIS 575

Query: 615 GGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLS 674
           GG+KQR+AIAR L+K   I+  DEATSALD  +E A+  T+     S   T + IAHRL 
Sbjct: 576 GGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRSNFPSGSRTSVYIAHRLR 635

Query: 675 TIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKDTTSKMN 724
           TI  ++ +IVL D+G+V E GK  EL A+  S LY+ L    +D +   N
Sbjct: 636 TIADADKIIVL-DNGTVKEDGKHIELLATPGS-LYRELWTIQEDLSHLEN 683

>AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR301C (ATM1)
          Length = 691

 Score =  196 bits (498), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 135/401 (33%), Positives = 217/401 (54%), Gaps = 11/401 (2%)

Query: 324 RDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFS 383
           RD  ++      VA + L   + V+ F  E+    +Y+ ++ K  D   + + + A   +
Sbjct: 284 RDANKADNKAASVALDSLINFEAVKYFNNEKYLADKYHTSLMKYRDSQIKVSQSLAFLNT 343

Query: 384 STSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAF-MLYTEYSGSAVFGLSNFYSELMKGA 442
             +++   +   ++    + V+QGSL++GDL     L  + S    F L + Y +L +  
Sbjct: 344 GQNLIFTTALTAMMYMACNGVMQGSLTVGDLVLINQLVFQLSVPLNF-LGSVYRDLKQSL 402

Query: 443 GAASRLFELTDHQPSIYATKGVPYVPGKG--EIKFENVSFSY-PTRSANQIFNNLNFTID 499
                LF+L  +Q +I  +     +P     +I+FENV+F Y P R   +I NN++FTI 
Sbjct: 403 IDMESLFKLQKNQVTIKNSPNAQNLPIHKPLDIRFENVTFGYDPER---RILNNVSFTIP 459

Query: 500 SGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPI 559
           +G    +VGPSG GKSTI  L+ ++Y P  GRI + G DI  +   SLR+ +GVV Q+  
Sbjct: 460 AGMKTAIVGPSGSGKSTILKLVFRFYEPEQGRILVGGTDIRDLDLLSLRKAIGVVPQDTP 519

Query: 560 LMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQ 619
           L + +I +N+ +G   + + DEI    +K      +     G  TV+G +G ++SGG+KQ
Sbjct: 520 LFNDTIWENVKFG-NISSSDDEILRAIEKAQLTKLLQNLPKGASTVVGERGLMISGGEKQ 578

Query: 620 RIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRS 679
           R+AIAR L+K   ++  DEATSALD  +E A+ +T+ Q   S   T + +AHRL TI  +
Sbjct: 579 RLAIARVLLKDAPLMFFDEATSALDTHTEQALLHTIQQNFSSNSKTSVYVAHRLRTIADA 638

Query: 680 ENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKDTT 720
           + +IVL + GSV E G    L AS+ S LY+ L +  ++ T
Sbjct: 639 DKIIVL-EQGSVREEGTHSSLLASQGS-LYRGLWDIQENLT 677

>KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {ON}
           Anc_5.20 YMR301C
          Length = 709

 Score =  196 bits (498), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 141/400 (35%), Positives = 213/400 (53%), Gaps = 24/400 (6%)

Query: 324 RDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAI----RKVFDVGKREALTNA 379
           RD  ++      +A + L   + V+ F  E     +YN A+         + K  A  N+
Sbjct: 302 RDANKADNKGASIALDSLINFEAVKYFNNENYLSSKYNSALIDYRNSQIKISKSLAFLNS 361

Query: 380 --TFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAF-MLYTEYSGSAVFGLSNFYS 436
                 +T++ G      ++  G   V+ G+L++GDL     L  + S    F L + Y 
Sbjct: 362 GQNLIFTTALTG------MMYLGCTGVIGGNLTVGDLVLINQLVFQLSVPLNF-LGSVYR 414

Query: 437 ELMKGAGAASRLFELTDHQPSIYATKGVPYV---PGKGEIKFENVSFSYPTRSANQIFNN 493
           EL +       LF+L  ++  I+  +    +    G  EI FENV+F Y   +  +I  N
Sbjct: 415 ELKQSLIDMESLFKLRKNEVKIHNIENPKIILKEDGPFEITFENVTFGY--HADRKILKN 472

Query: 494 LNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGV 553
            +FTI +G    +VGPSG GKSTI  L+ ++Y+P  GRI I+G D+ +I   SLR+ +GV
Sbjct: 473 ASFTIPAGWKTAIVGPSGSGKSTILKLVFRFYDPEEGRILINGIDVREIELDSLRKLIGV 532

Query: 554 VQQEPILMSGSIRDNITYGVPYTPTID-EIRSVSKKCFCHNFITKFSDGYETVIGPKGAL 612
           V Q+  L + SI +N+ +G      +D EI  V +K    + I K    YET++G +G +
Sbjct: 533 VPQDTPLFNDSIWENVKFG--RIDALDSEIYEVIEKAQLDSLIRKLPQSYETIVGERGLM 590

Query: 613 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHR 672
           +SGG+KQR+AIAR L+K  +++  DEATSALD  +E A+  T+    K+   T I IAHR
Sbjct: 591 ISGGEKQRLAIARVLLKDASVMFFDEATSALDTHTEQALLKTIRANFKTGSRTSIYIAHR 650

Query: 673 LSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLL 712
           L TI  ++ +IVL +DG+V E G   EL A K + LYK L
Sbjct: 651 LRTIADADKIIVL-EDGTVREEGTHNELLA-KSTSLYKEL 688

>KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 720

 Score =  195 bits (496), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 139/420 (33%), Positives = 219/420 (52%), Gaps = 10/420 (2%)

Query: 324 RDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFS 383
           R   ++      VA + L   + V+ F  E+    +Y+ ++ K  D   + A + A   +
Sbjct: 305 RSANRADNKAASVALDSLINFEAVKYFNNEEYLANKYHQSLSKYRDSQIKVAQSLAFLNA 364

Query: 384 STSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAF-MLYTEYSGSAVFGLSNFYSELMKGA 442
             + +   +   ++  G+  V++G+L++GDL     L  + S    F L + Y EL +  
Sbjct: 365 GQNFIFTSALTAMMYMGASGVMEGALTVGDLVLINQLVFQLSVPLNF-LGSVYRELKQSL 423

Query: 443 GAASRLFELTDHQPSIYATKGVPYVPGK--GEIKFENVSFSY-PTRSANQIFNNLNFTID 499
                LF+L  +   I  T+    +P     EIKFENV+F Y P R+   I  N  FTI 
Sbjct: 424 IDMESLFKLQKNPILIKNTERPLMLPEHLPCEIKFENVTFGYQPDRN---ILKNATFTIA 480

Query: 500 SGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPI 559
            G    +VGPSG GKSTI  L+ ++Y+P  GRI +DG+DI ++    LRR +GVV Q+  
Sbjct: 481 PGKKTAIVGPSGSGKSTILRLVFRFYDPQQGRILLDGKDIRELDLDELRRIVGVVPQDTP 540

Query: 560 LMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQ 619
           L + +I +N+ +G     T +EI +  +K    + I K   G ET++G +G ++SGG+KQ
Sbjct: 541 LFNDTIWENVKFG-RINATDNEIVTAIEKAQLSDLIHKLPKGTETIVGERGLMISGGEKQ 599

Query: 620 RIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRS 679
           R+AIAR L+K   I+  DEATSALD  +E ++  T+ +       T + IAHRL TI  +
Sbjct: 600 RLAIARVLLKDTPIMFFDEATSALDTHTEQSLLKTIKENFSDVAKTSVYIAHRLRTIADA 659

Query: 680 ENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKDTTSKMNAETVEKNDPSPKTEK 739
           + +IVL ++G+V E G    L A+  S   +L N +      +   E   K +  P+T K
Sbjct: 660 DKIIVL-ENGAVREEGTHNALLANPNSLYSELWNIQENLDMLEDELEDELKLEKEPRTSK 718

>Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}
           complement(65118..67244) [2127 nt, 709 aa]
          Length = 708

 Score =  195 bits (495), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 134/387 (34%), Positives = 204/387 (52%), Gaps = 19/387 (4%)

Query: 336 VAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLI 395
           +A + L   + V+ F  EQ    +Y  ++    +   + A + A   S  +++   +   
Sbjct: 310 IALDSLINFEAVKYFNNEQYLANKYYSSLVDYRNSQVKVAQSLAFLNSGQNLIFTSALTA 369

Query: 396 VLAYGSHLVLQGSLSIGDLTAF-MLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTD- 453
           ++  G   V+ G+L++GDL     L  + S    F L + Y EL +       LF+L   
Sbjct: 370 IMYLGCTGVIGGNLTVGDLVLINQLVFQLSVPLNF-LGSVYRELKQSLIDMESLFKLRKN 428

Query: 454 -------HQPSIYATKGVPYVPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCV 506
                  H+P +   +  P+     EIKFENV+F Y      +I  N +FTI +G    V
Sbjct: 429 EIKIQNVHRPLMLPNELTPF-----EIKFENVTFGYDKE--RKILKNASFTIPAGWKTAV 481

Query: 507 VGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIR 566
           VGPSG GKSTI  L+ ++Y+P  GRI ++G DI +I   SLR+ +GVV Q+  L + +I 
Sbjct: 482 VGPSGSGKSTILKLVFRFYDPEEGRILLNGTDIKEIDLASLRKVIGVVPQDTPLFNDTIW 541

Query: 567 DNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARA 626
           +N+ +G     T +EI    +K      I K   G ET++G +G ++SGG+KQR+AIAR 
Sbjct: 542 ENVKFG-RIEATDNEILQAIEKAQLAPLIKKLPKGRETIVGERGLMISGGEKQRLAIARV 600

Query: 627 LIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLG 686
           L+K   I+  DEATSALD  +E ++  T+ +       T + IAHRL TI  ++ +IVL 
Sbjct: 601 LLKNSGIMFFDEATSALDTHTEQSLLRTIKENFDGSSRTSVYIAHRLRTIADADKIIVL- 659

Query: 687 DDGSVVEMGKFKELYASKESKLYKLLN 713
            DG V E G  ++L A KES   +L N
Sbjct: 660 KDGQVEEEGTHRQLIAKKESLYSELWN 686

>NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {ON}
           Anc_5.20 YMR301C
          Length = 730

 Score =  195 bits (495), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 139/398 (34%), Positives = 209/398 (52%), Gaps = 14/398 (3%)

Query: 324 RDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFS 383
           RD  ++      VA + L   + V+ F  E     +Y+ ++ +  D   + A + A   S
Sbjct: 316 RDANKADNKGASVALDSLINFEAVKYFNNETYLSNKYHDSLLQYRDSTIKVAQSLAFLNS 375

Query: 384 STSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAF-MLYTEYSGSAVFGLSNFYSELMKGA 442
             +++   +  +++  G   V++G+L++GDL     L  + S    F L + Y EL +  
Sbjct: 376 GQNLIFTSALTMMMYLGCTGVIEGNLTVGDLVLINQLVFQLSVPLNF-LGSVYRELKQSL 434

Query: 443 GAASRLFELTDHQPSIYATKGVPYVP-------GKGEIKFENVSFSYPTRSANQIFNNLN 495
                LF+L  +   I   K  P  P       G  EIKFENV+F Y T    +I  N +
Sbjct: 435 IDMESLFQLRKNPIKIQNAKTGP-APIMLKSSDGPFEIKFENVTFGYDTN--RKILKNAS 491

Query: 496 FTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQ 555
           F I +G    VVGPSG GKSTI  L+ ++Y+P  GR+ I+G ++ +    SLRR +GVV 
Sbjct: 492 FIIPAGLKTAVVGPSGSGKSTILKLVFRFYDPEEGRVLINGINVQRYDIDSLRRVMGVVP 551

Query: 556 QEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSG 615
           Q+  L + +I +N+ +G       +EI+ V +K      I K     +T++G +G ++SG
Sbjct: 552 QDTPLFNDTIWENVKFG-RINANDEEIKQVIEKAQLAPLIEKLPQREKTIVGERGLMISG 610

Query: 616 GQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLST 675
           G+KQR+AIAR L+K  NI+  DEATSALD  +E A+  T+     S   T I IAHRL T
Sbjct: 611 GEKQRLAIARVLLKDANIMFFDEATSALDTHTEQALLNTIRANFPSGTRTSIYIAHRLRT 670

Query: 676 IRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLN 713
           I  ++ +IVL +DG V E G   EL A+K S    L N
Sbjct: 671 IADADKIIVL-EDGKVKEEGSHNELLATKGSLYSNLWN 707

>CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa]
           {ON} similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301c ATM1
          Length = 727

 Score =  194 bits (494), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 138/410 (33%), Positives = 218/410 (53%), Gaps = 14/410 (3%)

Query: 336 VAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLI 395
           VA + L   + V+ F  E     +Y++++ K  D   + A + A   S  S++   +   
Sbjct: 325 VALDSLINFEAVKYFNNESYLANKYHNSLIKYRDSQVKVAQSLAFLNSGQSLIFTTALTG 384

Query: 396 VLAYGSHLVLQGSLSIGDLTAF-MLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDH 454
           ++  G   V+ G L++GDL     L  + S    F L + Y EL +       LF+L  +
Sbjct: 385 MMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNF-LGSVYRELKQSLIDMESLFKLRKN 443

Query: 455 QPSIY---ATKGVPYVPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSG 511
           Q  I      K +    G  EIKFENV+F Y  +   +I  N +FTI +G    + GPSG
Sbjct: 444 QVKIQNCSQPKSISKSDGPFEIKFENVTFGYDGQ--RKILKNASFTIPAGMKTAIAGPSG 501

Query: 512 RGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITY 571
            GKST+  L+ ++Y+P  GR+ ++G D+ +     LR+ +GVV Q+  L + +I +N+ +
Sbjct: 502 SGKSTVLKLVFRFYDPEEGRVLVNGVDVREYDIDQLRKAIGVVPQDTPLFNDTIWENVKF 561

Query: 572 GVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKP 631
           G     + +EI  V  K    + I K   G  T++G +G ++SGG+KQR+AIAR L+K  
Sbjct: 562 G-RIEASDEEITRVIDKAQLSDLIAKLPQGSSTIVGERGLMISGGEKQRLAIARVLLKDA 620

Query: 632 NILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSV 691
           +I+  DEATSALD  +E ++  T+ +   S + T + IAHRL TI  ++ +IVL ++G+V
Sbjct: 621 DIMFFDEATSALDTHTEQSLLRTIRRNFNSGEKTSVYIAHRLRTIADADKIIVL-EEGTV 679

Query: 692 VEMGKFKELYASKESKLYKLLNEKAKDTTSKMNAETVEKNDPSPKTEKLN 741
            E G  +EL A +E+ LYK L    +D    ++    E N      EKLN
Sbjct: 680 REEGTHQELLA-RENSLYKELWRIQED----LDLLEDEINHEKETLEKLN 724

>TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20
           YMR301C
          Length = 696

 Score =  193 bits (490), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 136/401 (33%), Positives = 212/401 (52%), Gaps = 20/401 (4%)

Query: 321 SISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFD----VGKREAL 376
           +  RD  ++      VA + L   + V+ F  E     +Y++++ K  D    + +  A 
Sbjct: 278 AFRRDANKADNKAASVALDSLINFEAVKHFNNENYLAGKYHNSLMKYRDSQVKIAQSLAF 337

Query: 377 TNA-TFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAF-MLYTEYSGSAVFGLSNF 434
            NA   F  TS L    ++     G   V+ G L++GDL     L  + S    F L + 
Sbjct: 338 LNAGQNFIFTSALSAMMYM-----GCTGVIGGDLTVGDLVLINQLVFQLSVPLNF-LGSV 391

Query: 435 YSELMKGAGAASRLFELTDHQPSIYATKGVPYVP---GKGEIKFENVSFSYPTRSANQIF 491
           Y EL +       LF L +++  I+       +P   G  EIKFENV+F Y TR   +I 
Sbjct: 392 YRELKQSLIDMEALFNLRNNKIKIHNNDKPLMLPENAGPFEIKFENVTFGYDTR--RKIL 449

Query: 492 NNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHL 551
            N +FTI +G    +VGPSG GKSTI  L+ ++Y+P SGR+ ++G+D+ +    S R+ +
Sbjct: 450 RNASFTIPAGVKTAIVGPSGSGKSTILKLVFRFYDPESGRVLVNGKDVREYDLDSFRKVI 509

Query: 552 GVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGA 611
           GVV Q+  L + +I +N+ +G     T DE+ +  +K      I K   G  T++G +G 
Sbjct: 510 GVVPQDTPLFNDTIWENVKFG-RIDATDDEVTNAIEKAQLAPLIHKLPVGSATIVGERGL 568

Query: 612 LLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAH 671
           ++SGG+KQR+AIAR L+K   I+  DEATSALD  +E ++  T+ +       T + +AH
Sbjct: 569 MISGGEKQRLAIARVLLKNSQIMFFDEATSALDTHTEQSLLKTIRENFDRGSRTSVYVAH 628

Query: 672 RLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLL 712
           RL TI  ++ ++VL ++G V E G   EL  S+ + LYK L
Sbjct: 629 RLRTIADADKILVL-EEGCVREEGSHTELL-SRPNSLYKQL 667

>Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {ON}
           YMR301C (REAL)
          Length = 687

 Score =  192 bits (489), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 141/418 (33%), Positives = 221/418 (52%), Gaps = 24/418 (5%)

Query: 310 VGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFD 369
           +  T +  K R   RD  ++      VA + L   + V+ F  E+    +YN ++    D
Sbjct: 274 IKTTAWRTKFR---RDANKADNKAASVALDSLINFEAVKYFNNEKYLSDKYNSSLISYRD 330

Query: 370 VGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAF-MLYTEYSGSAV 428
              + + + A   S  +++   +   ++  G   V+ G+L++GDL     L  + S    
Sbjct: 331 SQIKVSQSLAFLNSGQNLIFTTALTAMMYMGCTGVIGGNLTVGDLVLINQLVFQLSVPLN 390

Query: 429 FGLSNFYSELMKGAGAASRLFELTDHQPSI-------YATKGVPYVPGKGEIKFENVSFS 481
           F L + Y +L +       LF+L  ++  I          + VPY     +I FENV+F 
Sbjct: 391 F-LGSVYRDLKQSLIDMETLFKLRRNEVKIKNAERPLMLPEHVPY-----DITFENVTFG 444

Query: 482 Y-PTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDIS 540
           Y P R   +I  N +FTI +G    +VG SG GKSTI  L+ ++Y+P SGRI I+G+DI 
Sbjct: 445 YHPDR---KILKNASFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIR 501

Query: 541 KISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSD 600
           +    +LR+ +GVV Q+  L + +I +N+ +G     T +E+ +V +K      I K   
Sbjct: 502 EYDINALRKVIGVVPQDTPLFNDTIWENVKFG-RIDATDEEVMTVVEKAQLAPLIKKLPQ 560

Query: 601 GYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMK 660
           G++T++G +G ++SGG+KQR+AIAR L+K   I+  DEATSALD  +E A+  T+     
Sbjct: 561 GFDTIVGERGLMISGGEKQRLAIARVLLKNAKIMFFDEATSALDTHTEQALLRTIRSNFT 620

Query: 661 SRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKD 718
           S   T + IAHRL TI  ++ +IVL D+G V E GK  EL A+  S LY+ L    +D
Sbjct: 621 SGSRTSVYIAHRLRTIADADKIIVL-DNGRVREEGKHLELLATPNS-LYRELWTIQED 676

>TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa]
           {ON} Anc_5.20 YMR301C
          Length = 725

 Score =  192 bits (489), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 133/386 (34%), Positives = 210/386 (54%), Gaps = 19/386 (4%)

Query: 336 VAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLI 395
           +A + L   + V+ F  E+   ++Y+  + +  D   + A + A   S  +++   +  +
Sbjct: 317 IALDSLINFEAVKYFNNEEYLAQKYHKTLSQYRDSQIKVAQSLAFLNSGQNLIFTSALTV 376

Query: 396 VLAYGSHLVLQGSLSIGDLTAF-MLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDH 454
           ++  G   ++ G+L++GDL     L  + S    F L + Y EL +       LF+L  +
Sbjct: 377 MMYMGCTGIIGGNLTVGDLVLINQLVFQLSVPLNF-LGSVYRELKQSLIDMEYLFQLKKN 435

Query: 455 --------QPSIYATKGVPYVPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCV 506
                   +P + A KG  ++P    I+FENV+F Y  +   +I  N +F I+SG    +
Sbjct: 436 PIIIKNVEKPLMLAEKG--HMPM--TIRFENVTFGYDKQ--RKILKNASFQIESGQKTAI 489

Query: 507 VGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIR 566
           VGPSG GKSTI  LL ++Y+P  GRI ++G D  +    SLR+ +GVV Q+  L + +I 
Sbjct: 490 VGPSGSGKSTILKLLFRFYDPEEGRILVNGVDAREYDIDSLRKVIGVVPQDTPLFNDTIW 549

Query: 567 DNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARA 626
           +N+ +G     + DEI  V  K      + K   G ET++G +G ++SGG+KQR+AIAR 
Sbjct: 550 ENVRFG-RIGASDDEITQVINKAQLGPLLVKLPQGRETIVGERGLMISGGEKQRLAIARV 608

Query: 627 LIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLG 686
           L+K  +I+  DEATSALD  +E A+  T+ +  K    T + IAHRL TI  ++ +IVL 
Sbjct: 609 LLKDADIMFFDEATSALDTHTEQALLKTINENFKKGSRTSVYIAHRLRTIADADKIIVL- 667

Query: 687 DDGSVVEMGKFKELYASKESKLYKLL 712
            +G+V E GK  EL A +   LYK L
Sbjct: 668 QEGTVREEGKHSELLA-RSGSLYKEL 692

>KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 694

 Score =  192 bits (488), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 140/407 (34%), Positives = 218/407 (53%), Gaps = 19/407 (4%)

Query: 336 VAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLI 395
           VA + L   + V+ F  EQ    +Y++++ +  D   + A + A   +  + +   +   
Sbjct: 296 VAVDSLINFEAVKYFNNEQFLANKYHNSLAQYRDSQIKVAQSLAFLNAGQNFIFTSALTA 355

Query: 396 VLAYGSHLVLQGSLSIGDLTAF-MLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDH 454
           ++  G   V+ G+LS+GDL     L  + S    F L + Y EL +       LF+L  +
Sbjct: 356 MMYMGCTGVISGTLSVGDLVLINQLVFQLSVPLNF-LGSVYRELKQSLIDMESLFQLQRN 414

Query: 455 QPSIYATKGVPYV-----PGKGEIKFENVSFSY-PTRSANQIFNNLNFTIDSGSNVCVVG 508
           +  I   K  P +     P K  I FENVSF Y P R    I  N +FT+ +G    +VG
Sbjct: 415 KVKI-QNKEKPLMLSSQRPSK--IVFENVSFGYDPDR---MILKNSSFTMPAGWKTAIVG 468

Query: 509 PSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDN 568
           PSG GKSTI  L+ ++Y+P  GRI +DG+D+ ++  +SLRR +GVV Q+  L + SI +N
Sbjct: 469 PSGSGKSTILKLVFRFYDPQEGRILVDGKDVRELDIESLRRAIGVVPQDTPLFNDSIWEN 528

Query: 569 ITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALI 628
           + +G   + + +EIR   +K    + + +   G +T++G +G ++SGG+KQR+AIAR L+
Sbjct: 529 VRFG-KISASDEEIRLAVEKAQLESLVDQLPKGRDTIVGERGLMISGGEKQRLAIARVLL 587

Query: 629 KKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDD 688
           K   I+  DEATSALD  +E A+  T+     +   T + IAHRL TI  ++ +IV+   
Sbjct: 588 KDAPIMFFDEATSALDTHTEQALLRTIKDNFPTGSKTSVYIAHRLRTIADADKIIVI-QQ 646

Query: 689 GSVVEMGKFKELYASKESKLYKLLN-EKAKDTTSK--MNAETVEKND 732
           G V E GK  EL A   S   +L N ++  D  ++     ET EK D
Sbjct: 647 GQVKEEGKHAELLAKPGSLYAELWNVQENLDVLNEELQREETQEKGD 693

>Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {ON}
           YMR301C (REAL)
          Length = 693

 Score =  191 bits (485), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 138/404 (34%), Positives = 214/404 (52%), Gaps = 21/404 (5%)

Query: 324 RDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFS 383
           RD  ++      VA + L   + V+ F  E+    +YN ++    D   + + + A   S
Sbjct: 288 RDANRADNKAASVALDSLINFEAVKYFNNEKYLADKYNGSLINYRDSQIKVSQSLAFLNS 347

Query: 384 STSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAF-MLYTEYSGSAVFGLSNFYSELMKGA 442
             +++   +   ++  G   V+ G L++GDL     L  + S    F L + Y EL +  
Sbjct: 348 GQNLIFTSALTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNF-LGSVYRELKQSL 406

Query: 443 GAASRLFELTDHQPSI-------YATKGVPYVPGKGEIKFENVSFSY-PTRSANQIFNNL 494
                LF+L  ++  I          + VPY     +I F+NV+F Y P R   +I  N 
Sbjct: 407 IDMEALFKLRKNEIKIKNAERPLMLPEHVPY-----DITFQNVTFGYHPDR---KILKNA 458

Query: 495 NFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVV 554
           +FTI +GS   +VG SG GKSTI  L+ ++Y+P SGRI I+G+DI +    +LR+ +GVV
Sbjct: 459 SFTIPAGSKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRKVIGVV 518

Query: 555 QQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLS 614
            Q+  L + +I +N+ +G     T +E+ +V +K      I K   G+ T++G +G ++S
Sbjct: 519 PQDTPLFNDTIWENVKFG-RIDATDEEVNTVVEKAQLAPLIKKLPQGFNTIVGERGLMIS 577

Query: 615 GGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLS 674
           GG+KQR+AIAR L+K   I+  DEATSALD  +E A+  T+     S   T + IAHRL 
Sbjct: 578 GGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRSNFPSGSRTSVYIAHRLR 637

Query: 675 TIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKD 718
           TI  ++ +IV  D+G V E GK  EL A+  S LY+ L    +D
Sbjct: 638 TIADADKIIVF-DNGKVREEGKHLELLATPGS-LYRELWTIQED 679

>YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON}
           ATM1Mitochondrial inner membrane ATP-binding cassette
           (ABC) transporter, exports mitochondrially synthesized
           precursors of iron-sulfur (Fe/S) clusters to the cytosol
          Length = 690

 Score =  191 bits (484), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 138/404 (34%), Positives = 215/404 (53%), Gaps = 21/404 (5%)

Query: 324 RDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFS 383
           RD  ++      VA + L   + V+ F  E+    +YN ++    D   + + + A   S
Sbjct: 285 RDANKADNKAASVALDSLINFEAVKYFNNEKYLADKYNGSLMNYRDSQIKVSQSLAFLNS 344

Query: 384 STSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAF-MLYTEYSGSAVFGLSNFYSELMKGA 442
             +++   +   ++  G   V+ G+L++GDL     L  + S    F L + Y +L +  
Sbjct: 345 GQNLIFTTALTAMMYMGCTGVIGGNLTVGDLVLINQLVFQLSVPLNF-LGSVYRDLKQSL 403

Query: 443 GAASRLFELTDHQPSI-------YATKGVPYVPGKGEIKFENVSFSY-PTRSANQIFNNL 494
                LF+L  ++  I          + VPY     +I FENV+F Y P R   +I  N 
Sbjct: 404 IDMETLFKLRKNEVKIKNAERPLMLPENVPY-----DITFENVTFGYHPDR---KILKNA 455

Query: 495 NFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVV 554
           +FTI +G    +VG SG GKSTI  L+ ++Y+P SGRI I+G+DI +    +LR+ +GVV
Sbjct: 456 SFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRKVIGVV 515

Query: 555 QQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLS 614
            Q+  L + +I +N+ +G     T +E+ +V +K      I K   G++T++G +G ++S
Sbjct: 516 PQDTPLFNDTIWENVKFG-RIDATDEEVITVVEKAQLAPLIKKLPQGFDTIVGERGLMIS 574

Query: 615 GGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLS 674
           GG+KQR+AIAR L+K   I+  DEATSALD  +E A+  T+     S   T + IAHRL 
Sbjct: 575 GGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRDNFTSGSRTSVYIAHRLR 634

Query: 675 TIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKD 718
           TI  ++ +IVL D+G V E GK  EL A   S LY+ L    +D
Sbjct: 635 TIADADKIIVL-DNGRVREEGKHLELLAMPGS-LYRELWTIQED 676

>TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {ON}
           Anc_5.20 YMR301C
          Length = 711

 Score =  186 bits (473), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 130/385 (33%), Positives = 204/385 (52%), Gaps = 22/385 (5%)

Query: 336 VAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLI 395
           +A + L   + V+ F  EQ    +YN +++   +   + A + A   S  +++   +   
Sbjct: 314 IALDSLINFEAVKYFNNEQYLASKYNTSLKSYTEAQVKVAQSLAFLNSGQNLIFTSALTA 373

Query: 396 VLAYGSHLVLQGSLSIGDLTAF-MLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDH 454
           ++  G   +L G+LS+GDL     L  + S    F L + Y +L +       LF+L  +
Sbjct: 374 MMYMGCTGILGGNLSVGDLVLINQLVFQLSVPLNF-LGSVYRDLKQSLIDMESLFKLRKN 432

Query: 455 Q--------PSIYATKGVPYVPGKGEIKFENVSFSY-PTRSANQIFNNLNFTIDSGSNVC 505
           +        P+I + K  P+      I+F+NV+F Y P R   +I  N +F I +G    
Sbjct: 433 EVKILNNKNPAILSLKDGPF-----NIEFKNVTFGYDPNR---KILRNASFIIPAGVKTA 484

Query: 506 VVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSI 565
           VVGPSG GKSTI  L+ ++Y+P  GR+ ++G D+      SLRR +GVV Q+  L + +I
Sbjct: 485 VVGPSGSGKSTILKLVFRFYDPEEGRVLVNGIDVRDYDLDSLRRAIGVVPQDTPLFNDTI 544

Query: 566 RDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIAR 625
            +N+ +G   T T ++I +  +K      I K    YET++G +G ++SGG+KQR+AIAR
Sbjct: 545 WENVKFG-DVTATDEQILNAVEKAQLGTLIEKLPKKYETIVGERGLMISGGEKQRLAIAR 603

Query: 626 ALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVL 685
            L+K   I+  DEATSALD  +E  +  T+         T + IAHRL T+  S+ +IVL
Sbjct: 604 VLLKNAPIMFFDEATSALDTHTEQELLKTIKNNFDKGSRTSVYIAHRLRTVADSDKIIVL 663

Query: 686 GDDGSVVEMGKFKELYASKESKLYK 710
             +GS+ E G    L  SK + LYK
Sbjct: 664 -KEGSIFEEGTHLGLL-SKPNSLYK 686

>ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} similar
           to uniprot|P40416 Saccharomyces cerevisiae YMR301C ATM1
           Mitochondrial inner membrane transporter exports
           mitochondrially synthesized precursors of iron- sulfur
           (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 709

 Score =  185 bits (469), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 132/395 (33%), Positives = 206/395 (52%), Gaps = 14/395 (3%)

Query: 324 RDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFS 383
           R+  ++      VA + L   + V++F  E+   ++Y  ++ K  D   R A + A   S
Sbjct: 280 REANKADNKAASVALDSLINFEAVKNFNNEKYLAEKYETSLLKYRDSQVRVAQSLAFLNS 339

Query: 384 STSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAF-MLYTEYSGSAVFGLSNFYSELMKGA 442
             +++   +   ++  G   ++ GSL++GDL     L  + S    F L + Y EL +  
Sbjct: 340 GQNLIFTTALTAMMYMGCTGIIGGSLTVGDLVLINQLVFQLSVPLNF-LGSVYRELKQSL 398

Query: 443 GAASRLFELTDH-----QPSIYATKGVPYVPGKGEIKFENVSFSYPTRSANQIFNNLNFT 497
                LF L ++      PS    K +P   G  +I FENV+F Y  R   +I  N +F 
Sbjct: 399 IDMESLFNLRNNPILIDNPS--KPKMLPANAGPFDIVFENVTFGYDPR--RKILQNASFV 454

Query: 498 IDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQE 557
           I +G    VVGPSG GKST+  L+ ++Y+P  GRI ++G DI +    SLRR +GVV Q+
Sbjct: 455 IPAGWKTAVVGPSGSGKSTLLKLVFRFYDPQEGRILVNGIDIREYDLDSLRRAIGVVPQD 514

Query: 558 PILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQ 617
             L + +I +N+ +G       +  RS+ +K      + +   G  T++G +G ++SGG+
Sbjct: 515 TPLFNDTIWENVKFGRIDADDQEVTRSI-EKAHLAPLVYRLPGGLNTIVGERGLMISGGE 573

Query: 618 KQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIR 677
           KQR+AIAR L+K  +I+  DEATSALD  +E A+  T+         T + IAHRL TI 
Sbjct: 574 KQRLAIARVLLKNSSIMFFDEATSALDTHTEQALLRTIRANFDRGSKTSVYIAHRLRTIA 633

Query: 678 RSENVIVLGDDGSVVEMGKFKELYASKESKLYKLL 712
            ++ +IVL ++G   E G   EL   KE  LY+ L
Sbjct: 634 DADKIIVL-EEGRPREEGTHHELL-QKEDSLYREL 666

>Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON}
            (464370..468200) [3831 nt, 1277 aa]
          Length = 1276

 Score =  187 bits (475), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 156/575 (27%), Positives = 268/575 (46%), Gaps = 32/575 (5%)

Query: 161  VIGMVLDVAK---NAITSDEKPKDLRDLPPVVWGLGLYDFLAVFAGALVLSTFA----NF 213
            V G+V  +A    N I S      L  + P V G G   +L  ++  ++  + A    NF
Sbjct: 707  VFGLVCSIAAGVANPIFSWAFSYLLNGIVPTVDGPGSPSYLVKWSIIVLCVSGADAVSNF 766

Query: 214  GRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDR--NKVGDLISRLSSDAYVVSRSMTQ 271
             +  +L    E  +  LR+  +++   +  E+F R  NK  ++ + L +D   +   ++Q
Sbjct: 767  LKTFILGYCSEYWIMDLRNRAMEEIAQKKLEWFSREENKSPEIAALLMNDLRDLRSLVSQ 826

Query: 272  NISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTG 331
             +S     +    VG+                      + + IYG  +++     +    
Sbjct: 827  FLSVISTFLTVSLVGLIWAIATGWKLSLVCISMFPLIVIFSIIYGTVLKNYETTYKTKVA 886

Query: 332  NLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDF 391
            NL  +  E ++GVKT++    +    K Y+    ++  + ++ A+      + T+ +   
Sbjct: 887  NLENLEYEIITGVKTIKCLQLQNHFKKCYHKLKDEMGQIARKRAIVTGLGIAITTAIATT 946

Query: 392  SFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFEL 451
               I+  YG  LV+ G  S   +        ++      L +   ++ +G  AAS ++ +
Sbjct: 947  IQSILYYYGLKLVMDGEYSTRTMFQTFTLLLFTVMTCNSLISQIPDISRGQRAASWIYRI 1006

Query: 452  TDHQPSIYATKGVPYVPGK------GE--------IKFENVSFSYPTRSANQIFNNLNFT 497
             +       TK      G+      GE        +   N+ F+YPT     I++NL+  
Sbjct: 1007 IEESED---TKEQTITDGRFDEIHCGEKVDKTQPLVSIHNLEFAYPTALDVNIYDNLSLD 1063

Query: 498  IDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQE 557
            ++ G  V +VG SG GKST+  LL K Y      I IDG D+++   ++LRR + VV+Q+
Sbjct: 1064 LNVGQTVAIVGESGSGKSTLVYLLTKLYQVADNCIDIDGTDVNEWDNETLRRQISVVEQK 1123

Query: 558  PILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQ 617
            P+L  G++R+N+ YG+ ++P   +I  + K    ++FI    +G ET +    +L+SGGQ
Sbjct: 1124 PVLFPGTVRENLIYGLYFSPLEIDIIDILKYVGVYDFIESLPEGLETSVDT--SLISGGQ 1181

Query: 618  KQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIR 677
             QR+ IARAL++KP ILILDE TSALD  S   IN  + +   S  +  ISI H    +R
Sbjct: 1182 AQRLCIARALLRKPKILILDECTSALDANSSKIINDIVAKGPPS--LLTISITHNEQMMR 1239

Query: 678  RSENVIVLGDDGSVVEMGKFKELYASKESKLYKLL 712
                V VL  DG + E G F +L+    ++LYK++
Sbjct: 1240 SCNTVAVL-KDGKICETGPFNKLFKPG-NELYKVV 1272

 Score =  158 bits (399), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 157/608 (25%), Positives = 276/608 (45%), Gaps = 43/608 (7%)

Query: 124 YKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVI-GMVLDVAKNAITSDEKPKDL 182
           +KE   ++   + DW LL+  + L TI+  +  AV  ++ G V D+ K+       PKD 
Sbjct: 9   WKENIYMYVQFKRDW-LLIATMVLTTIANGLVPAVTSILTGKVFDLLKD-FADPNIPKDH 66

Query: 183 RDLPPVVWGLGLYDFLAVFAGALVL-----STFANFGRVVLLRILGEKLVARLRSNVIKK 237
                +V  L     +A+ A A  L     ST+ +FG        G+    R R  ++  
Sbjct: 67  NLYHQLV--LRSMSLMALAACAFPLIWTSISTWMSFGE-------GQGFTVRYR--MLNS 115

Query: 238 TIHQDAEFFDR--NKVGDL------ISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGM 289
            + +  E++D+  N  GD       +  L + +   S    QNIS     I       G+
Sbjct: 116 YLDKSMEWYDKKENLSGDFTQLNRCVEELRASSAEASAITLQNISSMLSLI-------GV 168

Query: 290 MFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQS 349
            F+ S               + A I+ R I+  +      +G    +    ++  + ++ 
Sbjct: 169 SFYYSWSLTLIILCGTPLLIILAFIFSRSIQKYAALENTESGLAADLLAWSMNSAQMIKL 228

Query: 350 FVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSL 409
              + KEI+ +     K  D   + +L  A   S+   L    F+    +G+  + +G+L
Sbjct: 229 SCTQLKEIESFEELTLKCNDYFIKLSLYVAANISTLRFLSLAMFVQGFWFGNTEIRKGNL 288

Query: 410 SIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFE-LTDHQPSIYATKGVPYVP 468
           +I D+          GS +     +   L KG  A  ++   L D++  I  +       
Sbjct: 289 NISDVITCFSSCLMLGSTLNTTLGYLIFLQKGQVALRKIQSFLNDNKVEIDESALKQIDI 348

Query: 469 GKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPT 528
            K +I F +VSFSYP+R A+ + N+++    SG    +VG SG GKST+++LLLK Y+  
Sbjct: 349 SKADISFRHVSFSYPSRPADDVLNDISIDFLSGKTTFIVGRSGSGKSTLSNLLLKLYDEY 408

Query: 529 SGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGV----PYTPTID-EIR 583
            G I+I    I +I  + L +++ VV+Q   L + ++ +NI  G       +P +  +++
Sbjct: 409 DGYISIGSTHIREIDQQVLIKNITVVEQRCTLFNDTLVNNILLGSQDEDKSSPVVQKKLK 468

Query: 584 SVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSAL 643
              K     + I   S+G +T++G  G  LSGGQ+QR+A+ARA ++   +LILDEA SAL
Sbjct: 469 EAIKMACLESVIDSLSNGLDTILGTGGISLSGGQQQRVALARAYMRDTEVLILDEAVSAL 528

Query: 644 DVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYAS 703
           D+     +   + +  + R  T I + H LS I   + + V+ ++G ++E G   +L   
Sbjct: 529 DIVHREQLMSNITKWRQGR--TTIILTHELSQISIQDYLYVV-EEGRIIESGFQGQLMYD 585

Query: 704 KESKLYKL 711
            +S   ++
Sbjct: 586 PDSAFCRM 593

>Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {ON}
           similar to Ashbya gossypii AGL335W
          Length = 696

 Score =  184 bits (466), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 129/407 (31%), Positives = 208/407 (51%), Gaps = 10/407 (2%)

Query: 324 RDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFS 383
           RD   +      VA + L   + V+ F  E+    +Y+ ++    D   +   + A   S
Sbjct: 293 RDANSADNKAASVALDSLINFEAVKYFNNEEYLANKYHKSLLTYRDSQIKVQQSLAFLNS 352

Query: 384 STSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAF-MLYTEYSGSAVFGLSNFYSELMKGA 442
             +++   +   V+      V++GSL++GDL     L  + S    F L + Y EL +  
Sbjct: 353 GQNLIFTSALTAVMYMACSGVMEGSLTVGDLVLINQLIFQLSLPLNF-LGSVYRELKQSL 411

Query: 443 GAASRLFELTDHQPSIYATKGVPYVPGK--GEIKFENVSFSY-PTRSANQIFNNLNFTID 499
                LF L  ++ +I        +P K   +I+FENV+F Y P R   +I  N  FTI 
Sbjct: 412 IDMESLFRLQKNKITIKNVLNPQMLPEKLPSDIRFENVTFGYDPER---KILKNATFTIP 468

Query: 500 SGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPI 559
           +G    +VGPSG GKSTI  L+ ++Y P  GRI IDG+DI ++   SLR+ +GVV Q+  
Sbjct: 469 AGKKTAIVGPSGSGKSTILRLVFRFYEPEQGRILIDGKDIREVDLDSLRKSIGVVPQDTP 528

Query: 560 LMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQ 619
           L + +I +N+ +G     +  +I +  ++      I     G  T++G +G ++SGG+KQ
Sbjct: 529 LFNDTIWENVKFG-RIDASDKDITNAIERAQLTKLIQNLPKGINTIVGERGLMISGGEKQ 587

Query: 620 RIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRS 679
           R+AI+R L+K   ++  DEATSALD  +E ++  T+ +  + +  T + IAHRL TI  +
Sbjct: 588 RLAISRVLLKDCPLMFFDEATSALDTHTEQSLLKTINENFEGQSKTSVYIAHRLRTIADA 647

Query: 680 ENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKDTTSKMNAE 726
           + +IVL ++  V E G  K L  +  S   +L N +   T  K   E
Sbjct: 648 DKIIVL-NNSRVHEEGDHKTLLKTPGSLYSELWNIQESMTVDKSKTE 693

>KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1270

 Score =  185 bits (470), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 157/539 (29%), Positives = 253/539 (46%), Gaps = 29/539 (5%)

Query: 182  LRDLPPVVWGLGLYDFLAVFAGALVLSTFAN----FGRVVLLRILGEKLVARLRSNVIKK 237
            L  + P V G+G   +L  ++  ++   F +    F +   L  + E  +  LR+  ++ 
Sbjct: 728  LDGIVPKVDGVGSSHYLLKWSVIVLCVAFTDGISTFLKSFSLGFVSENWIMDLRNKAMES 787

Query: 238  TIHQDAEFF--DRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISS 295
              +++ E+F  D NK  +L + + +D   +   +++ IS     I+    G+        
Sbjct: 788  ITNKELEWFYKDENKSSELAALVLNDLRDLRSLISEFISAMSTFIVVSLAGLIWALTTGW 847

Query: 296  XXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQK 355
                          + + IYG  ++      + +  +L     E + G+KT++    EQ 
Sbjct: 848  KLSLVCIAMFPLIILFSAIYGSILQRYETTYKTTVADLENCVYEIMLGIKTIRCLQLEQH 907

Query: 356  EIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQG---SLSIG 412
             I+RY+    ++  +G++ A+      + T+ L      I+  YG  LV  G   ++ + 
Sbjct: 908  FIQRYSVLEARMKHIGRKRAIATGFGIAITTALVMCIEAILFYYGLKLVFIGEYTTMKMF 967

Query: 413  DLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYA-------TKGVP 465
                 +L+T  + ++   L N   ++ +G  AASR+F + D              T+G+P
Sbjct: 968  KTFTLLLFTIMTCTS---LINQIPDVTRGQRAASRIFRILDESDRFLEDSDEHGRTRGIP 1024

Query: 466  YVPG-KGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKY 524
                 K  I   N+ F YP+  ++ +FN LN  I     V VV  SG GKST+  LL + 
Sbjct: 1025 KNNSIKSIITINNLQFHYPSAESSNVFNRLNLQIADNQTVAVVAESGSGKSTLLYLLTRL 1084

Query: 525  YNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRS 584
            Y      I IDG DI++    SLR  + +V+Q+P L  GSIR N+ YG        +I  
Sbjct: 1085 YKVDFNSIFIDGTDINEWQLTSLRNLIAIVEQKPTLFEGSIRKNLIYGNKLEIMDMDIYD 1144

Query: 585  VSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALD 644
            V K+    +F+T   +G +T +    +LLSGGQ QRI IARAL++K  ILILDE TSALD
Sbjct: 1145 VLKQVGIFDFVTSLPNGIDTNVDT--SLLSGGQAQRICIARALLRKSKILILDECTSALD 1202

Query: 645  VESEGAINYTLGQLMKS--RDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELY 701
             ES     + +  L+KS    +  I+I H    +R   NVIVL  DG   + G F ELY
Sbjct: 1203 AESA----FVIQNLVKSGLPGVLTIAITHSEPMMRACGNVIVL-QDGETAQQGTFDELY 1256

 Score =  128 bits (321), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 132/519 (25%), Positives = 232/519 (44%), Gaps = 48/519 (9%)

Query: 222 LGEKLVARLRSNVIKKTIHQDAEFFDRNK--VGDLIS--RLSSDAYVVSRSMTQNISDGF 277
           +GE    R+R  ++   + +  E+FD N   +GD +   R   +    S   +      F
Sbjct: 96  IGETQSFRIRRTILLSYLKKPMEWFDENDQLLGDFVQMHRCVEEVRSGSAEASAITFQNF 155

Query: 278 KAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVA 337
            AII     +   F+ S               V A  + R I + ++     TG   +  
Sbjct: 156 VAII---ALVCTSFYYSWSLTLIILCSSPLLIVLAAFFSRMIENFTKLENDETGIAAQSL 212

Query: 338 EEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSS--TSVLGDFS--- 392
              ++  + V+ +  +  EIK++   + +  D        NA F+ S  TS+L   S   
Sbjct: 213 TWSMNAAQLVKLYCTQDFEIKKFKEIVIRCNDY-----FINAWFYVSANTSILRFLSLAM 267

Query: 393 FLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGS--------------AVFGLSNFYSEL 438
           F+    +GS ++ +  +S+  +          GS              A  GL+     L
Sbjct: 268 FVQGFWFGSTMIKKNKMSVDQVITCFSSCLMLGSILNTTLPQIVLLQKAHVGLNRVQDFL 327

Query: 439 MKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKFENVSFSYPTRSANQIFNNLNFTI 498
              +  A+      D Q SI     VP       I F+ +SF YP+R  + +  N++   
Sbjct: 328 EDKSEMATD----RDRQTSI-NLDNVPI-----SISFDAISFCYPSRPDDMVLKNISMNF 377

Query: 499 DSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEP 558
           D      +VG SG GKST+++LLLK+YN  +G I ++G ++  I    + +++ +V+Q+ 
Sbjct: 378 DPNKTTFIVGKSGSGKSTMSNLLLKFYNGYNGCIKVNGVNVQSIDRHWITKNVTLVEQKC 437

Query: 559 ILMSGSIRDNITYGVPYTPTIDEIRS-VSKKC---FCHNFITKFSDGYETVIGPKGALLS 614
            L + ++R+N+  G+ +    +++ S + + C      N I K   G +T +G  G  LS
Sbjct: 438 TLFNDTLRNNLLIGLSHISAAEDVDSRLQEACRFALLDNVIEKLPSGLDTKVGSGGVSLS 497

Query: 615 GGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLS 674
           GGQ+QR+A+ARA ++   ++ILDEA SALD  +   +   +    +S+  T I + H L+
Sbjct: 498 GGQQQRVALARAYLRDTPVVILDEAISALDARNRRQLMENIRIWTRSK--TAIILTHELN 555

Query: 675 TIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLN 713
            I  S+  + L ++G + E G   EL  + ES   K  +
Sbjct: 556 QILPSD-FLYLMENGQIKEEGYQNELIENVESTFCKFFH 593

>KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1275

 Score =  183 bits (465), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 135/519 (26%), Positives = 247/519 (47%), Gaps = 17/519 (3%)

Query: 206  VLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFD--RNKVGDLISRLSSDAY 263
            ++  F  F +  ++    E  +  LR  V++   +   E+F    NK  ++ +   +D  
Sbjct: 761  IIDAFCTFSKTFIMGYCSEYWIMDLRKKVMRTITYNKFEWFQLAENKPSEVSALALNDLR 820

Query: 264  VVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSIS 323
             +   +T+ ++     ++    G+                      V + +YG  ++   
Sbjct: 821  DLRTLVTEFLATASTFLVVSTCGLIWALVAGWKLSLVSISMFPLIIVFSGVYGAALQKCE 880

Query: 324  RDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFS 383
             D + +   L     E +  +KT++    +     RY+   +++  +G+R ++      +
Sbjct: 881  TDYKSAVAQLENCLYEVVVSMKTIRCLQLQTHFQNRYDRRKQRMLSLGRRRSVITGCGIA 940

Query: 384  STSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAG 443
             T  L      I+  YG  LV+ G  +   +        ++      L N   E+ +G  
Sbjct: 941  ITHTLTLCIQAILYYYGIKLVIDGKYTSKKMFEVFTLILFTIMTCTNLINQIPEVTRGQR 1000

Query: 444  AASRLFELT-------DHQPSIYATKGVPYVPGKGEIKF-ENVSFSYPTRSANQIFNNLN 495
            AA+ ++ +        +HQ     T  +     K  +   ++++F+YP   +  ++ +LN
Sbjct: 1001 AATYIYRILKEAAATREHQDMHNRTLPISNTSEKDTMVLVKDLTFAYPATPSKHVYEHLN 1060

Query: 496  FTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQ 555
              + S ++V +VG SG GKSTI SLL K Y+     I +DG D+S+    SLR  + VV+
Sbjct: 1061 LNLKSDTSVALVGESGSGKSTIISLLTKLYDVPEKHIYVDGTDLSEWDTNSLRNQISVVE 1120

Query: 556  QEPILMSGSIRDNITYGVPYTPTID-EIRSVSKKCFCHNFITKFSDGYETVIGPKGALLS 614
            Q   L++G+IR+N+TYG+P   T + ++  + K    ++F+++  +G +T++     LLS
Sbjct: 1121 QSANLLNGTIRENLTYGLPEEDTTEVDLIGILKLVSIYDFVSRLPNGIDTIVDRD--LLS 1178

Query: 615  GGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLS 674
            GGQ QR+ IARAL+K   ILILDE TSALD  S   I   + + +   +  II+I H   
Sbjct: 1179 GGQAQRLCIARALVKPHRILILDECTSALDALSTNIIIDIVRKGIP--NTLIIAITHDEH 1236

Query: 675  TIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLN 713
             +R  E+V++L  +G++VE G F EL   ++S+  K LN
Sbjct: 1237 MMRSCESVLLL-KNGAIVEQGSFVEL-MQQDSEFKKCLN 1273

 Score =  159 bits (401), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 152/617 (24%), Positives = 284/617 (46%), Gaps = 70/617 (11%)

Query: 137 DWKLLLVAISLLTISCSIGMAVPKVI-GMVLDVAKNAITSDEKPKD---LRDLPPVVWGL 192
           D+KLL V ++L TI+  +  A+  ++ G V D+  N   +D +      LR +  ++ G 
Sbjct: 14  DYKLLTV-VTLTTIASGLIPAITSILTGRVFDILSNISLNDRQFSHQLVLRSMSVMILGA 72

Query: 193 GLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRN--K 250
             +  + +F     ++++ + G V      G+    R+R N++   + +   ++D N  +
Sbjct: 73  ASFPVMWIF-----ITSWMHLGEVQ-----GD----RIRINMLGSYLSKSWTWYDGNGKR 118

Query: 251 VGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXV 310
           +    ++LS     V +S +++ +   ++ +     IG  F+ S                
Sbjct: 119 LLGEFTQLSRCIEEVRQSSSESAAITLQSFVSVLSLIGTSFYYSWSLTLIILCSTPIITA 178

Query: 311 GATIYGRKIRSISRDLQ-QSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFD 369
            A IY  K+ +   DL+ + T    ++    +     V+ + A+ +EI +++ ++ +   
Sbjct: 179 IA-IYFAKLTNKYTDLENKETSYAAELLTWSMRFNDMVKFYTAQNEEISKFDTSVTRCNS 237

Query: 370 VGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVF 429
           +  +  L +A   S    L    F+    +G+ ++ +  L I D+               
Sbjct: 238 LFIKACLYSALNSSIIRFLTLCMFVQGFWFGATMIRRNKLDINDV--------------- 282

Query: 430 GLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVP---------------YVPGKGE-- 472
            ++ F+S LM GA  +  + ++T  Q    A K +                  P KG   
Sbjct: 283 -ITCFHSCLMLGATVSEAMSQVTVIQKGHVANKKLEGFLELEGKTIMQAALKCPPKGNSL 341

Query: 473 -IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGR 531
            I F N+SF YP R++N    N++  ++SG    ++G SG GKST+A LLL++Y   SG 
Sbjct: 342 SITFNNISFKYPCRTSNSAVENVSLRLESGKMTFIIGKSGSGKSTLAKLLLRFYEEYSGS 401

Query: 532 ITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGV------PYTPTIDE-IRS 584
           IT+D   I  ++ + L  ++ VV+Q   L + ++R+NI  G           +I+E  R 
Sbjct: 402 ITVDNISICDLNQEWLLSNITVVEQNCTLFNDTLRNNILLGSENQSEPARMESIEERERK 461

Query: 585 VSKKC---FCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATS 641
           + K C     +  +   +DG +TVIG  G  LSGGQ+QR+A+ARA ++   I+I DE+ S
Sbjct: 462 LRKACNFALLNEMLADLTDGLDTVIGSGGVELSGGQRQRVALARAFLRNTPIMIFDESVS 521

Query: 642 ALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELY 701
           ALDV     +   +    + +  T I + H LS I  ++ + ++ + G V E G  ++L 
Sbjct: 522 ALDVAHRKLLMKAIRSWRQGK--TTIVLTHELSQINPTDFIYIM-EHGRVCEYGYQEDLL 578

Query: 702 ASKESKLYKLLNEKAKD 718
            S+ S   +    +A +
Sbjct: 579 KSETSYFSRFYQHQAPE 595

>TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1257

 Score =  180 bits (456), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 147/554 (26%), Positives = 255/554 (46%), Gaps = 50/554 (9%)

Query: 182  LRDLPPVVWGLG----LYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKK 237
            L  L P   G+G    L  +  +  G  +     NF +  L     E  + +LR+ V+++
Sbjct: 716  LNGLAPQFDGVGSPSYLLKWSLIVIGVAIADAILNFLQYFLFGYCSEYWILQLRNQVMQR 775

Query: 238  TIHQDAEFF--DRNKVGDLISR----------LSSDAYVVSRSMTQNISDGF-KAIICGG 284
               ++ ++F  +R+K  ++ +           L+SD  +   S     S G   A+I G 
Sbjct: 776  ISFEELDWFQRERHKASEVSALLLNDLRDLRALASDFLIAVSSFAVVSSVGIIWALIIGW 835

Query: 285  ----VGIGMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQ 340
                V I M   I                + + +YG  ++      + +  +L  +  E 
Sbjct: 836  KLSLVCISMFPLI---------------VIFSAVYGMALQRQETQYKSAVVDLENLLYEV 880

Query: 341  LSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYG 400
             +G+KT++    E   +++Y      +  +  R A+T     +    L      I+  Y 
Sbjct: 881  ATGIKTIRRLQLETNFLRQYKRLESHMRVIASRRAITTGLGVAVIEALAMSIQAILFYYA 940

Query: 401  SHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTD------- 453
              LV+ G  +   +   +    ++      L +   ++ +G  AA+R+ ++ D       
Sbjct: 941  LKLVIDGQYTTKKMFETLTLLLFTIMTCNILISQVPDISRGQRAANRILQMLDEKLEREK 1000

Query: 454  -HQPSIYATKGVPYVPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGR 512
             HQ     T G         I  +NV+F+YP+  +  IF++L   +  G    +VG SG 
Sbjct: 1001 PHQEKKQTTSG-SVSESSAVISLQNVTFAYPSAPSIHIFDSLYLELPIGRTFALVGQSGS 1059

Query: 513  GKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYG 572
            GKST+ +LL + Y PTSG + ++ +D+++ + + LRR + VV+Q P + SG++R+N+ YG
Sbjct: 1060 GKSTLVTLLTQLYRPTSGTVLVENKDVNEWNIRDLRRQMSVVEQTPTIFSGTVRENLLYG 1119

Query: 573  VPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPN 632
            + + P   E+  V +    H+FI+K   G +T I     LLSGGQ QR+ IARA++K+P 
Sbjct: 1120 LHHDPLEVEMYDVLRYVGIHDFISKLPLGLDTTIDID--LLSGGQLQRLCIARAILKRPK 1177

Query: 633  ILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVV 692
            ILILDE TSALD  S   IN  + +   +     ISI H +  ++  + +I L  +G V 
Sbjct: 1178 ILILDECTSALDPFSSHVINNIVRRGCPAP--LTISITHNVDMMKACDEIIFL-KNGRVA 1234

Query: 693  EMGKFKELYASKES 706
              G F  L  S ++
Sbjct: 1235 GTGSFDALLQSDKT 1248

 Score =  142 bits (359), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 136/511 (26%), Positives = 253/511 (49%), Gaps = 22/511 (4%)

Query: 198 LAVFA--GALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNK--VGD 253
           +A+ A  GA + +T+A+    +LL   GE+    +R  ++ K +    E++D+ +   G+
Sbjct: 62  MAIMALGGASLPTTWASISAWMLL---GERCGFGIRRRLLYKYLENPFEWYDKTEDICGN 118

Query: 254 LI--SRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVG 311
               +R   +A       +  I+     II     IG  F+ S               + 
Sbjct: 119 FTQQNRCVEEARASCAEASAVITRSLVTII---ALIGTSFYASWSLTLVTLCSAPLIIMC 175

Query: 312 ATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVG 371
              + RK++  +    + T   +++ +  ++  + ++    E +EIK + + ++   +  
Sbjct: 176 GWFFSRKVQRYADLENEQTSKASQLLDWSMTAAQFIRLSGTELREIKSFKNCVQNCTNNF 235

Query: 372 KREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGL 431
            +    ++   ++   L    F+    +GS ++ +G ++IGD+          GS + G 
Sbjct: 236 VKMCQYSSINLATLKFLSLAMFVQAFWFGSTMIRKGKMNIGDVITCFHSCILLGSTISGT 295

Query: 432 SNFYSELMKGAGAASRLFE-LTDHQPS---IYATKGVPYVPGKGEIKFENVSFSYPTRSA 487
                 + KG+ A + + + L D + +   I   + VP+   KG+I+F+NV FSYP+R  
Sbjct: 296 LQQLVIIQKGSVAVNIVSKFLADDKTATTDIRRWQDVPFPELKGDIRFQNVEFSYPSRPD 355

Query: 488 NQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSL 547
           + +  +++    +G    ++G SG GKS++++LLLK+Y   +G I++DG++I  I    L
Sbjct: 356 HNVLRSISLNFRAGKTTFLLGKSGSGKSSLSNLLLKFYENYTGVISVDGRNIKHIDQSQL 415

Query: 548 RRHLGVVQQEPILMSGSIRDNITYGV---PYTPTIDEIRSVSKKCFCHNFITKFSDGYET 604
            +++ VV+Q   + +G++++NI  G+        + +++ V +     NFI   SDG  T
Sbjct: 416 IKNITVVEQRCNVFNGTLKENIIIGIDGADEEEILTKLKLVCRISLLENFIHDLSDGLNT 475

Query: 605 VIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDI 664
           +IG  G  LSGGQ+Q++AIARAL+K P ILILDE+ SALDV   G I   +    K +  
Sbjct: 476 LIGSGGISLSGGQQQKVAIARALMKDPQILILDESLSALDVLQRGLILRAIRTHRKEK-- 533

Query: 665 TIISIAHRLSTIRRSENVIVLGDDGSVVEMG 695
           T I + H L+ I  S +   L + G  +E G
Sbjct: 534 TTIILTHELNQI-GSNDFCYLIESGQCIEHG 563

>YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}
            STE6Plasma membrane ATP-binding cassette (ABC)
            transporter required for the export of a-factor,
            catalyzes ATP hydrolysis coupled to a-factor transport;
            contains 12 transmembrane domains and two ATP binding
            domains; expressed only in MATa cells
          Length = 1290

 Score =  179 bits (453), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 141/523 (26%), Positives = 254/523 (48%), Gaps = 28/523 (5%)

Query: 212  NFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFF--DRNKVGDLISRLSSDAYVVSRSM 269
            NF +  LL    E  V  LR+ V++K   ++ ++F  + NK  ++ + + +D   + RS+
Sbjct: 777  NFAKGFLLDCCSEYWVMDLRNEVMEKLTRKNMDWFSGENNKASEISALVLNDLRDL-RSL 835

Query: 270  TQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXX--XXXVGATIYGRKIRSISRDLQ 327
                     + +     IG+++ + S                + + IYG  ++    D +
Sbjct: 836  VSEFLSAMTSFVTVST-IGLIWALVSGWKLSLVCISMFPLIIIFSAIYGGILQKCETDYK 894

Query: 328  QSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSV 387
             S   L     + ++ +KT++   AE      Y+    K+  +  + A+      S T++
Sbjct: 895  TSVAQLENCLYQIVTNIKTIKCLQAEFHFQLTYHDLKIKMQQIASKRAIATGFGISMTNM 954

Query: 388  LGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASR 447
            +      I+  YG  LV+    +  ++        ++  +   L +   ++ +G  AAS 
Sbjct: 955  IVMCIQAIIYYYGLKLVMIHEYTSKEMFTTFTLLLFTIMSCTSLVSQIPDISRGQRAASW 1014

Query: 448  LFELTDHQPSIYA-------TKGVPYVPGKGE-----IKFENVSFSYPTRSANQIFNNLN 495
            ++ + D + +          T G+      G+     +  +N++F+YP+     ++ N+N
Sbjct: 1015 IYRILDEKHNTLEVENNNARTVGIAGHTYHGKEKKPIVSIQNLTFAYPSAPTAFVYKNMN 1074

Query: 496  FTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQ 555
            F +  G  + ++G SG GKST+  LL K YN   G+I IDG D++  +  SLR+ + VV+
Sbjct: 1075 FDMFCGQTLGIIGESGTGKSTLVLLLTKLYNCEVGKIKIDGTDVNDWNLTSLRKEISVVE 1134

Query: 556  QEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSG 615
            Q+P+L +G+IRDN+TYG+       E+    K    H+F+     G +T I     LLSG
Sbjct: 1135 QKPLLFNGTIRDNLTYGLQDEILEIEMYDALKYVGIHDFVISSPQGLDTRIDT--TLLSG 1192

Query: 616  GQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIIS--IAHRL 673
            GQ QR+ IARAL++K  ILILDE TSALD  S   IN    +++K     +++  I H  
Sbjct: 1193 GQAQRLCIARALLRKSKILILDECTSALDSVSSSIIN----EIVKKGPPALLTMVITHSE 1248

Query: 674  STIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKA 716
              +R   ++ VL  DG VVE G F  LY ++  +L+++++ ++
Sbjct: 1249 QMMRSCNSIAVL-KDGKVVERGNFDTLYNNR-GELFQIVSNQS 1289

 Score =  167 bits (423), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 151/551 (27%), Positives = 243/551 (44%), Gaps = 67/551 (12%)

Query: 222 LGEKLVARLRSNVIKKTIHQD-AEFFDRNK--VGDL------ISRLSSDAYVVSRSMTQN 272
           +GE+   R+RS +++  + +   E++D N+  +GD       +  L S +   S    QN
Sbjct: 99  IGERQGFRIRSQILEAYLEEKPMEWYDNNEKLLGDFTQINRCVEELRSSSAEASAITFQN 158

Query: 273 ISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGN 332
           +       IC  +G    F+ S                 A ++ R I   S      T  
Sbjct: 159 L-----VAICALLGTS--FYYSWSLTLIILCSSPIITFFAVVFSRMIHVYSEKENSETSK 211

Query: 333 LTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFS 392
             ++    ++  + V+ +  ++ E K++   I     +        + FF + +  G   
Sbjct: 212 AAQLLTWSMNAAQLVRLYCTQRLERKKFKEII-----LNCNTFFIKSCFFVAANA-GILR 265

Query: 393 FLIV------LAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAAS 446
           FL +        +GS ++ +G L+I D+          GS +    +    L KG  A  
Sbjct: 266 FLTLTMFVQGFWFGSAMIKKGKLNINDVITCFHSCIMLGSTLNNTLHQIVVLQKGGVAME 325

Query: 447 RLFEL-------------TDHQ-PSIYATKGVPYVPGKGEIKFENVSFSYPTRSANQIFN 492
           ++  L               HQ P  YAT          ++ F NVSFSYP+R +  +  
Sbjct: 326 KIMTLLKDGSKRNPLNKTVAHQFPLDYAT---------SDLTFANVSFSYPSRPSEAVLK 376

Query: 493 NLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLG 552
           N++    +G    +VG SG GKST+++LLL++Y+  +G I+I+G +I  I  K L  ++ 
Sbjct: 377 NVSLNFSAGQFTFIVGKSGSGKSTLSNLLLRFYDGYNGSISINGHNIQTIDQKLLIENIT 436

Query: 553 VVQQEPILMSGSIRDNITYG---------VPYTPTIDEIRSVSKKCFCHNFITKFSDGYE 603
           VV+Q   L + ++R NI  G                  I+   +      FI    DG E
Sbjct: 437 VVEQRCTLFNDTLRKNILLGSTDSVRNADCSTNENRHLIKDACQMALLDRFILDLPDGLE 496

Query: 604 TVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRD 663
           T+IG  G  LSGGQ+QR+AIARA I+   IL LDEA SALD+     +   +    K + 
Sbjct: 497 TLIGTGGVTLSGGQQQRVAIARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRHWRKGK- 555

Query: 664 ITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYA---SKESKLYKLLNEKAKDTT 720
            T I + H LS I  S++ + L  +G VVE G   EL A   +  S  Y L N+ + D  
Sbjct: 556 -TTIILTHELSQI-ESDDYLYLMKEGEVVESGTQSELLADPTTTFSTWYHLQNDYS-DAK 612

Query: 721 SKMNAETVEKN 731
           + ++ ET EK+
Sbjct: 613 TIVDTETEEKS 623

>ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1273

 Score =  178 bits (451), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 123/408 (30%), Positives = 206/408 (50%), Gaps = 13/408 (3%)

Query: 312  ATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVG 371
            + IYG  ++    + + +   L  V  E ++G+KT++    E     ++N   +    +G
Sbjct: 867  SMIYGILLKKYETEYKNTIAKLENVQYEVVTGMKTIRCLQIEDHFKAKFNVLKQTAKLMG 926

Query: 372  KREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGL 431
            +R A+      + ++ L      I+  Y   LV+ G  +   +        ++      L
Sbjct: 927  QRRAIVTGFGVAVSNGLTMSIQGILYYYAIKLVIHGEYTTKKMFETFTLLLFTIMTCNNL 986

Query: 432  SNFYSELMKGAGAASRLFELTD--HQPSIYATKG---VPYV--PGKGEIKFENVSFSYPT 484
             N   ++ +G  AAS+++ + +   +   + T+G   VP V  P    I+F ++SF+YPT
Sbjct: 987  VNQIPDIRRGQRAASKIYRILEGIDESECFETEGHRIVPIVENPTGPIIRFNDLSFAYPT 1046

Query: 485  RSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISA 544
                +I  +L+  I SG  + +VG SG GKST+ +++ + Y   S  + +D  D++  + 
Sbjct: 1047 APTVKILKHLSMEIYSGDRIAIVGESGCGKSTLVNIITRLYECPSNSLFVDNTDVNDWAL 1106

Query: 545  KSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYET 604
              LR  + VV+Q+P L  G+IR+N+ YG P      ++ ++ K    ++F     +G ET
Sbjct: 1107 PKLREQIAVVEQKPTLFKGTIRENLVYGSPLGTADVDVFNMLKYVGIYDFFATLPEGLET 1166

Query: 605  VIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDI 664
             I     LLSGGQ QR+ IARAL+++P ILILDE TSALD  S   IN  + +      +
Sbjct: 1167 KI--DSGLLSGGQNQRLCIARALLQRPKILILDECTSALDTMSSHIINEIIRE--GPPTM 1222

Query: 665  TIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLL 712
              ISI H    +R    V VL D G +VEMG  ++L   K  +L+KL+
Sbjct: 1223 LTISITHDEQMVRACNKVAVL-DQGHIVEMGNREDLLRQK-GQLWKLV 1268

 Score =  156 bits (395), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 138/537 (25%), Positives = 245/537 (45%), Gaps = 38/537 (7%)

Query: 197 FLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKV--GDL 254
            LA+ AG++V+        +    +LGE+   R+R+ +I   + +  +++D N    GDL
Sbjct: 68  ILALGAGSIVIIWIC----ISSWMLLGERQNFRVRTQLIDSYLQKPMKWYDDNDTLTGDL 123

Query: 255 ------ISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXX 308
                 +  L S +   S    +N+       +         F+ S              
Sbjct: 124 TQTNRCVEELRSSSAEASALTWKNLVTILALTVTS-------FYYSWSLTLVTMCGAPVI 176

Query: 309 XVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVF 368
            + A  + R I   S      T   +++    +   + V+    +  E++ +  A++K  
Sbjct: 177 VLCAIFFSRLIHIYSEKENSHTAISSQLLSWSMEAAQLVRLSCMQLVEVQNFQLAVKKC- 235

Query: 369 DVGKREALTNATFFSSTSVLGDFSFLIVLA----YGSHLVLQGSLSIGDLTAFMLYTEYS 424
               +  +    + S+ + +  F  L +      +GS ++ +  L I D+          
Sbjct: 236 ---SKNFMKMCLYASANTAILKFLTLTIFVQAFWFGSTMIRKHKLRIEDVITCFQSCVLL 292

Query: 425 GSAVFGLSNFYSELMKGAGAASRLFELT---DHQPSIYATKGVPYVPG--KGEIKFENVS 479
           G+ + G  +    L KG      + E     ++    +      Y+ G    +I+  NV 
Sbjct: 293 GATINGTLHQIVILQKGKVGVINVNEFLKKDEYLKEDFKNNRRFYLDGGISEKIELRNVQ 352

Query: 480 FSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDI 539
           F+YP+R       N++ T+  G    VVG SG GKS++ +LLLK Y+  +G I+IDG DI
Sbjct: 353 FNYPSRPTVPALKNVSLTLPVGKITYVVGKSGSGKSSLGNLLLKLYDDYNGSISIDGIDI 412

Query: 540 SKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKC---FCHNFIT 596
             I  KS+ +++ +V+Q   L + ++R+NI +G   T  +    S+   C      NFI 
Sbjct: 413 KGIDQKSILKNITLVEQRCTLFNDTLRNNILFGSKETDELVRDESLKAACRISLLDNFIY 472

Query: 597 KFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLG 656
              +G +T+IG  G   SGGQ+QRIAIARA ++   IL+LDEA SALD+   G +   + 
Sbjct: 473 DLPEGLDTLIGTGGITPSGGQQQRIAIARAYMRDTPILVLDEAVSALDIIHRGLLMNAIR 532

Query: 657 QLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLN 713
              +S   TII + H LS I   +++I L +DG VVE G+ + L  +++ + + +++
Sbjct: 533 N-WRSEKTTII-LTHDLSEI-GPDDMIYLLEDGEVVEQGQQRNLLLNQQGRFFNMVS 586

>SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1310

 Score =  177 bits (450), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 162/593 (27%), Positives = 273/593 (46%), Gaps = 35/593 (5%)

Query: 144  AISLLTISCSIGMAVPK----VIGMVLDVAK---NAITSDEKPKDLRDLPPVVWGLGLYD 196
            +ISL TI   +   + K    ++G+   +     N I S    K L  + P    +G   
Sbjct: 728  SISLWTIVRKMNTTINKRSLLILGLTCSLMAGIANPIFSYTFSKLLSGIVPQNNEIGSPK 787

Query: 197  FLAVFAG-----ALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFF--DRN 249
            +L  ++G     A++ STF  F +   L    E  +  LR   I+K   QD  +F  D N
Sbjct: 788  YLIKWSGIVLFIAVLDSTFT-FLKNFFLGYCSEYWIRDLRMLAIRKITAQDLHWFSLDMN 846

Query: 250  KVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXX 309
            K  ++ + + +D   +   +++ +S     II   VGI   F                  
Sbjct: 847  KSSEISALVLNDLRDLRSLVSEFLSSISTLIIVSSVGIVWAFISGWKLSLVCISLFPIFI 906

Query: 310  VGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFD 369
            + +  YG  ++    D +     L     E   G+ T++    E + +++Y +  +K+  
Sbjct: 907  LFSCFYGGLLQRYETDYKTKVAELENQLHEIFRGITTIRYLKLEYQFLEKYYNLEKKMRR 966

Query: 370  VGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLS---IGDLTAFMLYTEYSGS 426
              K+ A+T     ++++ L      I+  YG  LV  GS S   + +    +L+T  +  
Sbjct: 967  ASKKRAITIGFGVAASNTLTLAVQAILFYYGIKLVTTGSYSTEKMFETFTLLLFTVMTCV 1026

Query: 427  AVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGE----IKFENVSFSY 482
            ++ G      ++ +G  AA+ +F + D+Q      +       K      I  +N+SFSY
Sbjct: 1027 SLIGQ---IPDISRGQRAATYIFRIIDNQSPAAKDEKKKIASYKFTHDPLISVKNLSFSY 1083

Query: 483  PTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKI 542
            P+  +  I+  L   + SG  + VVG SG GKST+  L+   Y   +G I IDG DI++ 
Sbjct: 1084 PSAPSTAIYKGLKLDVFSGETIAVVGESGSGKSTLTLLISALYEVPNGSIEIDGIDINRW 1143

Query: 543  SAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGY 602
                LR  + VV+Q+P    G++ +N+ YG+    T  +++         +F+    +G 
Sbjct: 1144 DTNKLRTIISVVEQKPQFFDGTVGENLLYGISGRVTQIQVKEALCLAGVQDFVFSLPEGL 1203

Query: 603  ETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSR 662
            +T I    +L+SGGQ QR++IARA+++KP IL LDE TSALD  +  AI      L+K  
Sbjct: 1204 DTRIDT--SLISGGQAQRLSIARAMLRKPKILFLDECTSALDTSNTHAI----ANLIKKH 1257

Query: 663  --DITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLN 713
               IT I I H    +R  E + VL  +G V E G F +LYA +  + ++++N
Sbjct: 1258 FCGITTIVITHNEQMMRACERIAVL-QNGKVAEDGSFDDLYAQR-GEFFRIMN 1308

 Score =  137 bits (345), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 142/559 (25%), Positives = 242/559 (43%), Gaps = 57/559 (10%)

Query: 222 LGEKLVARLRSNVIKKTIHQDAEFFDRN--------KVGDLISRLSSDAYVVSRSMTQNI 273
           LGEK   R+R  ++   + +   ++D++        ++   +  L S     S    QN+
Sbjct: 104 LGEKQGLRVRRKLLNTYLDKPLTWYDKSEQASGEFTQLNRCVEELRSSCAESSAITFQNV 163

Query: 274 SDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNL 333
              F   I         F+ S               V + I  + I   +R     +   
Sbjct: 164 VTVFALTITS-------FYYSWSLTLVIMAGVPIIIVFSVILSKLIERFTRLENMESSRA 216

Query: 334 TKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSF 393
            ++        + ++ F  +Q EI+++  +++K      R +L ++  ++         F
Sbjct: 217 AQMVSWSFDAAEMIRLFCTQQFEIEKFELSVKKCTKYFIRISLFSSASYAMLRFFTLCMF 276

Query: 394 LIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFG--LSNFYSELM---KGAGAASRL 448
           +    +G+ ++ QG L+ GD+      T +S   + G  L+N   +++   KG  A  ++
Sbjct: 277 IQGFWFGNKMIRQGVLTTGDVI-----TCFSSCLLLGNTLNNTLQQVITMQKGKVALGKI 331

Query: 449 FELT-------DHQPSIYATKGV-------PYVPGKGEIKFENVSFSYPTRSANQIFNNL 494
              T       DH+  I +   +        +  G GEI F+NVSFSYPTR    +  N+
Sbjct: 332 LMFTSEENDFPDHRNEIISDAFILNHINANKFRCG-GEISFKNVSFSYPTRPNYHVLKNV 390

Query: 495 NFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVV 554
           +          +VG SG GKSTI  LLLK Y   +G I +DG DI  I    L  ++ +V
Sbjct: 391 SLNFPKNKTTFIVGKSGSGKSTIGKLLLKSYGGYTGAIEVDGIDIQHIKTSWLAENITLV 450

Query: 555 QQEPILMSGSIRDNITYGVPYTPTIDE-IRSVSKKCFCHNFITKFSDGYETVIGPKGALL 613
           +Q   L + +I++NI  G       D  +R   +       I    +G +TV+G  G  L
Sbjct: 451 EQSCTLFNDTIKNNILLGCKGKAYGDSLVREACQMALLDRLIFDLPNGLDTVLGSGGVSL 510

Query: 614 SGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRL 673
           SGGQKQR+A+ARA ++   ILILDEA S +D+     +   + +  K   +T + + H L
Sbjct: 511 SGGQKQRVALARARVRDSPILILDEAISGMDIIHRDLLVEAIKKWRKG--MTTVIVTHEL 568

Query: 674 STIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLN-EKAKD-------TTSKM-- 723
           + I   E+ +   ++G + E G    L  ++ S   +L   +KAK        +TS +  
Sbjct: 569 TQI-SDEDYLYFMEEGQIRESGFKCNLEKNENSHFNRLWRLQKAKTGFSRRSVSTSNLEK 627

Query: 724 ---NAETVEKNDPSPKTEK 739
              NAE V +    P T +
Sbjct: 628 FPENAEVVNETKLDPCTHQ 646

>Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON}
           YKL209C (REAL)
          Length = 1316

 Score =  174 bits (442), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 174/648 (26%), Positives = 284/648 (43%), Gaps = 62/648 (9%)

Query: 128 FRLFR--LARHDWKLLLVAISLLTISCSIGMAVPKVI-GMVLDVAKNAITS----DEKPK 180
           + +FR    R D+KLL++ I + T++  +  A+  ++ G V D+    + S    D  P+
Sbjct: 38  YHIFRNVCIRSDYKLLILMI-ISTVATGLVPAITSILTGRVFDLLSVFVLSGSHNDLYPQ 96

Query: 181 DLRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIH 240
            L      V  LG+    A++   L L+++   G    LRI  + L A L    +K    
Sbjct: 97  -LVQRAMAVMALGVASVPAMW---LSLTSWMYIGEKQGLRIRSQLLEAYLEKKPMKWYDV 152

Query: 241 QDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXX 300
            D    D  ++   +  L S +   S    QN+       IC  +G    F+ S      
Sbjct: 153 NDTLLGDFTQINRCVEELRSSSAEASAITFQNL-----VAICALLGTS--FYYSWSLTLI 205

Query: 301 XXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRY 360
                      A  + R +   S+   + T    ++    ++  + V+ +  +  E K++
Sbjct: 206 ILCSSPIITFFAVAFSRMVHMYSQKENEETSKAAQLFAWSMNAAQLVRLYCTQPLERKKF 265

Query: 361 NHAIRKVFDVGKREALTNATFFSSTSVL-----GDFSFLIV------LAYGSHLVLQGSL 409
                      +R  L+  TFF  + +      G   FL +        +GS ++ QG L
Sbjct: 266 -----------QRIILSCNTFFIKSCLFVAANAGILRFLTLTMFVQGFWFGSTMIKQGKL 314

Query: 410 SIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGV----- 464
           +I D+          GS +    +    L KG  A  ++  L ++ P       +     
Sbjct: 315 NINDVITCFHSCILLGSTLNNTLHQIVVLQKGEVALQKIMNLLENGPKCNPPNEIELHQY 374

Query: 465 PYVPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKY 524
           P      ++ F+NVSFSYP+R +  +  N +    +G    +VG SG GKST++SLLLK+
Sbjct: 375 PLDYANSDLVFDNVSFSYPSRPSEIVLENASLKFPAGQFTFIVGKSGSGKSTLSSLLLKF 434

Query: 525 YNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYG-------VPYTP 577
           Y+   G I+I+G++I  I  K L +++ VV+Q   L + ++R NI  G         Y+ 
Sbjct: 435 YDGYDGSISINGRNIQAIPQKLLIKNITVVEQRCTLFNDTLRKNILLGSTELAKNADYST 494

Query: 578 --TIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILI 635
               + I+   +       I    DG ET+IG  G  LSGGQ+QR+A+ARA I+   IL 
Sbjct: 495 NKNTNLIKDACRMALLDRLILDLPDGLETLIGSGGVTLSGGQQQRVAMARAFIRDTPILF 554

Query: 636 LDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMG 695
           LDEA SALD+     +   +    K +  T I + H L  +  S++ + L  +G V+E G
Sbjct: 555 LDEAVSALDIIHRNLLMKAIRHWRKGK--TTIILTHELGQV-ESDDHLYLMQEGKVIESG 611

Query: 696 KFKELYASKESKLYKL--LNEKAKDTTSKMNAETVEKNDPSPKTEKLN 741
              EL A   S   K   L +   DT + +N+E  EK+  S  TE  N
Sbjct: 612 TQSELLADSTSTFSKWYCLQKDYSDTKTIVNSEIDEKSLNS--TESFN 657

 Score =  149 bits (377), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 137/522 (26%), Positives = 247/522 (47%), Gaps = 28/522 (5%)

Query: 212  NFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFF--DRNKVGDLISRLSSDAYVVSRSM 269
            NF +  LL    E  +  LR+ V++K   +   +F  + NK  ++ + + +D   + RS+
Sbjct: 803  NFAKGFLLGYCSEYWIMDLRNEVMEKLTKKSMNWFSGEDNKASEVSALVLNDLRDL-RSL 861

Query: 270  TQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXX--XXXVGATIYGRKIRSISRDLQ 327
                     + I     IG+++ ++S                + + IYG  ++    D +
Sbjct: 862  VSEFLSAITSFITVSF-IGLVWALASGWKLSLVCISMFPLIIIFSAIYGSILQKHETDYK 920

Query: 328  QSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSV 387
             S   L     + ++ +KT++   AE      Y+    K+  +  + A+      S T++
Sbjct: 921  TSVVQLENCLYQIVTNIKTIKYLQAEFHFQLSYHKLKTKMEQIASKRAIATGFGISMTNM 980

Query: 388  LGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASR 447
            +      I+  YG  LV+    +   +        ++  +   L +   ++ +G  AAS 
Sbjct: 981  IAMCIQAILYYYGLKLVMVHEYTSKKMFTTFTLLLFTIMSCTSLVSQIPDISRGQRAASW 1040

Query: 448  LF----------ELTDHQPSIYATKGVPYVPGKGE--IKFENVSFSYPTRSANQIFNNLN 495
            ++          E+ D+        G  Y   +    +  +N++F+YP+  +  I+ N+N
Sbjct: 1041 IYRILDEKQVTLEIEDNNARSIGIIGETYHEKQTTPMLSIQNLTFAYPSAPSVLIYKNMN 1100

Query: 496  FTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQ 555
              +  G  + +VG SG GKST+  LL + Y+   G I +DG D++  +   LRR + VV+
Sbjct: 1101 LNMFCGQTIGIVGGSGSGKSTLVLLLTRLYDCEVGSIKLDGTDVNDWNLTVLRREISVVE 1160

Query: 556  QEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSG 615
            Q+P+L +G+IRDN+TYG        EI    K    ++F+     G  T I     LLSG
Sbjct: 1161 QKPLLFNGTIRDNLTYGCLGEILEIEIYDALKYVGIYDFVASLPLGLGTRIDTN--LLSG 1218

Query: 616  GQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIIS--IAHRL 673
            GQ QR+ IARAL++KP ILILDE TSALD  S    ++ + +++K     +++  I H  
Sbjct: 1219 GQAQRLCIARALVRKPKILILDECTSALDSMS----SHVIKEIVKKGPPALLTLVITHDE 1274

Query: 674  STIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEK 715
              +R  +++ V   DG V+E G F  LY +   +++++++EK
Sbjct: 1275 QMMRCCDSIAVF-KDGKVIEEGSFDTLY-NNCGEMFRIVSEK 1314

>TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1253

 Score =  174 bits (442), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 140/525 (26%), Positives = 241/525 (45%), Gaps = 32/525 (6%)

Query: 198  LAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDR--NKVGDLI 255
            L V A AL   TF NF ++ +L    E  +  LR+ +++    +  E++ R  NK  ++ 
Sbjct: 726  LIVLAIALADGTF-NFIKIFILGYCSEYWIMDLRNELMQCVSQKRFEWYGRSSNKSSEIS 784

Query: 256  SRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIY 315
            +   +D   +   +T+ +S     +    +G+                      + + IY
Sbjct: 785  ALALNDLRDLRTLVTEFLSTMSTFVTVSMMGLIWAIATGWKLSLVCISMFPLIIIFSMIY 844

Query: 316  GRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREA 375
            G  +++     + +  +L  +  E ++ +KT++        +  Y+   +K+  + K+  
Sbjct: 845  GTVLQNYETSYKSAVADLENLQYEMITSIKTIKCLRLNDHFLGLYSELEKKMKRIAKKRT 904

Query: 376  LTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFY 435
            +      S  + +      I+  YG  LVL G  +   +        ++ +    L +  
Sbjct: 905  IVTGLGLSMLTTITTCIQSILYYYGLKLVLTGEYTSKTMFQTFTLVLFTVTTCNSLVSQI 964

Query: 436  SELMKGAGAASRLFELTDHQPSIYATKG----VPYVPGKGE----IKFENVSFSYPTRSA 487
             ++ +G  AAS +  + D         G    V  +  + +    I+ EN++F YP    
Sbjct: 965  PDVSRGQRAASWVLRIIDENEYTKEVNGEDCRVETIEHENDSDPLIEIENLNFHYPNTPG 1024

Query: 488  NQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSL 547
              ++ +LN  I+SG  + +VG SG GKST+  LL K Y+    RI I+G DI+  S   L
Sbjct: 1025 VNVYQDLNLKINSGETIGLVGQSGSGKSTLMYLLTKLYDVQDNRILINGTDINDWSYDIL 1084

Query: 548  RRHLGVVQQEPILMSGSIRDNITYGV----PYTPTIDEIRSVSKKCFCHNFITKFSDGYE 603
            R  + VV+Q+P L  G+IR+NITYGV    P + T  E++ + +    H F+       +
Sbjct: 1085 RAEICVVEQKPNLFHGTIRENITYGVSEKNPVSET--EVQELLQLVDMHEFVEALPKALD 1142

Query: 604  TVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI-------NYTLG 656
            TV+     LLSGGQ QR+ I R L++KP +LILDE TS+LD ++   +       N  LG
Sbjct: 1143 TVVDI--GLLSGGQAQRLCIVRTLLRKPKVLILDECTSSLDAQTTQIVIALIKDLNTKLG 1200

Query: 657  QLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELY 701
                  DI  I I H    ++    ++VL D G VVE G+F +L+
Sbjct: 1201 W-----DILTIVITHNRQMMQCCSRLVVL-DVGRVVEDGQFDDLH 1239

 Score =  165 bits (418), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 137/528 (25%), Positives = 245/528 (46%), Gaps = 29/528 (5%)

Query: 222 LGEKLVARLRSNVIKKTIHQDAEFFD--RNKVGDL------ISRLSSDAYVVSRSMTQNI 273
           LGE+   R+RS ++++ + +  E++D   N  GD       +  L S +   S    QN 
Sbjct: 93  LGERQGFRVRSKLLEEYLEKPMEWYDLKENLAGDFTQLNRCMEELRSGSAEASAVTYQNC 152

Query: 274 SDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNL 333
                A+IC      + F+ S               V A  + R I+  +    + T   
Sbjct: 153 V-AIIALIC------VSFYYSWQLTLIILCTSPFIIVCAACFSRFIQKYASFENKETAAA 205

Query: 334 TKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSF 393
             +    +   +TV+    + KEIK++   + K  D   R +L  A        L    F
Sbjct: 206 ADLLMWTMDSSQTVKLSCTQSKEIKKFETLVSKCNDYFIRTSLFTAANIGILRFLTLSMF 265

Query: 394 LIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTD 453
           +    +GS ++ +G L+I D+          GS +    +    + KG  A +++ +  +
Sbjct: 266 VQGFWFGSTMIRKGKLNISDVITCFYSCLMLGSILNTTLHHVIFIQKGQVALAKIQKFIN 325

Query: 454 HQPSI----YATKGVPYVPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGP 509
             P +      + G+ Y     +I  +N++F+YP+R    +  N++  I S     +VG 
Sbjct: 326 ESPELPSKTLTSSGLVY--SHVDISIDNLTFAYPSRPTENVLKNVSLKIKSARTTFIVGK 383

Query: 510 SGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNI 569
           SG GKSTI +L++K+Y    G I +  +DI  +    L +++ +V+Q   L + ++++NI
Sbjct: 384 SGSGKSTITNLIMKFYEDYKGNIIVGDKDIRSVPIDELLQNITLVEQRCTLFNDTLKNNI 443

Query: 570 TYGVPYTP-TIDE--IRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARA 626
             G  YT  TI++  + S+       + I+   DG ET +G  G  LSGGQ+QR+A+ARA
Sbjct: 444 LLGSKYTSQTINDGLLSSICSLACLDSVISSLPDGIETRLGTDGITLSGGQQQRVALARA 503

Query: 627 LIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLG 686
            ++  +ILILDEA SALD+     +   + ++ +++  T I + H L+ I  ++  I L 
Sbjct: 504 FLRDTDILILDEAVSALDIMQREILMRNISKVRQNK--TTIILTHDLNQINDND-YIYLF 560

Query: 687 DDGSVVEMGKFKELYASKESKLYKLLN--EKAKDTTSKMNAETVEKND 732
           ++  + E G  K L   + +  Y + N    A  T S+ ++ T+   D
Sbjct: 561 ENNEIKENGFKKTLMNDENTLFYNMYNLQRNAAITDSRASSPTIYDKD 608

>Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON}
            YKL209C (REAL)
          Length = 1290

 Score =  174 bits (442), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 142/530 (26%), Positives = 243/530 (45%), Gaps = 38/530 (7%)

Query: 210  FANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFF--DRNKVGDLISRLSSDAYVVSR 267
            F NF +  LL    E  +  LR+ ++ K   ++  +F  + NK  ++ + + +D   +  
Sbjct: 776  FFNFAKGFLLGYCSEYWIMDLRNKIMDKLTRKNINWFSGESNKASEITALVLNDLRDLRS 835

Query: 268  SMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQ 327
             +++ +S     +    +G+                      + + IYG  ++    D +
Sbjct: 836  LVSEFLSAMTSFVTVSTIGLVWALVSGWKLSLVCISMFPLIVIFSAIYGGILQKYETDYK 895

Query: 328  QSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSV 387
             S   L     + ++ +KT++   AE      Y+   +K+  +  + A+      S T++
Sbjct: 896  TSVAQLENCLYQIMTSIKTIKCLQAEFHFQLSYHDLKKKMEQIAYKRAIATGFGISVTNM 955

Query: 388  LGDFSFLIVLAYGSHLVL---QGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGA 444
            +      I+  YG  LVL     S  + +    +L+T  S +++ G      ++ +G  A
Sbjct: 956  IAMCIQAILYYYGLKLVLVHEYTSKKMFETFTLLLFTIMSCTSLVGQ---IPDISRGQRA 1012

Query: 445  ASRLFELTDHQPSI------------------YATKGVPYVPGKGEIKFENVSFSYPTRS 486
            AS ++ + D +                     Y  + +P       I   N+SF+YP+  
Sbjct: 1013 ASWIYRILDEEEDTLEIENNDARALDISGAEYYGDRNIPI------ISIRNLSFAYPSAP 1066

Query: 487  ANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKS 546
               IF +++  +     + +VG SG GKST+A LL + YN  +  I IDG D++  +  S
Sbjct: 1067 NVPIFKHMDLDMFCEQTIGIVGESGSGKSTLALLLTRLYNCEANSIIIDGTDVNDWNLTS 1126

Query: 547  LRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVI 606
            LR+ + VV+Q+P    GSIRDN+TYG        EI  V K    ++F+     G +T +
Sbjct: 1127 LRKQISVVEQKPSFFDGSIRDNLTYGCLGEMLEVEIYDVLKYVGIYDFVASLPQGLDTRV 1186

Query: 607  GPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITI 666
                 LLSGGQ QR+ IARAL++K  ILILDE TSALD  S   IN  + +      +  
Sbjct: 1187 DTN--LLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSRIINDIVRK--GPPGLLT 1242

Query: 667  ISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKA 716
            + I H    +R   ++ VL   G VVE G F  LY +KE +L++++  K+
Sbjct: 1243 LVITHSEQMMRCCNSIAVL-KHGKVVEEGNFDNLY-NKEGELFRIVCNKS 1290

 Score =  152 bits (384), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 170/633 (26%), Positives = 276/633 (43%), Gaps = 66/633 (10%)

Query: 135 RHDWKLLLVAISLLTISCSIGMAVPKVI-GMVLDVAKNAITSDEKPKDLRDLPP------ 187
           R+D+KLL + + + T++  +  AV  V+ G V D+    + S        DL P      
Sbjct: 22  RNDYKLLSIMV-VGTVATGLVPAVTSVLTGRVFDLLSVFVLSGSH----HDLYPQLVQRS 76

Query: 188 -VVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFF 246
             V  LG     A++   L L+ +   G     R+  + L A L +  +      +    
Sbjct: 77  MAVMALGAASVPAMW---LSLTAWMRIGERQGFRVRAQLLEAYLETKPMGWYDANETLLG 133

Query: 247 DRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXX 306
           D  +V   +  L S +   S    QN+       IC  +G    F+ S            
Sbjct: 134 DFTQVNRCVEELRSSSAEASAITFQNL-----VAICALIGTS--FYYSWSLTLIILCSSP 186

Query: 307 XXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRK 366
              + A I+ R I + ++     T N  ++    ++  + V+ +  +  E +++   I  
Sbjct: 187 VITIFAVIFSRLIHTYTQKENTETSNAAQLFTWSMNAAQLVRLYCTQPLERQKFQEII-- 244

Query: 367 VFDVGKREALTNATFFSSTSVL-----GDFSFLIV------LAYGSHLVLQGSLSIGDLT 415
                    L+  TFF  + +      G   FL +        +GS ++ +G L+I D+ 
Sbjct: 245 ---------LSCNTFFIKSCLYVAANAGILRFLTLTMFVQGFWFGSTMIRKGKLNINDVI 295

Query: 416 AFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVP-----GK 470
                    GS +    +    L KG  A  ++  L +      A+    ++        
Sbjct: 296 TCFHSCIMLGSTLNSTLHQIVVLQKGEVALQKIMALLESGSKQNASNTREHLQPPLNFAT 355

Query: 471 GEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSG 530
            ++ FENVSF+YP+R +  +  N+N    SG    +VG SG GKSTI++LLL +Y+   G
Sbjct: 356 SDLVFENVSFAYPSRPSETVLQNVNLKFPSGQFTFIVGKSGSGKSTISNLLLNFYDNYDG 415

Query: 531 RITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNI------TYGVPYTPTI---DE 581
            I I+G++   I  K L  ++ VV+Q   L + +++ NI      + G   T TI   + 
Sbjct: 416 SILINGRNTQSIQQKLLVSNITVVEQRCTLFNDTLKKNILLGSTGSIGNADTNTIGNNNL 475

Query: 582 IRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATS 641
           I+   +       I    DG ET+IG  G  LSGGQ+QR+AIARA I+   IL LDEA S
Sbjct: 476 IKDACRMALLDRLILDLPDGLETLIGSGGVSLSGGQQQRVAIARAFIRDTPILFLDEAVS 535

Query: 642 ALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELY 701
           ALD+     +   +    K +  T I + H LS I   +++ V+  +G VVE G   EL 
Sbjct: 536 ALDIVHRNLLMKAIRHWRKGK--TTIILTHELSQIESDDHLYVM-QEGRVVESGIQSELL 592

Query: 702 ASKE---SKLYKLLNEKAKDTTSKMNAETVEKN 731
           A      SK Y L N+ + D  + +N ET E++
Sbjct: 593 ADSATTFSKWYYLQNDFS-DAKTIINTETEEES 624

>TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_1.527
            YKL209C
          Length = 1296

 Score =  174 bits (440), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 152/572 (26%), Positives = 267/572 (46%), Gaps = 27/572 (4%)

Query: 162  IGMVLDV---AKNAITSDEKPKDLRDLPPVVWGLGLYDFL----AVFAGALVLSTFANFG 214
            IG++  +   A N I S      L  + P +  +G   +L     +  G  ++   +NF 
Sbjct: 729  IGLIFAIFAGATNPIFSWAFSYLLAGIAPTLKDIGSVHYLIKWSCIVIGITIIDGISNFF 788

Query: 215  RVVLLRILGEKLVARLRSNVIKKTIHQDAEFF--DRNKVGDLISRLSSDAYVVSRSMTQN 272
            +  LL I  E  +  LR   +K+ + +  ++F  ++ +  ++ + + +D   +   +++ 
Sbjct: 789  KGFLLGICSEYWIMDLRDKFMKEILRKKIQWFSDEKYQTAEMSALILNDLRDLRSLVSEF 848

Query: 273  ISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGN 332
            +S     I+    G+                      + + IYG  ++    D + S  N
Sbjct: 849  MSAMATFIVVSLFGLIWALVTGWKLALVCIAMFPLIIIFSAIYGAVLQKSETDYKSSVAN 908

Query: 333  LTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFS 392
            L  +  + +S +KT++S   E      Y  A  K+ +V  + ++      S T+ +    
Sbjct: 909  LENIEFDIVSNIKTIKSLQLEGHFYHNYKVAETKLKNVATKRSIYTGLGISITNTITMCI 968

Query: 393  FLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLF--- 449
              I+  YG  L++ G  ++  +        ++      L N   ++ +G  AAS ++   
Sbjct: 969  QAILYYYGFKLIMDGEYTVKQMFTTFTLLLFTVMTCNSLVNQIPDMSRGQRAASWVYSIL 1028

Query: 450  -------ELTDHQPSIYATKGVPYVPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGS 502
                   E+ D    I     +       +IK  N++F+Y +  + ++ + L   +  G 
Sbjct: 1029 QQSDDTKEVNDPNSIIVDNNTISNDFPILDIK--NLTFAYESTPSIKVLDGLTLKLFPGD 1086

Query: 503  NVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMS 562
             + + G SG GK+T+ SLL+K+Y+    +I  +G+DI     +SLR  + +V+Q+P ++S
Sbjct: 1087 KLAIAGESGCGKTTLLSLLVKFYDVDPNQIYFNGKDILNYEFESLRDAIVIVEQKPSVLS 1146

Query: 563  GSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIA 622
            GSIRDN+        +  E+  V K     +FI     G +T+I     LLSGGQ QRI 
Sbjct: 1147 GSIRDNLLGNNKRLISDYELYDVLKLTGIFDFIETLPSGIDTIIDT--TLLSGGQAQRIC 1204

Query: 623  IARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENV 682
            IARAL++KP ILILDE TSALD  S   IN  + + +    +TIISI H  S +   +NV
Sbjct: 1205 IARALLRKPKILILDECTSALDAMSADIINNLVSKELNG--VTIISITHSESMMTSCQNV 1262

Query: 683  IVLGDDGSVVEMGKFKELYASKESKLYKLLNE 714
             VL  +G +VE+G +  L A+  S L KLL++
Sbjct: 1263 AVL-KNGKIVEVGTYDSL-ATSSSHLGKLLSK 1292

 Score =  168 bits (426), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 118/374 (31%), Positives = 197/374 (52%), Gaps = 27/374 (7%)

Query: 384 STSVLGDFSFLIVLA---YGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFG--LSNFYSE- 437
           +TS+L   + L+ +    +GS ++ +G L I ++      T +S   + G  +SN   + 
Sbjct: 266 NTSILRTLTLLMFVQGFWFGSTMIRKGHLKIDEVI-----TCFSSCLLLGSIISNTLHQI 320

Query: 438 --LMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKFENVSFSYPTRSANQIFNNLN 495
             L KG  A  ++ +  D           P       I F+N+SF+YP+R    I N +N
Sbjct: 321 VVLQKGEVALQKIVDFLDEADDPLEINSAPITLINSNISFQNISFAYPSRPNENILNQIN 380

Query: 496 FTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQ 555
               + +   +VG SG GKST+++LLLK+Y    G I ID  +I  ++ K+L  ++ +V+
Sbjct: 381 LYFQNSATTFIVGKSGSGKSTLSNLLLKFYETYKGDILIDNINIKNLNQKNLLDNIMIVE 440

Query: 556 QEPILMSGSIRDNITYGVP-YT-------PTIDE-IRSVSKKCFCHNFITKFSDGYETVI 606
           Q+  L + +IR+NI +GV  +T       P ++E +++        +F+    +G +TVI
Sbjct: 441 QKCTLFNDTIRNNILFGVSNFTNQYASNRPNLNERLKNACTFALLDHFLIDLPNGIDTVI 500

Query: 607 GPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITI 666
           G  G  LSGGQ+QR+A+ARA ++ P ILILDEA SALDV     +   + +L +S   TI
Sbjct: 501 GTGGITLSGGQQQRVALARAYMRDPPILILDEAVSALDVNIRELLMKAI-KLWRSNKTTI 559

Query: 667 ISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLN-EKAKDTTSKMNA 725
           I + H L+ I   + + V+   G ++E GK KEL     ++ +KL+  +   +     + 
Sbjct: 560 I-LTHDLTQIDNDDFLYVI-KHGRIIEHGKRKELITDPNTEFHKLVAIQNNNNLNEDFDL 617

Query: 726 ETVEKNDPSPKTEK 739
           ET +  + SP+ EK
Sbjct: 618 ET-DTFNGSPRDEK 630

>CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209c STE6
          Length = 1227

 Score =  173 bits (439), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 142/513 (27%), Positives = 241/513 (46%), Gaps = 17/513 (3%)

Query: 211  ANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDR--NKVGDLISRLSSDAYVVSRS 268
            + F ++  L   GE  +  LR     K I     +F +  NK   L + L +D   +   
Sbjct: 721  STFIKLFFLGYSGEFWIFELRQETFIKIIKNPISWFSKSNNKAPILSTLLINDLRDLRNL 780

Query: 269  MTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQ 328
            +T+ +S     I+   +G+     I                V   +YG  +       + 
Sbjct: 781  VTEFLSVITTLILVTSIGLVWAIAIGWKLSLVCIAIIPLVVVLTGLYGTILIKTENRYKT 840

Query: 329  STGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVL 388
            S  NL  +  E + G+KT+QS   +Q   K++N  I+ +   G   A+      + T++L
Sbjct: 841  SVANLESIVYEAIIGMKTIQSLCLQQYITKKFNCKIKLLEKNGTYRAVATGLGIALTNML 900

Query: 389  GDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRL 448
                  I+  YG  LVL G  +   L   +    ++   V  L     ++ +G  + S +
Sbjct: 901  VLLFQSILFYYGFKLVLTGEYTHSKLFETIALLLFTIVTVASLVTQLPDITRGQRSISWI 960

Query: 449  FELT--DHQPSIY------ATKGVPYVPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDS 500
             ++   D+Q +I        TKG+ + P +  I+  N+SF+Y      +   N+N  + S
Sbjct: 961  DQILKGDNQQTIEPPSNLSTTKGI-WNPNQPVIEVSNLSFTYAQVHNKKTLTNINMQLYS 1019

Query: 501  GSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPIL 560
                 +VG SG GKST+ +L+   Y+ + G I I   DI+K S K L + + ++QQ P+L
Sbjct: 1020 NQIYGIVGKSGSGKSTLINLICGLYSLSEGSINICSCDINKWSTKELHKTVALLQQNPVL 1079

Query: 561  MSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQR 620
               +IR+N+ YG+  T   + + +V +     +FI   ++G ++ +    +LLSGGQ QR
Sbjct: 1080 QFDTIRNNLLYGLTETVGDEHLLNVLEYVGLKSFIISLNNGLDSKL--DDSLLSGGQSQR 1137

Query: 621  IAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSE 680
            + +AR +++ P +LILDE TSALDV S   IN  +G   +S     I ++H+  TI+  +
Sbjct: 1138 LCMAREMLRNPKVLILDECTSALDVTSAKKINDIIGS--RSLAPVTIIVSHQKETIKLCD 1195

Query: 681  NVIVLGDDGSVVEMGKFKELYASKESKLYKLLN 713
             +  L  DG+V  MG ++EL      +  KLLN
Sbjct: 1196 KIFFLV-DGTVAMMGTYEEL-MENNWEFRKLLN 1226

 Score =  157 bits (396), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 145/581 (24%), Positives = 252/581 (43%), Gaps = 55/581 (9%)

Query: 127 IFRLFRLARHDWKLLLVAISLLTISCS-IGMAVPKV-------IGMVLDVAKNAITSDEK 178
           I+   R  ++ W L+L+ +      C+ I   VP +       I  +LD   + +  + K
Sbjct: 13  IYMNIRFRKNIWLLILILV------CTVINGLVPAISSILFGRIFHLLDDNSDKVDYNTK 66

Query: 179 PKDL--RDLPPVVWGLG--LYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNV 234
            K L  R +  ++ G+G   +++LA++   +                LGE+    +R  +
Sbjct: 67  RKQLVIRTMSILILGMGNLPFNWLAIYGWMM----------------LGERQSYIIRKKL 110

Query: 235 IKKTIHQDAEFFDRNK---VGDL--ISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGM 289
             +  +    +FD+ +   +G+   + R   +    S   +  +S    A+I     IG 
Sbjct: 111 FHEYFNLPCSWFDKYRSDIMGEFTQLHRCIEEVRSSSAEASAIMSQSLVAVI---ALIGT 167

Query: 290 MFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQS 349
            F+ S               + A I+ + I   +      +    +     L  ++ V+ 
Sbjct: 168 AFYFSWSLTLIIFCSTPFIIICAVIFSKYIHKYTEKENTESECAAERLAWMLKNIEFVRL 227

Query: 350 FVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSL 409
              +  EI  Y H I +  +   + +L  +   S   +L    F+    +GS ++ QG L
Sbjct: 228 HNGDDFEISMYTHYIAQANEYYIKASLFISANISILRLLSLLMFVQGFWFGSSMIKQGKL 287

Query: 410 SIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPS-----IYATKGV 464
           +I  +          GS +         L KG  A  RL ++ D  P      I A  G+
Sbjct: 288 NIDSVITSFHCCLMLGSIINSALGQAVVLQKGDVAMKRLLKMIDRTPRESLAFIDAISGI 347

Query: 465 PYVPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKY 524
             +P    I F NVSF YP R  +++F+ +NF I       V+GPSG GKST+  L+L +
Sbjct: 348 DLLP----IVFNNVSFCYPERKTDKVFDKMNFIIKPNKMTYVIGPSGSGKSTLFDLILLH 403

Query: 525 YNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYT--PTIDEI 582
           Y+   G I +   DI  I+   +  ++ +V Q P L + +IR+NI     +T  P+  E+
Sbjct: 404 YDNYHGSIMLGDLDIRSINRNIILENITLVSQTPTLFNDTIRNNILACSNWTNLPSKLEM 463

Query: 583 RSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSA 642
             + K     N I +  DG +T IG  G  LSGGQ Q++A+ARA  +  +IL+LDE  SA
Sbjct: 464 ECICKFALLENLIAELPDGLDTRIGSGGIKLSGGQAQKVALARAFARNTSILLLDEPLSA 523

Query: 643 LDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVI 683
           +D+     +   + +    +  T + I H L  IR ++N++
Sbjct: 524 VDMRQRIVLMENIKRWRNGK--TTVIITHDLEFIRNTDNIL 562

>AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKL209C (STE6)
          Length = 1284

 Score =  173 bits (439), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 142/537 (26%), Positives = 249/537 (46%), Gaps = 26/537 (4%)

Query: 190  WGL---GLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFF 246
            W L   G+  F AVF          NF ++ LL  + E+ V +LR N+++  + +D  + 
Sbjct: 763  WSLVVIGIASFDAVF----------NFLQLFLLGFVSEQCVRQLRGNMMQLVLKRDLHWI 812

Query: 247  DRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXX 306
             +NK  ++ +   +D   +    +  +S      +   VG+     I             
Sbjct: 813  SQNKSSEITALTMNDLRDLRNVTSILLSSLTSLCVLASVGLIWAIVIGWKLTLVCLSLLP 872

Query: 307  XXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRK 366
                  T+YG  ++      + +   L  +  E + GVKT++    E     RY    + 
Sbjct: 873  LFIGVITLYGMFVQKSEVQYKTAVSQLENLLSEIVKGVKTIKCLQLEPYFQGRYATMEKY 932

Query: 367  VFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGS 426
            +    +R ++   +  + TS L      I+  YG  LV+ G      L        ++  
Sbjct: 933  LKKQMRRRSILYGSGLAITSCLVILLQTILYYYGIRLVVTGEYDSKQLFQTFTLILFTTM 992

Query: 427  AVFGLSNFYSELMKGAGAASRLFELTDH---QPSIYAT--KGVP--YVPGKGEIKFENVS 479
            +  GL +      +G  A + +F + +    +P  Y+   +  P  +   +  +    ++
Sbjct: 993  SSVGLLSALPSSSRGQRAGTFVFGMLEEPLPEPDNYSAVLRKAPTNHFSREPLVVLRALN 1052

Query: 480  FSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDI 539
            F+YP     QI+ N N  I+ G+ V +VG SG GKST+  L+   Y      + IDG DI
Sbjct: 1053 FAYPAAKDVQIYKNFNLRINQGTKVAIVGESGSGKSTLFYLICGLYPVKPASLFIDGTDI 1112

Query: 540  SKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFS 599
                  +LR+ + VV+Q+P   +G+IR+N+ YG+  T T +EI  V  +    NF+    
Sbjct: 1113 CNWEMSALRKIIAVVEQKPRFFNGTIRENLVYGLEGTITDNEIYEVLAEVRIINFVRSLP 1172

Query: 600  DGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLM 659
            +G ET +     L+SGGQ QR++I RAL+++P +LILDE TSALD  +  AI   +   +
Sbjct: 1173 EGLETRVDTN--LVSGGQLQRLSIVRALLRRPTLLILDECTSALDAANANAIANVVRNSL 1230

Query: 660  KSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKA 716
               DIT+I I H    ++  + ++VL  +G+V E G F +L+ ++  +L++++   A
Sbjct: 1231 --HDITVIVITHSKQMMKMCDRIVVL-KNGAVAEDGSFDDLFRAR-GELHRMVTTTA 1283

 Score =  124 bits (311), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 129/595 (21%), Positives = 264/595 (44%), Gaps = 36/595 (6%)

Query: 137 DWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKN--AITSDEKPKDLRDLPPVVWGLGL 194
           D+ LL+  I++  I  ++   V  + G V DV +    +  + + + L  L      LG 
Sbjct: 20  DYGLLITMITMTIIWGTVPAVVAVLTGRVFDVMQQLAQMKYNTQAEFLHVLLVRSLELGS 79

Query: 195 YDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDR----NK 250
              + +    + ++++          +LGE+   R+R  +++  + +  +++D+    N 
Sbjct: 80  VGLVQIPVQWIAITSWM---------LLGERQSLRIRRELLRSYLAKPMQWYDKIDDING 130

Query: 251 VGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXV 310
           +  + +R   +A     S  +     F++ +   +     F  S+              +
Sbjct: 131 MYTITNRCVEEA---RASCAEASGVLFQSAVTALILAVTAFKFSAKLTVVTLAGAPLLAL 187

Query: 311 GATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDV 370
              ++ + ++  +    + T + +      L+    V+ F  +  E++++N A+      
Sbjct: 188 LTVVFSKFVQKYAALENEQTSSASSTLSWALNSATMVKLFGTQDLELRKFNKAVNLSKKY 247

Query: 371 GKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFG 430
             R  + ++   ++   L    F+    YGS L+ +  +    +      +    S++  
Sbjct: 248 FVRTLICSSINQAAMRFLSLMMFVQAFWYGSILIQRDEVETAAVITVFSASVLLSSSINA 307

Query: 431 LSNFYSELMKGAGAASRLFELTDHQPSIYATK-GVPYVPGK--------GEIKFENVSFS 481
           + +    L KG  A  ++ E  + +P     +   PY  G          EI F+ VSF+
Sbjct: 308 MLSKVVLLQKGKVACRQIAEAVNVEPEGRPNQYAFPYEVGHIIALEDQPSEIVFDQVSFN 367

Query: 482 YPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISK 541
           YP R   +  + ++ T        +VG SG GKST+ +LLLK+Y+   G IT++  ++  
Sbjct: 368 YPARPDTKALDGVSLTFRPNQITFIVGKSGSGKSTLGNLLLKFYSDYEGIITVNSTNLRG 427

Query: 542 ISAKSLRRHLGVVQQEPILMSGSIRDNITYGV-PYTPTIDEIRSVSKKCFCHNFITKFSD 600
           I    L +++ +V+Q   L +G++ +NIT    P   T   ++   +       +    +
Sbjct: 428 IDRSWLLQNITLVEQSCTLFNGTLFENITLSAKPVNKTAGAVKRACQMALLEKLVFDLPE 487

Query: 601 GYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMK 660
           G  T +G  G  +SGGQ+QR+A+ARA+++   +LILDEA SALD+         L ++++
Sbjct: 488 GLHTKVGSGGISMSGGQQQRVALARAILRDAPVLILDEAISALDIIHRD----LLMEVIR 543

Query: 661 SR--DITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLN 713
           S   D T I + H LS +   ++ + + + G V+E G   EL ++  S+ ++ LN
Sbjct: 544 SWRADKTTIILTHELSHV-LDDDYLYMMEHGQVIEQGYKSELLSNPNSR-FRALN 596

>Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON}
           YKL209C (REAL)
          Length = 1295

 Score =  171 bits (433), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 168/625 (26%), Positives = 270/625 (43%), Gaps = 54/625 (8%)

Query: 137 DWKLLLVAISLLTISCSIGMAVPKVI-GMVLDVAKNAITSDEKPKDLRDL---PPVVWGL 192
           D+KLLL+ + + T++  +  AV  ++ G V D+    + S       R L      V  L
Sbjct: 24  DYKLLLMML-ISTVATGLVPAVTSILTGRVFDLLSVFVLSGSHHDLYRQLLQRSMAVMAL 82

Query: 193 GLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKVG 252
           G+     ++   L L+++ + G     RI    L A L+   I+     +    D  ++ 
Sbjct: 83  GVASAPVMW---LSLTSWMHIGERQGFRIRSMLLEAYLKKKPIEWYDANETLLGDFTQIN 139

Query: 253 DLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGA 312
             +  L S +   S    QN+       IC  +G    F  S               + A
Sbjct: 140 RCVEELRSSSAEASAITFQNL-----VAICALIGTS--FFYSWSLTLIILCSSPIIALFA 192

Query: 313 TIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGK 372
             + R I   ++     TG   ++    ++  + V+ +  +  E K++   +        
Sbjct: 193 VAFCRMIHIYTKKENTETGKAAQLLTWSMNAAQLVRLYCTQPLERKKFEEIVSNC----- 247

Query: 373 REALTNATFFSSTSVL----GDFSFLIV------LAYGSHLVLQGSLSIGDLTAFMLYTE 422
                N  F  S   L    G   FL +        +GS ++ +G L+I D+        
Sbjct: 248 -----NTFFIKSCFYLAANAGVLRFLTLTMFVQGFWFGSTMIRKGRLNINDVITCFHSCI 302

Query: 423 YSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVP-YVP----GKGEIKFEN 477
             G+ +    +    L KG  A  ++  L ++ P    +  +  Y P      G++ FEN
Sbjct: 303 MLGTTLNNTLHQIVVLQKGEVALEKIMTLLENGPKRNTSNTIELYQPLIDYATGDLVFEN 362

Query: 478 VSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQ 537
           VSF+YP+R    I  N       G    +VG SG GKSTI++LLLK+Y+   G I+I+G+
Sbjct: 363 VSFAYPSRPTETILQNAGIKFPGGQFTFIVGKSGSGKSTISNLLLKFYDGYDGSISINGR 422

Query: 538 DISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGV------PYTPTIDE---IRSVSKK 588
           +I  I  KSL  ++ VV+Q   L + ++++NI  G         + TID    I+   + 
Sbjct: 423 NIQTIPQKSLIENITVVEQRCTLFNNTLKNNILLGSTGSIRNADSNTIDNNNLIKEACRM 482

Query: 589 CFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESE 648
                 I    DG ET+IG  G  LSGGQ+QR+AIARA I+   IL LDEA SALD+   
Sbjct: 483 ALLDRLILDLPDGLETIIGSGGITLSGGQQQRVAIARAFIRDTPILFLDEAISALDIVHR 542

Query: 649 GAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKL 708
             +   +    K +  T I + H+LS I  +++ + L  DG V+E G   EL     +  
Sbjct: 543 NLLMKAIRHWRKGK--TTIILTHQLSQI-EADDYLYLMQDGKVIESGIQSELLVDSTTTF 599

Query: 709 YKL--LNEKAKDTTSKMNAETVEKN 731
            K   L E   D  + +N +T EK+
Sbjct: 600 SKWYHLQEDYFDAKTVVNTKTEEKS 624

 Score =  167 bits (423), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 139/521 (26%), Positives = 240/521 (46%), Gaps = 30/521 (5%)

Query: 212  NFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFF--DRNKVGDLISRLSSDAYVVSRSM 269
            NF +  LL    E  +  LR+ +++K   ++  +F  + NK  ++ + + +D   +   +
Sbjct: 778  NFAKGFLLGYCSEYWIMDLRNEIMEKVTRKNINWFSGENNKAAEISALVMNDLRDLRSLV 837

Query: 270  TQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQS 329
            ++ +S     I    +G+                      + + IYG  +++   D + S
Sbjct: 838  SEFLSAMTSFITVSTIGLVWALISGWKLSLVCISMFPLIIIFSVIYGSSLQTYETDYKSS 897

Query: 330  TGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLG 389
               L     + ++ +KT++   AE      Y+    K+  +  + A+      S T+++ 
Sbjct: 898  VAQLENCLYQIVTSIKTIKCLQAEFHFQLTYHDMKTKMEGIASKRAIATGFGVSMTNMIA 957

Query: 390  DFSFLIVLAYGSHLVLQGSLSIGDLTA---FMLYTEYSGSAVFGLSNFYSELMKGAGAAS 446
                 I+  YG  LV+    +   + A    +L+T  S + + G      ++ +G  AAS
Sbjct: 958  MCIQAILYYYGLKLVMVHEYTSKKMFATFTLLLFTIMSCTTLVGQ---IPDISRGQRAAS 1014

Query: 447  RLF----------ELTDHQPSIYATKGVPYV--PGKGEIKFENVSFSYPTRSANQIFNNL 494
             ++          E+ D+   +    G  Y     K  +  +N++F+YP+     I+  +
Sbjct: 1015 WIYRILDEAECTLEIEDNNGRVLGISGGTYYGNSNKPIVSIQNLTFAYPSAPNISIYKRM 1074

Query: 495  NFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVV 554
            +  +  G  V +VG SG GKST+  LL   Y    G I IDG D++  +  SLRR + VV
Sbjct: 1075 DLNMFCGQTVGIVGESGSGKSTLVLLLTGLYACKVGCIEIDGTDVNDWNLTSLRREISVV 1134

Query: 555  QQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLS 614
            +Q+P L  GSIRDN+TYG        E+    K    ++F+       +T I     LLS
Sbjct: 1135 EQKPSLFDGSIRDNLTYGCLGQMPDFELYDALKYVGIYDFVASLPQSLDTRIDTN--LLS 1192

Query: 615  GGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIIS--IAHR 672
            GGQ QR+ IARAL++K  ILILDE TSALD  S   IN     ++K     +++  I H 
Sbjct: 1193 GGQAQRLCIARALLRKSKILILDECTSALDSVSSRIIN----DIVKKGPPALLTMVITHN 1248

Query: 673  LSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLN 713
               +R   +V+V   DG +VE G F  LY +   +L+++++
Sbjct: 1249 EEMMRCCSSVVVF-KDGKIVEEGSFDTLY-NDHKELFRIIS 1287

>NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1.527
          Length = 1288

 Score =  167 bits (424), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 146/524 (27%), Positives = 250/524 (47%), Gaps = 37/524 (7%)

Query: 200  VFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFF--DRNKVGDLISR 257
            +  G  V    +NF +  +L    E  +  LR+  ++  +++D  +F  D NK     S 
Sbjct: 763  IVLGVAVADGVSNFLKAYILGYCSENWIMDLRNEAMESILNKDLFWFSKDTNKS----SE 818

Query: 258  LSSDAYVVSRSMTQNISDGFKAIICGGVG--IGMMFHISSXXXXXXXXXXXXXXVGA--T 313
            LS+      R +   +S+   A+    V   IG+++ + S              + A   
Sbjct: 819  LSALLLNDLRDLRSLVSEFLSAMTTFMVVSLIGLIWALVSGWKLSLVCLSMFPLIIAFSA 878

Query: 314  IYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKR 373
            +YG  ++      + S   L     E ++G+KT++S  AE   IK Y+     +  +  +
Sbjct: 879  VYGTMLQKYETTYKTSVAALENQEYEIMTGIKTIRSLQAESHFIKNYSGLEHNMRAIAHK 938

Query: 374  EALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLS---IGDLTAFMLYTEYSGSAVFG 430
             ++      S T+++      I+  YG  LV +G  S   + +    +L+T  + ++   
Sbjct: 939  RSIATGFGISVTNMITICIQSILYYYGIKLVFEGEYSSKKMFETFTLLLFTIMTCTS--- 995

Query: 431  LSNFYSELMKGAGAASRLFELTDH-----QPSIYATKGVPYVPGKGE------IKFENVS 479
            L N   ++ +G  +A+ L+ + D      +      +    V  K E      IK +N++
Sbjct: 996  LVNQIPDISRGQRSATFLYRILDEGLASDESEFETHRKAEIVAPKQESKSNPLIKIQNLT 1055

Query: 480  FSYPTRSANQIFNNLNFTID-SGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQD 538
            F+YP+ +   ++ +LN  +  S   + +VG SG GKST+  LL K Y      I +DG D
Sbjct: 1056 FAYPSETNVNVYEDLNLEMHASEKTIGLVGESGSGKSTLMYLLTKLYQVAPHSIYLDGTD 1115

Query: 539  ISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTID-EIRSVSKKCFCHNFITK 597
            ++     +LR  + VV+Q+P L  G++R+N++YG+  T  +D E+  + K    + F+  
Sbjct: 1116 VNDWGLMNLRTQISVVEQKPTLFDGTVRENLSYGIS-TDILDMELFDMLKYVGIYEFVES 1174

Query: 598  FSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQ 657
               G +T I  K  LLSGGQ QRI IARAL++KP ILILDE TSALD  S   I      
Sbjct: 1175 LPFGLDTRIDTK--LLSGGQAQRICIARALLRKPKILILDECTSALDALSANII----ID 1228

Query: 658  LMKSRDITIISIAHRLST-IRRSENVIVLGDDGSVVEMGKFKEL 700
            ++K+    +++I    S  + R+ N I +  +G ++E G FKEL
Sbjct: 1229 IVKNGPPALLTIVITHSEKMMRACNTIAVLKNGKIIEKGGFKEL 1272

 Score =  134 bits (337), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 153/625 (24%), Positives = 271/625 (43%), Gaps = 60/625 (9%)

Query: 125 KEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVI-GMVLDVAKNA--ITSDEKPKD 181
           + I+    + R  W L+LV I+  T S  +  A+  ++ G V D+  N    +      +
Sbjct: 16  QHIYMHVDVKRDKWILMLVLIT--TTSNGLVPAITSILTGRVFDLLSNISNFSMHTILSE 73

Query: 182 LRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQ 241
           LR     +  LG      ++   + LS++ +         LGE+    +R  ++++ + +
Sbjct: 74  LRTRAFAIMALGAASLPLMW---ISLSSWMS---------LGERQGFAVREKILQEYLTK 121

Query: 242 DAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDG-------FKAIICGGVGIGMMFHIS 294
              ++D N        LS D   ++R + +  S         F+ ++     IG  F+ S
Sbjct: 122 PITWYDSN------DNLSGDFTQINRCVEELRSSSAEASAIIFQNLVSILALIGTSFYYS 175

Query: 295 SXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQ 354
                            A  +   I   +      TG   ++A   +  ++ V+ +  + 
Sbjct: 176 WSLTLIILCTAPIIIAFAVFFSHMIHKYTELENTETGKAAQLANWAMDSIQLVKLYCTQF 235

Query: 355 KEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDF----SFLIVLAYGSHLVLQGSLS 410
           +E++ +        D+  +  L    + S+ + L  F     F+    +G+ +V +G L 
Sbjct: 236 REVRNFRELTSNCNDLFIKCCL----YVSANTALLRFLSLSMFIQGFWFGATMVRKGKLQ 291

Query: 411 IGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFEL----TDH--QPSIYATKGV 464
           I ++          GS +         L KG  A  ++        DH     IY     
Sbjct: 292 ISNVVTCFQSCLMLGSTLSNTLQVIVILQKGDVALKKILGFLSTSVDHGADEPIYE---- 347

Query: 465 PYVPGK-GEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLK 523
           P  P +   I F N++FSYP+R ++ +  N++   +      ++G SG GKST+++LLLK
Sbjct: 348 PETPAELCTIAFNNITFSYPSRPSHPVLKNVSLCFEPTKFTFIIGKSGSGKSTLSNLLLK 407

Query: 524 YYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIR 583
           +Y+  +G IT+ G D+ +I+   L  ++ VV+Q   L + ++R+NI  GV     +++  
Sbjct: 408 FYDDYNGTITVKGNDVKEINRNWLLNNVTVVEQRCTLFNDTLRNNILLGVS-KDQLEDHE 466

Query: 584 SVSKK----C---FCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILIL 636
           S+ +K    C        +     G  T+IG  G  LSGGQ+QR+AIARA ++   ILIL
Sbjct: 467 SIEQKLKDACSISMLDRLVCDLPHGLNTIIGSGGISLSGGQQQRVAIARAFMRNKPILIL 526

Query: 637 DEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGK 696
           DEA SALD+     +   + Q    +  T I + H LS I   +   V+  +G V E G 
Sbjct: 527 DEAVSALDIIHRELLMKNIRQWRSGK--TTILLTHELSQIEPDDYTYVI-QEGEVKENGY 583

Query: 697 FKELYASKESKLYKLLNEKAKDTTS 721
            K+L   K S    +LN +  +  S
Sbjct: 584 QKDLKQKKTSVFNHMLNLQTNNRDS 608

>KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON} similar
            to uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1271

 Score =  164 bits (416), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 123/408 (30%), Positives = 209/408 (51%), Gaps = 14/408 (3%)

Query: 314  IYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKR 373
            IYG  ++      +     L     E +  +KT++    +Q     +   + KV  V K+
Sbjct: 866  IYGSLLQVYETAYKTEIAELETRVHELVISMKTIKLLQLQQHFEGSFKTQLAKVRIVCKK 925

Query: 374  EALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSN 433
             ++      + T+ L      I+  +G  LV+QG  S+  +        +S      L N
Sbjct: 926  RSVAVGFGIAVTNALAMVVQAILFFFGIKLVIQGEYSVAQMFETFTLLLFSIMTCVSLIN 985

Query: 434  FYSELMKGAGAASRLFELTDHQPSIYATKGVPY-------VPGKGE-IKFENVSFSYPTR 485
               E+ +G  AA+ +F++ +   S+  +K  P          G  E IK  N+SF++ + 
Sbjct: 986  QVPEISRGQRAATYIFKVLEDSGSVDTSKPDPSQNQSFFSTAGNRETIKISNLSFAFSSA 1045

Query: 486  SANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAK 545
              N+IFN+L+  I     V +VG SG GKST++ LL + Y   SG++ I G DI+K    
Sbjct: 1046 PMNKIFNSLSCEICLNETVGIVGESGSGKSTLSLLLTRLYPVPSGKVYIGGIDINKWDEY 1105

Query: 546  SLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETV 605
            +LRR + +V+Q+P    G++R+N+ YG+    +  E+RSV K     +F+    +   T 
Sbjct: 1106 ALRRTISIVEQKPKFFDGTVRENLVYGLKRNVSNSELRSVLKSVDLLSFVQTLPNDLNTR 1165

Query: 606  IGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDIT 665
            +     L+SGGQ QR++IAR L+++P I+ILDE TSALD  +  AI   +  ++K  ++T
Sbjct: 1166 V--HDGLMSGGQAQRLSIARTLLRQPKIIILDECTSALDAANSFAIAELIRTVLK--NVT 1221

Query: 666  IISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLN 713
            +I I H    ++  + V+VL   G V E G + EL+ S+  +LY++++
Sbjct: 1222 VIVITHSEQLMQICDRVLVL-KKGKVKEEGSYAELFESR-GELYRIVS 1267

 Score =  148 bits (373), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 128/506 (25%), Positives = 232/506 (45%), Gaps = 21/506 (4%)

Query: 222 LGEKLVARLRSNVIKKTIHQDAEFFDRNK--VGDLISRLSSDAYVVSRSMTQNISDGFKA 279
           LGE+   R+R+++I     +D +++D N+   GD I +++     V  S  +  +  F+ 
Sbjct: 91  LGERQGFRIRNSLIMFYFEKDLKWYDSNENLEGDFI-QINRCIEEVRASSAEASAIFFQN 149

Query: 280 IICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEE 339
           +I     I    + S                 A     K+   S+     +   + V   
Sbjct: 150 VISIIALIATSMYYSWSLTLIILCSLPLLATLAVFLSMKVEKFSKLENLESSKASSVLAW 209

Query: 340 QLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAY 399
            L   + ++ F     E K++   + K      +  L +A   SS   L    F+    +
Sbjct: 210 SLDAFQMIRLFNTSYWEQKKFETLVSKCNKHFVKSCLYSALNASSLRFLTLCMFVQGFWF 269

Query: 400 GSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRL--FELTDHQPS 457
           G+  + +G +  GD+          GS++         + KG  A  R+  F + + + +
Sbjct: 270 GNTQIKRGKMKAGDVITCFSSCLLLGSSLSSTLQQIVTIQKGKAAIQRINQFLVPNSKSA 329

Query: 458 I------------YATKGVPYVPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVC 505
           +             ++ G+  +   G+I+F +VSF+YPTR  + +  N++  I SG+   
Sbjct: 330 VGEWEKRSSLISTSSSIGLAPIFCDGDIEFRDVSFAYPTRPDDYVLKNVSIKIKSGATCF 389

Query: 506 VVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSI 565
           +VG SG GKST+ASLLLK Y   +G I     +I  +    L  ++ +V+Q   L +G++
Sbjct: 390 IVGKSGSGKSTLASLLLKMYGEYTGEIKFGEYEIDSLDDSWLVENITLVEQRCTLFNGTL 449

Query: 566 RDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIAR 625
           +DN+T    Y  +  E++   +    +  +    +G +T++G  G  LSGGQ+QR+A+AR
Sbjct: 450 KDNLTIVNKYA-SCTEVKQACQFALLNTVLLNLPNGIDTLLGRHGVTLSGGQQQRVALAR 508

Query: 626 ALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVL 685
           A ++   +LILDE+ SALD+ S   I   +    K +  T I + H  + I+  E V ++
Sbjct: 509 AYLRNTPVLILDESLSALDIMSRELIVEAIRHWRKGK--TTIILTHEYTQIKDDEYVYLM 566

Query: 686 GDDGSVVEMGKFKELYASKESKLYKL 711
             +G+VVE G   +L  + +S   +L
Sbjct: 567 S-EGTVVESGFKYDLLENPDSYFAQL 591

>Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON}
           YKL209C (STE6) - ABC transporter, glycoprotein,
           component of a-factor secretory pathway [contig 290]
           FULL
          Length = 1297

 Score =  162 bits (409), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 167/675 (24%), Positives = 290/675 (42%), Gaps = 100/675 (14%)

Query: 123 GYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVI-GMVLDVAKNAITS--DEKP 179
           G   I+    L+R DW LL++ IS+ +++  I  AV  ++ G V ++ +  +    D   
Sbjct: 12  GEAHIYMHVDLSR-DWWLLMI-ISICSVAYGIVPAVTSILMGAVFNLLQKPVIQQFDSVN 69

Query: 180 KDLRDLP--------------PVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEK 225
             +RDL               P  W L +Y +++                      LGE+
Sbjct: 70  TLMRDLTIRTMAILITGIASIPFCW-LSIYAWMS----------------------LGER 106

Query: 226 LVARLRSNVIKKTIHQDAEFFDRN--------KVGDLISRLSSDAYVVSRSMTQNISDGF 277
              RLR  +++    +   ++D N        ++   +  L S +   S  + QN+    
Sbjct: 107 QGFRLRRKLLRSYFEKSMAWYDINEQISGEYTQLNRCVEELRSSSAEASAIIFQNL---- 162

Query: 278 KAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIY-GRKIRSISRDLQQSTGNLTKV 336
              +   +G  + +   S              +G  IY  R +    +     T     +
Sbjct: 163 -VTVIALLGTALYY---SWSLTLVIMANSPLVIGFAIYCSRNVEKYGKIENSETSVAADI 218

Query: 337 AEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIV 396
               L+  K V+    +  EI ++  ++ K      + +L ++  +S    L    F+  
Sbjct: 219 MAWSLNAAKMVRLLGTQDYEIAKFRASVLKCRMNFNKMSLFSSLNYSILRFLTLCMFVQG 278

Query: 397 LAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFE-----L 451
             YG+  +  G+L  GD+           S +    +    L KGA    ++ E     +
Sbjct: 279 FWYGNVRIKSGNLKPGDVMTCFSSCILLASTLNSTLHQVVTLQKGAVGLKKIQEFLTSDV 338

Query: 452 TDHQPSIYATKGVPYVPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSG 511
              +  +  +  +P +  + +I FENVSF+YP+RS + +  NLN  +  G    +VG SG
Sbjct: 339 VQGKECVVNSMHLPLLWEQAQISFENVSFAYPSRSKHPVIKNLNLKVPGGRFTFIVGKSG 398

Query: 512 RGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITY 571
            GKSTI++LLLK Y P SG I ++  DI +I+ + L R + +V+Q   L   SI++NI  
Sbjct: 399 SGKSTISNLLLKLYRPCSGLIKVNDVDIREINQQDLFRSITLVEQNSPLFEDSIKNNIQL 458

Query: 572 GVPYTPTIDEIRS---VSKKC---FCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIAR 625
                 T DE R    +S+ C        I   + G +T+IG  G  LSGG++QR+A+AR
Sbjct: 459 ------TSDEHRDDGRLSQACQAAMLEGVIRDLAKGLDTIIGSSGVDLSGGEQQRVALAR 512

Query: 626 ALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVL 685
           A ++   ILILDEA SA D   +  +   +    K R  T I + H L+ I   ++ ++L
Sbjct: 513 AFVRDSPILILDEALSAQDRMHKDLLMEAIRFWRKGR--TTIILTHELNDILE-DDFVLL 569

Query: 686 GDDGSVVEMGKFKELYASKESKL-----YKLLNEKAKDTTS----------------KMN 724
            +DG+V+E G+  +L +   SK      ++L +E   + ++                +++
Sbjct: 570 MEDGNVIERGQKSDLLSDSTSKFSLLHAFQLCDEIEDEASTITDSNRLSLGAKLEPIRVD 629

Query: 725 AETVEKNDPSPKTEK 739
            E +     SP TEK
Sbjct: 630 VEELYSEMGSPSTEK 644

 Score =  158 bits (400), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 140/556 (25%), Positives = 249/556 (44%), Gaps = 64/556 (11%)

Query: 187  PVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFF 246
            P  W L       V   A + S F  F +  +L   GE  +  LR N  +  + +D  +F
Sbjct: 771  PAKWSL------IVLLVAFLDSAF-TFLKCYILSRCGENWIKELRINAFRSVMEKDFTWF 823

Query: 247  D--------------------RNKVGDLISRLSSDAYVVSRSMTQNISDGFK-AIICGGV 285
                                 R    + ++ LS+ A V    +   +  G+K +++C  +
Sbjct: 824  QDSNNSTSNITSLILNDLRDLRALASEFLAALSTLAVVSLCGLLWALVAGWKLSLVC--I 881

Query: 286  GIGMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVK 345
             +  MF + S                  IYG  +++     +     L     + +  +K
Sbjct: 882  SLIPMFVLFSG-----------------IYGGLLQNYEARYKTCIAELENELYKAIRCMK 924

Query: 346  TVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVL 405
            T++    E K  + Y           ++ A+      +S++ L   +  I+L +G  LV+
Sbjct: 925  TIKCLQMENKVARSYEMLEVTSKGAARKRAMGTGFGVASSNALTFITQSILLYFGMKLVI 984

Query: 406  QGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFEL--TDHQ--PSIYAT 461
             G  + G +   +    ++      L +   E+ +G  AA+ LF+L   +H+   S+   
Sbjct: 985  TGEYTPGKMLETLTLLLFTIMTCMTLMSQVPEISRGQRAATYLFKLFGNEHEEGASVLKE 1044

Query: 462  KGVPYVPGKGE---IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIA 518
            +  P +    +   I  +++ FSY   +   ++ NL+  +D G  V ++G SG GKST+ 
Sbjct: 1045 RHAPIIKTCSKQTLISIKHLKFSYSNINNPMVYKNLSLKVDRGEIVGLIGTSGSGKSTLW 1104

Query: 519  SLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPT 578
            SLL + Y   +G I+IDG DI++   K+LR  + VV+Q+P+  SGSI +N+TYG+    +
Sbjct: 1105 SLLTRLYPVENGSISIDGTDINQWDRKALRSCIAVVEQKPLFFSGSIIENLTYGLMRKVS 1164

Query: 579  IDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDE 638
             +E+  +        F+        +VI  +  LLSGGQ QR+AI RAL++KP +L+LDE
Sbjct: 1165 DEEVNELLLTLGMLEFVNSTPKRLHSVIDTQ--LLSGGQVQRLAIVRALLRKPQLLVLDE 1222

Query: 639  ATSALDVESEGAINYTLGQLMKSR--DITIISIAHRLSTIRRSENVIVLGDDGSVVEMGK 696
             TSALD       ++ + + +K      T + + H    +R    ++   + G +VE G 
Sbjct: 1223 CTSALDARH----SFIMSEFVKHHLYHTTTLVVTHSEQMMRSCHRILTF-NKGEIVEEGS 1277

Query: 697  FKELYASKESKLYKLL 712
               L+  K  +LY++L
Sbjct: 1278 IDNLFNQK-GELYRIL 1292

>KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209C STE6 ATP-binding cassette (ABC) transporter
            required for the export of a-factor catalyzes ATP
            hydrolysis coupled to a-factor transport contains 12
            transmembrane domains and two ATP binding domains
            expressed only in MATa cells
          Length = 1298

 Score =  161 bits (407), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 111/379 (29%), Positives = 194/379 (51%), Gaps = 17/379 (4%)

Query: 344  VKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHL 403
            +KT++    E++ IK Y     K    G++ AL      + ++ L   +  I+L YG  L
Sbjct: 924  IKTIRCLQVEERVIKEYEVLEGKAKLAGRKRALGTGFGVALSNALTLITQSILLYYGMKL 983

Query: 404  VLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYAT-- 461
            V+ G  S   +   +    ++      L     E+ +G  AA+ LF + D +        
Sbjct: 984  VITGEYSSERMFQTLTLLLFTIMTCMSLIAQIPEISRGQRAATYLFRILDSETQFADANL 1043

Query: 462  KGVPYVPGKG-----EIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKST 516
            +G   +  +G      I  +++ FSY   +   ++  LN ++ +G  V +VG SG GKST
Sbjct: 1044 EGESALTSRGCSNEALIFIKDLRFSYSFLNNPMVYRGLNLSVKAGETVALVGLSGSGKST 1103

Query: 517  IASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYT 576
            +  L+ + Y   SG I  DG D+++    +LR+ + VV+Q P L  GSI DN+TYG+  +
Sbjct: 1104 LWHLITRLYRVPSGSIWFDGLDVNEWEEWALRKRIAVVEQRPSLFRGSIFDNLTYGLSTS 1163

Query: 577  PTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILIL 636
                EIR + +     +F+     G ++ I     +LSGGQ QR+AI RAL++KP +L+L
Sbjct: 1164 VDEREIRELLELVGMMDFVNSNPLGLQSFIDTD--VLSGGQLQRLAIVRALLRKPQLLVL 1221

Query: 637  DEATSALDVESEGAINYTLGQLMK--SRDITIISIAHRLSTIRRSENVIVLGDDGSVVEM 694
            DE TSALD +      + + + ++  S+  T + + H    +R    ++    +G+++E 
Sbjct: 1222 DECTSALDAQH----GFIMSEFVRQGSQSTTTLVLTHSEQMMRACNRILTFA-NGNIIED 1276

Query: 695  GKFKELYASKESKLYKLLN 713
            G F+ LY S++ +L+K+L+
Sbjct: 1277 GSFERLY-SQKGELFKILS 1294

 Score =  155 bits (392), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 159/609 (26%), Positives = 270/609 (44%), Gaps = 50/609 (8%)

Query: 135 RHDWKLLLVAISLLTISCSIGMA-VPKVIGMVLDVAKNAITSDEKPKDLRDLPPVVWGLG 193
           + DW LL+V    +T+ CS+    VP V  ++     N +   ++P   R+   V     
Sbjct: 19  KQDWSLLVV----ITV-CSVAYGLVPAVTSILTGTVFNLL---QQPAA-REFGSVN---A 66

Query: 194 LYDFLAVFAGALVLSTFANFGRVVL----LRILGEKLVARLRSNVIKKTIHQDAEFFDRN 249
           L   LA+ + A++ +  A+     L       LGE+   RLR  +++  + +   ++D N
Sbjct: 67  LMHELALRSMAILATGIASIPLCWLSVSAWMSLGERQAFRLRRKMLQSYLDKSMAWYDAN 126

Query: 250 K--VGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXX 307
           +   GD  ++L+     +  S  ++ +  F+ ++     +G   + S             
Sbjct: 127 EQISGDF-TQLNRCVEELRSSSAESSAIVFQNVVTVAALLGSALYYSWSLTLIIMANSPL 185

Query: 308 XXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKV 367
               A  + RK+   ++     T +        L   K V+    + +E+ R+   ++K 
Sbjct: 186 VIGFAVFFSRKVEKYAKRENSETSSAADAMAWSLDAAKMVRLLGTQDRELARFEACVQKC 245

Query: 368 FDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDL-TAFMLYTEYSGS 426
                + +L ++  +S    L    F+    YG+  +  G L  GD+ T F        S
Sbjct: 246 RQHFNKMSLFSSLNYSVLRFLTLCMFVQGFWYGNSRINIGKLKPGDVVTCF-------SS 298

Query: 427 AVFGLSNFYSEL------MKGAGAASRLFELTDHQPSIYATKG--------VPYVPGKGE 472
            V   S   S L       KGA    ++    + + +  + K         +P    +  
Sbjct: 299 CVLLASTLNSTLHQIIILQKGAVGLQKIMAFVNSRDASESQKNKVEISFRRLPLCWERAS 358

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           I F+NV F+YPTR  + +   ++    SG    V+G SG GKSTI +LLL +Y   SG I
Sbjct: 359 ITFQNVHFAYPTRPDDFVLKGVSLDFPSGETTFVIGKSGSGKSTIGNLLLGFYGIGSGTI 418

Query: 533 TIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIR--SVSKKCF 590
            ++GQD+ +I+   L R++ +V+Q   L + ++ +N+T G       DEIR     +   
Sbjct: 419 NVNGQDVKEINQSELARNIMLVEQTTSLFTETLANNVTIGEAGVDD-DEIRLKQACQMAM 477

Query: 591 CHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGA 650
             N I   + G ET IG  G  LSGG++QR+A+ARA  +   ILILDEA SA D   +  
Sbjct: 478 LGNIIRDLAKGLETTIGCSGLDLSGGEQQRVALARAYFRNAPILILDEALSAQDRIHKSL 537

Query: 651 INYTLGQLMKSR-DITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLY 709
           +   +  + K R D T I + H LS I  ++ V V+  DG + E G    L ++ +S+  
Sbjct: 538 L---MEAIRKWRADKTTIILTHELSDILDTDYVYVM-SDGQIREHGYKSGLLSNPKSEFS 593

Query: 710 KLLNEKAKD 718
            L   +A D
Sbjct: 594 NLHRFQACD 602

>Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} similar to
            Ashbya gossypii AFR432W
          Length = 1315

 Score =  160 bits (404), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 139/523 (26%), Positives = 243/523 (46%), Gaps = 39/523 (7%)

Query: 212  NFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFF--DRNKVGDLISRLSSDAYVVSRSM 269
             F +  +L +  E  +  LR   + +  +QD  +F  D NK  ++ + + +D   +   +
Sbjct: 807  TFLKKFILSVCSELWIMSLRIKAMDRISNQDVHWFSLDINKPSEISALILNDLRDLRYLV 866

Query: 270  TQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGAT-IYGRKIRSISRDLQQ 328
            +  +S     I    +G+   F +S               +G T IYG  ++    D + 
Sbjct: 867  SGFLSAVTTLIFVSAIGLAWAF-VSGWKLSLVCISTIPLFIGVTGIYGGVLQKYETDYKT 925

Query: 329  STGNLTKVAEEQLSGVKTVQSFVAEQKEIKRY--------NHAIRKVFDVGKREALTNAT 380
            +   L     E + G+KTV+    E     +Y        + + R+    G   AL+NA 
Sbjct: 926  AVAELENNMFEFVKGIKTVRCLQLESHFSNKYTMLEEGMKHQSRRRAVVTGFGVALSNAL 985

Query: 381  FFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLT---AFMLYTEYSGSAVFGLSNFYSE 437
                 ++L          YG  LV+ G  +  +L      +++T  + SA+      +S 
Sbjct: 986  VIGVQAIL--------YYYGIKLVVDGEYTPDNLLQTFTLLVFTIMTCSALMYEVPSFS- 1036

Query: 438  LMKGAGAASRLFELTDHQPSI------YATKGVPYVPGKGE-IKFENVSFSYPTRSANQI 490
              +G  AA+ +F + + +         + T+ +         I+ ++++F+YP+    ++
Sbjct: 1037 --RGRRAATYVFRILNTRSDFLSIDDDFRTEPIEKPSHMNPLIRIQDLTFAYPSALDVEV 1094

Query: 491  FNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRH 550
            +  L+ TI+ G N+ +VG SG GKST+  +L   Y      + ID  DI K +  SLR+H
Sbjct: 1095 YKKLSLTINFGENLAIVGESGSGKSTMGLILCGLYPVNGNTVFIDDTDICKWNLSSLRKH 1154

Query: 551  LGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKG 610
            + +V+Q+     GSIRDN+ YG+    T  +I  V       +F+ +   G  T I    
Sbjct: 1155 ISMVEQKAKFFDGSIRDNLIYGLDRIVTDSQIFEVLSLVGIADFVKELPQGLNTRIDTN- 1213

Query: 611  ALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIA 670
             L+SGGQ QRI+I RAL+++P +LILDE TS+LD ++  AI   +G  +    IT I I 
Sbjct: 1214 -LISGGQAQRISIGRALLRQPKLLILDECTSSLDAKNAQAIASLVGSSLYG--ITTIVIT 1270

Query: 671  HRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLN 713
            H  + + +S N I+   +G + E G F+EL  S+    Y+++ 
Sbjct: 1271 HN-TQMMKSCNRILFFKNGRISEEGTFQELSDSRRD-FYRMIT 1311

 Score =  118 bits (296), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 113/437 (25%), Positives = 198/437 (45%), Gaps = 58/437 (13%)

Query: 312 ATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKV---- 367
           A I+ + +   +      T +   +    +   + ++ F  EQ E+++++ +++K     
Sbjct: 193 AIIFSKLVEKYTELENTETSHAASILTWSMEAPQLIRLFGTEQVELQKFSISVKKCSKFF 252

Query: 368 FDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSA 427
            ++ K  A   A+    + ++    F+    +G+ ++ +G L+ G +      T +S   
Sbjct: 253 INLSKYAAANQASLRGLSLIM----FVQGFWFGNTMIKRGKLNSGQVI-----TCFSACI 303

Query: 428 VFG--LSNFYSELM---KGAGAASRLFELTDHQ---------------PSIYATKGV-PY 466
           + G  L+N    ++   KG  A  ++  + + +               PS  +   V P 
Sbjct: 304 LLGTTLNNTLQHIVIMQKGKVALQKILSMVESESDALRGRRGETFEIFPSPISGMFVSPV 363

Query: 467 VPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYN 526
            P   +I FENVSFSYP+R      +N++ T        +VG SG GKST+++LLLK Y+
Sbjct: 364 FPK--QITFENVSFSYPSRPNEYALDNVSLTFYPEKITFIVGKSGSGKSTLSNLLLKLYS 421

Query: 527 PTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVS 586
              G I +   DI       L  ++ +V+Q   L +    D++   +  T   D     S
Sbjct: 422 DYEGTIKVGTLDIRATKDSWLLENITLVEQSCTLFN----DSLLNNLLLTAKDDNKNEAS 477

Query: 587 KKCFCH-----NFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATS 641
            K  C        +    DG  TVIG  G  LSGGQ+QR+A+ARA+++   +LILDE+ S
Sbjct: 478 IKRACQMALLEKLLFDLPDGLSTVIGSNGISLSGGQQQRVALARAILRDTPVLILDESIS 537

Query: 642 ALDVESEGAI-----NYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGK 696
           ALD+     +     N+  G+       T I + H LS I   ++ + L +DG V E G 
Sbjct: 538 ALDIIHRDLLMEVIRNWRAGK-------TTIILTHELSHI-LDDDYLYLMEDGKVGEHGY 589

Query: 697 FKELYASKESKLYKLLN 713
            ++L +    +  +L N
Sbjct: 590 KRDLLSYTSGRFTELHN 606

>NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1.527
           YKL209C
          Length = 1293

 Score =  159 bits (403), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 137/542 (25%), Positives = 245/542 (45%), Gaps = 36/542 (6%)

Query: 222 LGEKLVARLRSNVIKKTIHQDAEFFDRNK--VGDLISRLSSDAYVVSRSMTQNISDGFKA 279
           LGE+    +R  ++ + + +  E++D +   +GD  ++++     +  S  +  +  F+ 
Sbjct: 100 LGERQGFAIRKRLLNEYLVKPMEWYDCHDKLLGDF-TQVNRCVEELRSSSAEASAITFQN 158

Query: 280 IICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEE 339
            +     IG  F+ S               + A ++   I   +      TG   ++   
Sbjct: 159 FVAMLALIGTSFYYSWSLTLIILCSAPLIILFAILFSHMIHKYTELENSETGKAAQLLNW 218

Query: 340 QLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSS--TSVLGDFS---FL 394
            ++  + V+ +  +  EI  +   + +  D+        + F+ S  TS+L   S   F+
Sbjct: 219 SMNSAQLVKLYCTQAYEIHSFKELVGQCNDL-----FIKSCFYVSANTSILRFLSLSMFV 273

Query: 395 IVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFEL--- 451
               +G+ +V +G LSI D+          GS +         L KG  A  ++ +    
Sbjct: 274 QGFWFGAIMVKKGKLSIKDVITCFHSCLMLGSTLNNTLQQIVVLQKGDVALKKILDFISF 333

Query: 452 TDHQPSIYATKGVPYVPG----KGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVV 507
           +   PS+      PY P      GEI F+N+SF+YPTR    +  +++ T   G +  ++
Sbjct: 334 SQRSPSLEP----PYEPSVPISNGEISFQNISFAYPTRPHQTVLKDVSITFQPGRSTFII 389

Query: 508 GPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRD 567
           G SG GKST+A+LLLK+YN   G I I   ++ KI+   L  ++ VV+Q   L + ++R+
Sbjct: 390 GKSGSGKSTLANLLLKFYNDYQGSIKIGNTNVKKINKNWLFENITVVEQRCTLFNDTLRN 449

Query: 568 NITYGVPYTPTIDE---------IRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQK 618
           N+  G+  +    E         ++   +       I +  DG +T+IG  G  LSGGQ+
Sbjct: 450 NLLLGISNSNQKVEQDDIEISQRLKDACRIAMLEELIRELPDGLDTIIGAGGVSLSGGQQ 509

Query: 619 QRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRR 678
           QR+AIARA IK  ++LILDEA SALD+     I   +      +  T I + H LS +  
Sbjct: 510 QRVAIARAYIKDSSVLILDEAVSALDIIHRELIMKAIKNWRSGK--TTIILTHDLSQLDY 567

Query: 679 SENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKDTTSKMNAETVEKNDPSPKTE 738
            + + V  +DG V E G  + L   +++   KL + + +   S   +E+     P  + +
Sbjct: 568 DDFLYVF-EDGEVKESGYQQALLQDEKTIFSKLYDIQMRKHMSYSPSESTIVETPGDEKK 626

Query: 739 KL 740
           + 
Sbjct: 627 RF 628

 Score =  157 bits (397), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 128/422 (30%), Positives = 204/422 (48%), Gaps = 37/422 (8%)

Query: 314  IYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKR 373
            IYG  ++      + +   L     E ++ +KT++   A +  IK Y      +  +  +
Sbjct: 886  IYGSTLQRYETMYKTAVAELENHEYEIMTKIKTIRYLQASKYFIKNYKVLENNLKKIAHK 945

Query: 374  EALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLS---IGDLTAFMLYTEYSGSAVFG 430
             ++      S T+ +      I+  YG  LV +G  S   + +    +L+T  S ++   
Sbjct: 946  RSIATGFGISITNTIAVCIQSILYYYGLRLVFKGEYSSKKMFETFTLLLFTIISCTS--- 1002

Query: 431  LSNFYSELMKGAGAASRLF----ELTDHQPSIYA------------TKGVPYVPGKGEIK 474
            L +   ++ +G  AAS L+    E  D++ S+ +            T  VP       I 
Sbjct: 1003 LVSQIPDISRGQRAASWLYRILDESDDNKESVDSGSRSADIIISGNTNSVPL------IS 1056

Query: 475  FENVSFSYPTRSANQIFNNLNFTIDSGS-NVCVVGPSGRGKSTIASLLLKYYNPTSGRIT 533
             +N+ FSYP+    +I+ N+   + S    + +VG SG GKST+  LL K Y   +  I 
Sbjct: 1057 IKNLRFSYPSAQTVEIYKNITLHVTSSQKTIGIVGESGSGKSTLMYLLTKLYKTPANSIY 1116

Query: 534  IDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHN 593
            IDG D+++     LR+ + VV+Q P L  G++RDN+ YG     +  EI  V K    + 
Sbjct: 1117 IDGTDVNEWDTLKLRKQISVVEQNPTLFEGTVRDNLVYGTLNDISEIEIYDVLKYLGIYE 1176

Query: 594  FITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINY 653
            FI     G ++ I  K  L+SGGQ QR+ IARAL++KP ILILDE TSALD  S   IN 
Sbjct: 1177 FIENLPMGLDSRIDTK--LVSGGQAQRLCIARALLRKPTILILDECTSALDAASAHLIN- 1233

Query: 654  TLGQLMKSRDITIISIAHRLS-TIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLL 712
                L+K+   T+++I    S  +  + N + +  DG + E G F EL     S+L +++
Sbjct: 1234 ---NLVKNGLPTVLTIVITHSKQMMEACNSLAVIKDGRLAEQGNFAEL-MKNNSELRRII 1289

Query: 713  NE 714
            NE
Sbjct: 1290 NE 1291

>ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1695

 Score =  157 bits (396), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 147/546 (26%), Positives = 246/546 (45%), Gaps = 47/546 (8%)

Query: 192  LGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKV 251
            L +Y FL  FA + VLS F    + +L  + G     ++ + +++K +H    FFD   +
Sbjct: 1146 LAIY-FLIGFAQS-VLSAF----KTILSFVAGLNASKKIFNLLLQKVLHAKLRFFDSTPI 1199

Query: 252  GDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVG 311
            G +++R S D   V + +T      F +++     + ++  I+                 
Sbjct: 1200 GRIMNRFSKDIEAVDQELTPFFEGAFYSLVTCLSTVVLITFITPQFLIVAVIVAVLYYFI 1259

Query: 312  ATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAI----RKV 367
               Y    R + R    S   + +   E L GV T+++F  E + I+   H I    R  
Sbjct: 1260 GYFYLAGSRELKRLDSISRSPIYQHFSETLVGVTTIRAFGDESRFIQENLHKIDENNRPF 1319

Query: 368  F--DVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSG 425
            F   V  R          S  V G   F  +L    H+     ++   LT  + +TE   
Sbjct: 1320 FYLWVANRWLAMRIDLIGSLVVFGAGVF--ILLNIDHI--DAGMAGISLTYAITFTE--- 1372

Query: 426  SAVFGLSNFYSELMKGAGAASRLFE--LTDHQPSIYATKGVPY-VPGKGEIKFENVSFSY 482
                 L   YS +     +  RL E  + + +P        P   P  G ++  +VS  Y
Sbjct: 1373 -GALWLVRLYSNVEMNMNSVERLKEYMVVEQEPYNQPIMTPPSDWPQHGRVEMSDVSLRY 1431

Query: 483  PTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKI 542
                  ++  N++FT++  S V VVG +G GKSTI + L ++ +P +G I ID  DIS I
Sbjct: 1432 AP-GLPRVIKNVSFTVEPKSKVGVVGRTGAGKSTIITALFRFLDPETGHIKIDNVDISLI 1490

Query: 543  SAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDE--------IRSVSKKCFCHNF 594
              + LRR + ++ Q+P L +G+I+ N+    PY    DE        +  VS++    + 
Sbjct: 1491 DLQMLRRSITIIPQDPTLFTGTIKSNLD---PYDEYSDEDIFAALKRVNLVSQEELDRSN 1547

Query: 595  ITKFSDGYETV---------IGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDV 645
            I   S G E V         I   G  LS GQ+Q + +AR+L++ P I++LDEAT+++D 
Sbjct: 1548 IDAASVGSENVNKFLDLNSEINEGGGNLSQGQRQLVCLARSLLRSPKIILLDEATASIDY 1607

Query: 646  ESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKE 705
            +S+  I  T+ +  +    TI++IAHRL ++   + ++V+ D G V E      L  +K 
Sbjct: 1608 QSDAKIQETIRKEFQGN--TILTIAHRLRSVIDYDKILVM-DQGEVKEYDHPYSLLLNKN 1664

Query: 706  SKLYKL 711
            S+ Y +
Sbjct: 1665 SQFYSM 1670

 Score =  111 bits (277), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 90/323 (27%), Positives = 149/323 (46%), Gaps = 22/323 (6%)

Query: 431  LSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKFENVSFSYPTRSANQI 490
            LS+  S +++   +  R+ E  + +P       +   PG  ++ FEN + S+ +   +  
Sbjct: 705  LSDMLSFVIQSKVSLDRIQEFLE-EPDTDKYNQLSVAPGGQKLGFENATISWDSEKQDFK 763

Query: 491  FNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITI---DGQDISKISAKSL 547
              NLN     G    V+GP+G GK++I   LL      +G I +   D + +  I A  +
Sbjct: 764  LRNLNIDFKVGKLNVVIGPTGSGKTSILMALLGEMKLLNGNIVVPSLDPRALLPIDADGM 823

Query: 548  RRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIG 607
               +    Q   L++ ++R+NI +  PY+        V + C         S G  T IG
Sbjct: 824  TNSIAYCSQAAWLLNDTVRNNILFNSPYSEA--RYNDVIEACGLKRDFEILSAGDMTEIG 881

Query: 608  PKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI--NYTLGQLMKSRDIT 665
             +G  LSGGQKQRI++AR+L      L+LD+  SA+D  +   I  N   G LM+ R  T
Sbjct: 882  ERGITLSGGQKQRISLARSLYSNSRHLLLDDCLSAVDSHTASWIYDNCITGPLMQGR--T 939

Query: 666  IISIAHRLSTIRRSENVIVLGDDGSVVE------------MGKFKELYASKESKLYKLLN 713
             I I+H ++   R+  ++VL ++G V E            +G+ + + +S  S+    +N
Sbjct: 940  CILISHNIALTLRNAELVVLLENGQVKEQGDPLTLLHKGHLGEDELVKSSIMSRNNSSVN 999

Query: 714  EKAKDTTSKMNAETVEKNDPSPK 736
             K K +TS  N     K    P+
Sbjct: 1000 VKTKSSTSVQNLAKTSKESTKPQ 1022

>TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_4.52
            YLL015W
          Length = 1535

 Score =  156 bits (395), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 156/584 (26%), Positives = 257/584 (44%), Gaps = 57/584 (9%)

Query: 161  VIGMVLDVAKN---AITSDEKPKDLRDLPPVVWG-LGLYDFLAVFAGALVLSTFANFGRV 216
            ++  V DV +N      S+E  +  R     VW  +G+Y  + VF+ A     F N   +
Sbjct: 964  ILSRVFDVVENFWLKYWSEENER--RGTNEDVWKFVGIYAAIGVFSAA-----FNNLRTI 1016

Query: 217  VLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDG 276
            VLL     +  A+L   + K  +     FF+   VG +I+R SSD   V  ++    +  
Sbjct: 1017 VLLLFCTIRGAAQLHDTMAKTVLRSPMSFFETTPVGRIINRFSSDVQAVDSTLQWVFAFF 1076

Query: 277  FKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKV 336
            F++I+   V + ++ +                      Y    R + R    ST  +  +
Sbjct: 1077 FRSILNYAVTVILISYNMPWFLIVNAVLLIIYIYYQAFYITLSRELKRLTSVSTSPIMSL 1136

Query: 337  AEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATF-FSSTS--------V 387
              E L G   + +F    K   R++       +    +   N +F F ST+         
Sbjct: 1137 FSETLGGHAVINAF----KHFDRFDF-----INFNNVQFNINCSFNFRSTNRWLSVRLQT 1187

Query: 388  LGDFSFLIVLAYG----SHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAG 443
            +G F   IVLA      S +  +  LS G +   M Y     S++  +     ++     
Sbjct: 1188 IGAF---IVLATALLALSTINSERRLSPGMVGLLMSYALQVTSSLMWIVRMSVQIETNIV 1244

Query: 444  AASRLFELTDHQPS----IYATKGVPYVPGKGEIKFENVSFSYPTRSANQIFNNLNFTID 499
            +  R++E  +  P     I + +     P +GEI F+N S  Y T+  +     +N +I 
Sbjct: 1245 SVERIYEYCNLTPEAPEVIESCRPKKTWPSEGEIIFKNYSTKYKTK-GDLALKGINLSIK 1303

Query: 500  SGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPI 559
                + VVG +G GKST++  L +    T G I IDG DISK+  K LR HLG++ Q+  
Sbjct: 1304 PQEKIGVVGRTGAGKSTLSLALFRLLEATEGTIEIDGLDISKMGLKDLRSHLGIIPQDAQ 1363

Query: 560  LMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKF--SDGYE----------TVIG 607
               G++R N+     Y+ T +   S+       + +  F   D  E            I 
Sbjct: 1364 AFEGTVRSNLDPFEQYS-TEELWASIELSHLKPHIVEMFRKEDNSELPASKEKMLDVKIS 1422

Query: 608  PKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITII 667
              G  LS GQ+Q + ++RAL+    +L+LDEAT+A+D+E++  I  T+   +K +  TI+
Sbjct: 1423 ENGGNLSVGQRQLLCLSRALLNTSKVLVLDEATAAVDMETDKIIQETIRSELKEK--TIL 1480

Query: 668  SIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKL 711
            +IAHR+ T+  S+ +IVL D G V E    + L ++K+S  Y L
Sbjct: 1481 TIAHRIDTVLDSDKIIVL-DAGQVKEFDTPENLLSNKQSIFYAL 1523

 Score =  107 bits (267), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 105/409 (25%), Positives = 192/409 (46%), Gaps = 44/409 (10%)

Query: 335 KVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKRE---ALTNATFFSSTSV--LG 389
           K   E L+ +K+++ +  E+  +KR +H +R   ++   +    ++N  +F+   V  + 
Sbjct: 464 KTTTEILNSMKSIKLYAWEEAMLKRLDH-VRNGLELENYKRIGVVSNLIYFAWNCVPLMV 522

Query: 390 DFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLF 449
             S   + ++ +   L   +    L+ F +  +    A++ L N  + +++   + +R+ 
Sbjct: 523 TCSTFAIFSFFNKTPLSPEVVFPSLSLFNILND----AIYSLPNTINSIIETKVSINRIK 578

Query: 450 EL------------TDHQPSIYATKGVPYVPGKGEIKFENVSFSYPTRSANQI------F 491
           E              D  PS   +  V  +      K   + FS  +   ++I       
Sbjct: 579 EFLLSEELDDSFIEIDKTPSDKVSPVVEIINATFLWKSPKILFSEGSDEESRIESSQVAL 638

Query: 492 NNLN-FTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRH 550
            N+N F    G   C+VG  G GKST+   +L       G++      +  +  K L R 
Sbjct: 639 ENINGFQAKKGELTCIVGRVGSGKSTMLRAIL-------GQLPCVNASVGGLEPKVLIRA 691

Query: 551 --LGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGP 608
             +    QEP +M+ SI+DNIT+G  Y  T     +  K C     +    +   T++G 
Sbjct: 692 STVAYCPQEPWIMNASIKDNITFGFRYDETY--YNATIKACQLLPDLDILPERDNTLVGE 749

Query: 609 KGALLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTLGQLMK-SRDITI 666
           KG  LSGGQK RI++ARA+  + ++ +LD+  SA+D E S+  +   L + M   R+ T+
Sbjct: 750 KGISLSGGQKARISLARAVYSRADLFLLDDILSAVDAEVSKNIVEMVLDKKMGLLRNKTV 809

Query: 667 ISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKE-SKLYKLLNE 714
           +   + +S + RS+ + +L + GS+VE G F E+ +S E SKL K+++E
Sbjct: 810 VLTTNAISVLNRSQKIYML-EGGSIVEEGSFTEVTSSPEPSKLKKMIDE 857

>KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4.6
            YHL035C
          Length = 1717

 Score =  156 bits (394), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 151/560 (26%), Positives = 251/560 (44%), Gaps = 70/560 (12%)

Query: 215  RVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNIS 274
            +  L  I G     ++ + ++ K IH    FFD   +G +++R S D   V + +T  ++
Sbjct: 1179 KTFLTYIFGINASRKIFAMLLNKVIHSKLRFFDTTPIGRIMNRFSKDIESVDQELTPYLT 1238

Query: 275  DGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLT 334
              F + +     I ++  I+               +    Y    R + R    +   + 
Sbjct: 1239 GAFYSFVECFSTIILISWITPQFFVVAILISIMYYLVGYFYMAGSRELKRLDSITKSPIY 1298

Query: 335  KVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFL 394
            +   E L GV T+++F  E + +K        +F + +     N  FF         SF 
Sbjct: 1299 QHFSETLVGVTTIRAFGDEMRFLKE------NLFKIDE----NNKPFFYLWVANRWLSFR 1348

Query: 395  IVLAYGSHLVL-QGSLSIGD------------LTAFMLYTEYSGSAVFGLSNFYSELMKG 441
            I +  GS +V   G   + D            LT  + +TE        L  FYSE+   
Sbjct: 1349 IDMI-GSFVVFGAGVFILADIKNIDSGMAGISLTYAISFTE----GALWLVRFYSEVEMN 1403

Query: 442  AGAASRLFELTDHQPSIYATKG-----VPYV-PGKGEIKFENVSFSYPTRSAN--QIFNN 493
              +  R+ E    +   Y  K       P V P +G+I+  ++S  Y   +AN  ++  N
Sbjct: 1404 MNSVERIKEYMSVEQEPYDIKDEIVRTPPTVWPDEGKIEVNDLSLRY---AANLPRVIKN 1460

Query: 494  LNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGV 553
            ++FT++  S V VVG +G GKSTI + L ++ +P SG I ID  DI+ I    LRR + +
Sbjct: 1461 VSFTVEPNSKVGVVGRTGAGKSTIITALFRFLDPESGYIKIDNMDITTIPLTRLRRAITI 1520

Query: 554  VQQEPILMSGSIRDNITYGVPYTPTID--------------------EIRSVSKKCFCH- 592
            + Q+P L +G+++ N+    PY    D                    E  +VS +   H 
Sbjct: 1521 IPQDPTLFAGTLKFNLD---PYDEYNDKDIFAALTRVNLVSGEELNGETTAVSDQGSMHS 1577

Query: 593  NFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAIN 652
            N   +F D     I   G  LS GQ+Q I +AR+L++ P IL+LDEAT+++D ES+  + 
Sbjct: 1578 NNENRFLD-LSNEITEGGGNLSQGQRQLICLARSLLRNPKILLLDEATASIDYESDARLQ 1636

Query: 653  YTL-GQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKL 711
             T+ G+   S   TI++IAHRL ++   + ++V+ D G V+E      L  ++ S+ YK+
Sbjct: 1637 ATIRGEFGNS---TILTIAHRLRSVIDYDKILVM-DAGEVIEYDHPYSLLLNRNSEFYKM 1692

Query: 712  LNEKAK-DTTSKMNAETVEK 730
                 + DT ++M  E   K
Sbjct: 1693 CESSGELDTLTEMAKEAFVK 1712

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 71/231 (30%), Positives = 112/231 (48%), Gaps = 13/231 (5%)

Query: 472 EIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGR 531
           ++ F+N + S+ T  +     NLN     G    V+G +G GK+++   LL   +   GR
Sbjct: 758 KLAFDNSTTSWDTNGSGFKLRNLNIDFKVGKLNVVIGATGSGKTSLLMALLGEMHICQGR 817

Query: 532 ITIDG-QDISKISAKS--LRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIR--SVS 586
           I +   +  S ++A S      +    Q   L++ ++R+NI +   +    DE R   V 
Sbjct: 818 IIVPSLEPRSSLTANSDGFTNSIAYCSQAAWLLNDTVRNNILFNSSF----DENRYHKVV 873

Query: 587 KKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVE 646
           + C           G  T IG KG  LSGGQKQRI++ARAL      L+LD+  SA+D  
Sbjct: 874 EACGLKRDFDILKAGDLTEIGEKGITLSGGQKQRISLARALYSDSKHLLLDDCLSAVDSH 933

Query: 647 SEGAI--NYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMG 695
           +   I  N   G LM  R  T I ++H ++   R+  ++V+ +DG V + G
Sbjct: 934 TASWIYDNCITGPLMVGR--TCILVSHNIALTLRNAELVVILEDGRVKDQG 982

>NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10
          Length = 1506

 Score =  155 bits (391), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 163/610 (26%), Positives = 273/610 (44%), Gaps = 85/610 (13%)

Query: 138  WKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAITSDEKPKDLRDLPPVVWGLGLYDF 197
            W +++V   L+ I C+          +   V  +  T D+     ++  P  + +GLY F
Sbjct: 924  WGIVVVPCYLILIMCT------TFCSLFSSVWLSYWTEDK----FKNRAPSFY-MGLYSF 972

Query: 198  LAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKVGDLISR 257
               F+  L  S F       LL  +G      L    +K+ +H    + D   +G +++R
Sbjct: 973  FVFFSYILTTSQFT------LLCCIGVLSSKWLNLRAVKRILHTPMSYLDTTPLGRILNR 1026

Query: 258  LSSDAYVVSRSMTQNISD---GFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATI 314
             + D   +   +T+++      F  I+  GV I  + ++                +    
Sbjct: 1027 FTKDTDSLDNELTESVRMLLYQFANIV--GVCIMCIIYLPWFAIAIPFLFVGFVLIADHY 1084

Query: 315  Y--GRKIR---SISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFD 369
               GR+I+   +I R    +  N      E L G+ T++S+ +E + I + +  I K+ +
Sbjct: 1085 QSSGREIKRLEAIQRSFVYNNFN------EVLGGMDTIKSYRSENRFIAKSDFLIDKMNE 1138

Query: 370  VGKREALTN---ATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGS 426
             G          A F    +V   F+ +I L   +      + S+G L  ++L  +  G 
Sbjct: 1139 AGYLVVAVQRWVAIFLDVIAVC--FALIITLLCVTRAFPISAASVGVLLTYVL--QLPG- 1193

Query: 427  AVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYV------PGKGEIKFENVSF 480
             + G+    ++      +A RL       P + A    P V      P KGEI FENV F
Sbjct: 1194 LLNGVLRSLTQTENDMNSAERLVTYATELP-LEADYRKPEVSPPEEWPTKGEIHFENVDF 1252

Query: 481  SY----PTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDG 536
            SY    PT     +  NL+  I SG  + + G +G GKSTI S L +    +SG++ ID 
Sbjct: 1253 SYRPGLPT-----VLKNLSLDIKSGEKIGICGRTGAGKSTIMSALYRLNEISSGKMIIDD 1307

Query: 537  QDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDE------IR--SVSKK 588
             DIS I    LRR L ++ Q+P+L  G+IR N+    P+    DE      +R  ++ +K
Sbjct: 1308 VDISTIGLYDLRRKLAIIPQDPVLFRGTIRKNLD---PFNEHQDEHLWNALVRGGAIEQK 1364

Query: 589  CF------------CHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILIL 636
                           H+ + KF    + ++  +GA  S G++Q +A+ RAL+++  ILIL
Sbjct: 1365 ELNEIKAQKPDEKGNHSEMYKFH--LDQLVEEEGANFSLGERQLLALTRALVRQARILIL 1422

Query: 637  DEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGK 696
            DEATS++D E++G I   + +  +    TI+ IAHRL TI   + ++VL + G V E   
Sbjct: 1423 DEATSSVDYETDGKIQARIVE--EFGHCTILCIAHRLKTILTYDRILVL-EKGEVAEFDT 1479

Query: 697  FKELYASKES 706
             K L+A ++S
Sbjct: 1480 PKTLFAQEDS 1489

 Score =  104 bits (259), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 79/226 (34%), Positives = 118/226 (52%), Gaps = 25/226 (11%)

Query: 491 FNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRH 550
           F++LNF I  G  + +VGP G GK+++ +    + N  SGRI I+G D+           
Sbjct: 649 FHDLNFEIKKGEFIIMVGPIGTGKTSLLNAFAGFMNKVSGRIQING-DL----------- 696

Query: 551 LGVVQQEPILMSGSIRDNITYGVPYTPT-IDEIRSVSKKCFCHNFITKFSDGYETVIGPK 609
             ++   P + + S++DNI +G PY     DE+  V   C   + +     G  T IG +
Sbjct: 697 --LLCGYPWIQNASVKDNIIFGSPYNKAKYDEVIRV---CSLKSDLDILPAGDLTEIGER 751

Query: 610 GALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI--NYTLGQLMKSRDITII 667
           G  LSGGQK RI +AR++ K+ +I + D+  SA+D      I     LG L   +D T I
Sbjct: 752 GITLSGGQKARINLARSVYKQKDIYLFDDVLSAVDSRVGKHIMDECFLGLL---KDKTRI 808

Query: 668 SIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLN 713
              H+LS + R+  VIVLG+DGS  ++G  +EL   + S L  LL 
Sbjct: 809 LATHQLSLLERASRVIVLGNDGS-FDIGTVEEL-KQRSSTLVNLLQ 852

>YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}
            VMR1Vacuolar membrane protein involved in multiple drug
            resistance and metal sensitivity; ATP-binding cassette
            (ABC) family member involved in drug transport; potential
            Cdc28p substrate; induced under respiratory conditions
          Length = 1592

 Score =  154 bits (389), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 151/561 (26%), Positives = 249/561 (44%), Gaps = 96/561 (17%)

Query: 223  GEKLVARLRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIIC 282
            G +   ++ +N++   +H    FFD   VG +++R S D   V + +   +         
Sbjct: 1067 GMRASRKIFNNLLDLVLHAQIRFFDVTPVGRIMNRFSKDIEGVDQELIPYLE-------- 1118

Query: 283  GGVGIGMMFHISSXXXXXXXXXXXXXXVGATIY------GRKIRSISRDLQQ----STGN 332
              V I  +   +S              V   ++      G+   + SR+L++    +   
Sbjct: 1119 --VTIFCLIQCASIIFLITVITPRFLTVAVIVFVLYFFVGKWYLTASRELKRLDSITKSP 1176

Query: 333  LTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFS 392
            + +   E L GV T+++F  E++ I    + I +           N  FF  +  +  FS
Sbjct: 1177 IFQHFSETLVGVCTIRAFGDERRFILENMNKIDQ----------NNRAFFYLSVTVKWFS 1226

Query: 393  F-------LIVLAYGSHLVLQ-----GSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMK 440
            F        IVLA GS ++L        L+   LT  +L+T+        L   YS    
Sbjct: 1227 FRVDMIGAFIVLASGSFILLNIANIDSGLAGISLTYAILFTD----GALWLVRLYSTFEM 1282

Query: 441  GAGAASRLFELTDHQPSIYATK--------GVPYVPGKGEIKFENVSFSYPTRSANQIFN 492
               +  RL E +  +   Y             P  P  GEI+ EN+S  Y   +   +  
Sbjct: 1283 NMNSVERLKEYSSIEQENYLGHDEGRILLLNEPSWPKDGEIEIENLSLRYAP-NLPPVIR 1341

Query: 493  NLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLG 552
            N++F +D  S + +VG +G GKSTI + L +   P +G I IDGQDISKI   +LRR + 
Sbjct: 1342 NVSFKVDPQSKIGIVGRTGAGKSTIITALFRLLEPITGCIKIDGQDISKIDLVTLRRSIT 1401

Query: 553  VVQQEPILMSGSIRDNITYGVPYTP--------TIDEIRSVSKKCF------------CH 592
            ++ Q+PIL +G+I+ N+    PY           + ++  +S   F             H
Sbjct: 1402 IIPQDPILFAGTIKSNVD---PYDEYDEKKIFKALSQVNLISSHEFEEVLNSEERFNSTH 1458

Query: 593  NFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAIN 652
            N   KF +   T I   G  LS G++Q + IAR+L+++P I++LDEATS++D +S+  I 
Sbjct: 1459 N---KFLN-LHTEIAEGGLNLSQGERQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQ 1514

Query: 653  YTL-GQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLY-- 709
              +  +  KS   TI++IAHRL ++   + +IV+ D G V E  +  EL   +    Y  
Sbjct: 1515 GIIRSEFNKS---TILTIAHRLRSVIDYDRIIVM-DAGEVKEYDRPSELLKDERGIFYSM 1570

Query: 710  -------KLLNEKAKDTTSKM 723
                   +LL + AK ++  M
Sbjct: 1571 CRDSGGLELLKQIAKQSSKMM 1591

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 105/422 (24%), Positives = 182/422 (43%), Gaps = 31/422 (7%)

Query: 339 EQLSGVKTVQSFVAEQK---EIKRYNH-AIRKVFDVGKREALTNATFFSSTSVLGDFSFL 394
           E L  ++ V+ F  E+    EIK      +R +       ++T+  +F + +++   +F 
Sbjct: 532 ECLQNIRIVKYFAWERNIINEIKSIRQKELRSLLKKSLVWSVTSFLWFVTPTLVTGVTFA 591

Query: 395 IVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDH 454
           I   +  H  L   L+   L+ F L      + +  LSN  S + +   +  R+ +    
Sbjct: 592 IC-TFVQHEDLNAPLAFTTLSLFTLLK----TPLDQLSNMLSFINQSKVSLKRISDFLRM 646

Query: 455 QPSIYATKGVPYVPGKGEIKFENVSFSYPTRSANQ---IFNNLNFTIDSGSNVCVVGPSG 511
             +      +   P K +I+F+N + ++    ++        LN     G    ++G +G
Sbjct: 647 DDT-EKYNQLTISPDKNKIEFKNATLTWNENDSDMNAFKLCGLNIKFQIGKLNLILGSTG 705

Query: 512 RGKSTIASLLLKYYNPTSGRITIDG----QDISKISAKSLRRHLGVVQQEPILMSGSIRD 567
            GKS +   LL   N  SG I +       D+     + L        Q   L++ ++++
Sbjct: 706 SGKSALLLGLLGELNLISGSIIVPSLEPKHDLIP-DCEGLTNSFAYCSQSAWLLNDTVKN 764

Query: 568 NITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARAL 627
           NI +   Y    D    V   C     +     G  T IG KG  LSGGQKQRI++ARA+
Sbjct: 765 NIIFDNFYNE--DRYNKVIDACGLKRDLEILPAGDLTEIGEKGITLSGGQKQRISLARAV 822

Query: 628 IKKPNILILDEATSALDVESEGAI--NYTLGQLMKSRDITIISIAHRLSTIRRSENVIVL 685
                 ++LD+  SA+D  +   I  N   G LMK+R  T I + H +S   R+ +  ++
Sbjct: 823 YSSAKHVLLDDCLSAVDSHTAVWIYENCITGPLMKNR--TCILVTHNVSLTLRNAHFAIV 880

Query: 686 GDDGSVVEMGKFKELYASKESKLYKLLNEKAKDTTSKMNAETVE---KNDP---SPKTEK 739
            ++G V   G   EL +    K  K +   ++D+ ++ NA  ++   KND     P TE 
Sbjct: 881 LENGKVKNQGTITELQSKGLFK-EKYVQLSSRDSINEKNANRLKAPRKNDSQKIEPVTEN 939

Query: 740 LN 741
           +N
Sbjct: 940 IN 941

>CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1648

 Score =  154 bits (388), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 145/570 (25%), Positives = 252/570 (44%), Gaps = 76/570 (13%)

Query: 193  GLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKVG 252
            G+  FL V+    V+S+     +  +  + G +    +  +++ + +H    FFD   +G
Sbjct: 1088 GIAKFLVVYCLIGVMSSIIGSIKTFVNSLFGIRASKLIFDSLLDRVLHARVRFFDSTPIG 1147

Query: 253  DLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGA 312
             +++R S D      S+ Q I    +++    + +     + S              +G 
Sbjct: 1148 RIMNRFSKDI----ESIDQEIPPNIQSVFYSAIEVFATLLLISYITPAFFPVAIIIVLGY 1203

Query: 313  TIYGRKIRSISRDLQQ----STGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVF 368
            +I G    + SR+L++    S   + +   E L GV T+++F  EQ+ IK     I +  
Sbjct: 1204 SIVGFFYLTTSRELKRLDSISKSPIFQHFSETLVGVTTIRAFGDEQRFIKENLSMIDQ-- 1261

Query: 369  DVGKREALTNATFFSSTSVLGDFSF-------LIVLAYGSHLVLQ-----GSLSIGDLTA 416
                     +  FF    V    SF       L++ + G  ++L        L+   LT 
Sbjct: 1262 --------NSMPFFYLWVVNRWLSFRIDLIGALVIFSSGVFILLNINNIDAGLAGISLTY 1313

Query: 417  FMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELT--DHQPSIY----ATKGVPYVPGK 470
             + +TE    A   L   YSEL     +  R+ E    + +P I     A    P  P  
Sbjct: 1314 AISFTE----AALWLVRQYSELEMNMNSVERVLEYMNIEQEPLIADPANAVTPPPQWPDS 1369

Query: 471  GEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSG 530
            G+++  N+S  Y       +  ++ FTI+    V +VG +G GKSTI + L ++    +G
Sbjct: 1370 GKVEVNNLSLKYAPHLP-YVIKDVTFTIEPLEKVGIVGRTGAGKSTIITALFRFLEADTG 1428

Query: 531  RITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTID---------- 580
             I +DG +I+ I  K LRR + ++ Q+P L +GSIR N+    PY    D          
Sbjct: 1429 SIKLDGVNIANIDLKRLRRSITIIPQDPTLFAGSIRSNLD---PYDEYSDEEIFTALKRV 1485

Query: 581  -------------EIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARAL 627
                         EI+S S K      + KF +  E+ I   G+  S GQ+Q + +AR+L
Sbjct: 1486 NLVSTEEMEASTSEIQSNSSKN-----VNKFLN-LESEIAEGGSNFSQGQRQLMCLARSL 1539

Query: 628  IKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGD 687
            ++ P +++LDEAT+++D  S+  I  T+ Q  +  + T+++IAHRL +I   + ++V+ D
Sbjct: 1540 LRMPKVILLDEATASIDYNSDAKIQETIRQ--EFNNSTVLTIAHRLRSIVDYDKILVM-D 1596

Query: 688  DGSVVEMGKFKELYASKESKLYKLLNEKAK 717
             G V E      L   K+S  Y +  +  +
Sbjct: 1597 AGEVKEFDHPYSLLLEKKSIFYNMCEDSGE 1626

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 69/237 (29%), Positives = 115/237 (48%), Gaps = 13/237 (5%)

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           + FENV+  + +   + +  NL+    +G    +VG +G GK++I   LL     + G+I
Sbjct: 706 LAFENVTLRWDSDKDSFVLRNLDIEFMTGKLNVIVGATGSGKTSILMGLLGEMQLSEGKI 765

Query: 533 TIDG---QDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIR--SVSK 587
            +     +   +  A  +   +    Q   L++ ++R+NI +  P+    D+ R  +V +
Sbjct: 766 IVPSLSPRHEYQSQAGVINDSIAYCSQAAWLLNDTVRNNILFNAPF----DQARYDAVVE 821

Query: 588 KCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVES 647
            C           G  T IG KG  LSGGQKQR+++ARAL      L+LD+  SA+D  +
Sbjct: 822 ACSLKRDFQILKAGDSTEIGEKGITLSGGQKQRVSLARALYSSAGHLLLDDCLSAVDSHT 881

Query: 648 EGAI--NYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYA 702
              I      G LM+ R  T I + H ++   ++ + +V+ +DG V E G   EL A
Sbjct: 882 ALWIYDKCISGPLMEGR--TCILVTHNIALTMKNADFVVMIEDGKVKEKGTPIELLA 936

>CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1 or uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1
          Length = 1535

 Score =  154 bits (388), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 150/552 (27%), Positives = 251/552 (45%), Gaps = 50/552 (9%)

Query: 193  GLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDA-EFFDRNKV 251
             L  FL V+A   +   F N  R + + + G    +R   N + KTI +    FF+    
Sbjct: 990  NLLWFLGVYAAIGLGGAFCNNMRSLTMLLYGSLRGSRKLHNKMAKTIMRSPMSFFETTPT 1049

Query: 252  GDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVG 311
            G +I+R SSD   V  ++    S  F++I+   + + ++                     
Sbjct: 1050 GRIINRFSSDMDSVDTTLQNVFSLFFRSILDYIITVILVTFNMPLFFLLNAGLLVIYLYY 1109

Query: 312  ATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVG 371
             + Y    R + R    S   +  +  E LSG  T+ ++    ++I+R++H   +     
Sbjct: 1110 QSFYIVLSRELKRLTSISYSPIMSLMGESLSGHFTISAY----EQIRRFSHLNYE----- 1160

Query: 372  KREALTNATFFSSTSV-------LGDFSFLIVLAYG----SHLVLQGSLSIGDLTAFMLY 420
             R   +   FF+  S        L     LIVL+ G    S L     LS G +   M Y
Sbjct: 1161 -RIQFSINCFFNYRSSNRWLSVRLQSIGALIVLSTGLLALSSLGTDHQLSSGLVGLLMSY 1219

Query: 421  TEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYV----PGKGEIKFE 476
                 S++  +      +     +  R+ E  D  P     K    +    P +G+I+F+
Sbjct: 1220 ALQVTSSLIWIIRSSVLIETNIVSVERIVEYCDISPEAPEVKEEHRLDDNWPNQGQIEFK 1279

Query: 477  NVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDG 536
            N S SY   + + +  ++N  I  G  + VVG +G GKST++  L +   PT+G I+ID 
Sbjct: 1280 NYSTSY-RENLDPVLKHINLVISPGEKIGVVGRTGAGKSTLSMALFRLLEPTAGTISIDN 1338

Query: 537  QDISKISAKSLRRHLGVVQQEPILMSGSIR-----------DNITYGVPYTPTIDEIRSV 585
             DI+ I  + LR H+ ++ Q+     G+IR           D++ + +  +     + ++
Sbjct: 1339 IDITSIGLRDLRSHIAIIPQDAQAFEGTIRSNLDPFEKFSDDDLWHAIELSHLKFHLETI 1398

Query: 586  SKKCFCHNFITKFSD------GYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEA 639
            +K+    N  +++SD        +  +   G+ LS GQKQ + +ARAL+ K  IL+LDEA
Sbjct: 1399 AKEI---NDDSEYSDRSRLESPLDIPVREAGSNLSVGQKQLLCLARALLNKSKILVLDEA 1455

Query: 640  TSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKE 699
            T+++DVE++  I  T+ +    R  TI++IAHRL T+  S+ +IVL D G V E  K + 
Sbjct: 1456 TASVDVETDKIIQETIRKEFADR--TILTIAHRLDTVFDSDRIIVL-DGGEVKEFDKPET 1512

Query: 700  LYASKESKLYKL 711
            L   K+S  YKL
Sbjct: 1513 LLEQKDSIFYKL 1524

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 107/442 (24%), Positives = 208/442 (47%), Gaps = 62/442 (14%)

Query: 313 TIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIR---KVFD 369
           T+  RK++ +S+   +   +  K   E LS +K+++ +  E+  +KR  H IR   ++ +
Sbjct: 434 TLLSRKLKVLSKTQMKFKDSRIKTVSEILSSIKSIKLYAWEEPMLKRLFH-IRNDLELMN 492

Query: 370 VGKREALTNATFFSSTSV------LGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEY 423
           + K   ++N   F+  +V         F+F ++    S   L   +    L+ F +    
Sbjct: 493 LKKIGIMSNFISFAWNAVPLAITCATFFTFAVI----SKTPLSPEIVFPALSLFNIL--- 545

Query: 424 SGSAVFGLSNFYSELMKGAGAASRL--FELTDHQPSIYATKGV-PYVPGKGEIKFENVSF 480
             SA++ + +  S +++   + SR+  F L +   + +  + V P       +K  N +F
Sbjct: 546 -NSAIYSIPSMISRIIETGVSISRVKKFLLLEELDNSFIERSVTPEDDTTPVLKINNATF 604

Query: 481 SYPTRS---------ANQIFNNL-----------NFTIDSGSNVCVVGPSGRGKSTIASL 520
            + ++           N +   +           NF +   S +CVVG  G GKSTI   
Sbjct: 605 LWRSKENLHKDDKNGENDVEARIESSQIALKSIDNFEVPKSSLICVVGRVGAGKSTILKC 664

Query: 521 LLKYYNPTSGRITIDGQDIS---KISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTP 577
           +L      SG    +   +S   +I+A ++        QE  +M+ S++DNI +G  Y  
Sbjct: 665 ILGQLPCISG----NNDHLSPQFQINATTV----AYCPQEAWIMNASVKDNILFGHKYDE 716

Query: 578 TIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILD 637
                ++  K C     I    DG ET++G KG +LSGGQK R+++ARA+  + ++ +LD
Sbjct: 717 AF--YKATIKACQLLPDIKVLPDGDETMVGEKGIVLSGGQKTRLSLARAVYSRADLYLLD 774

Query: 638 EATSALDVE-SEGAINYTLGQ---LMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVE 693
           +  SA+D E  +  I   L +   L+K + I + +  + +S ++ S  + +L ++ S+ +
Sbjct: 775 DILSAVDTEVCKTIIKEVLDEKTGLLKDKSIVLAT--NTISVLKHSTKIYLL-ENKSIAQ 831

Query: 694 MGKFKELYASKE-SKLYKLLNE 714
            G + ++  +++ SKL  +L+E
Sbjct: 832 EGNYDDIMNNQQDSKLKNILHE 853

>Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  152 bits (385), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 137/532 (25%), Positives = 242/532 (45%), Gaps = 52/532 (9%)

Query: 214  GRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNI 273
            G+ +L  + G     ++ + ++ K +H    FFD    G +++R S D   + + +T  I
Sbjct: 1121 GKTILNFVAGINASRKIFNMILNKVLHSKLRFFDATPTGRIMNRFSKDIEAIDQELTPYI 1180

Query: 274  SDGFKAII-CGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGN 332
               F ++I C    I + F                  +G   Y    R + R    S   
Sbjct: 1181 QGAFYSLIECLSTVILITFITPQFLSVAIVVSIMYYFIG-YFYMAGSRELKRYESISRSP 1239

Query: 333  LTKVAEEQLSGVKTVQSFVAE----QKEIKRYNHAIRKVF--DVGKREALTNATFFSSTS 386
            + +   E L GV T+++F  E    Q+ +++ +   +  F   V  R          S  
Sbjct: 1240 IYQHFSETLVGVTTIRAFGDEGRFMQENLQKIDENNKPFFYLWVANRWLAFRIDMIGSLV 1299

Query: 387  VLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAAS 446
            + G  + L +L+   HL     ++   LT  + +TE        L   YSE+     +  
Sbjct: 1300 IFG--AGLFILSNIDHL--DSGMAGISLTYAISFTE----GALWLVRLYSEVEMNMNSVE 1351

Query: 447  RLFELTDHQPSIY-ATKGVP--YVPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSN 503
            R+ E  + +   Y   K VP    P  G+I+  ++S  Y   +  ++  N++F++D+ S 
Sbjct: 1352 RVKEYMEIEQEPYNQHKEVPPPQWPQDGKIEVNDLSLRYAP-NLPRVIKNVSFSVDAQSK 1410

Query: 504  VCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSG 563
            V +VG +G GKSTI + L ++  P +G I ID  DIS +  + LRR + ++ Q+P L SG
Sbjct: 1411 VGIVGRTGAGKSTIITALFRFLEPDTGHIKIDNIDISNVDLQRLRRSITIIPQDPTLFSG 1470

Query: 564  SIRDNITYGVPYTP------------------------TIDEIRSVSKKCFCHNFITKFS 599
            +I+ N+    PY                          T+ E+ + +      N + KF 
Sbjct: 1471 TIKTNLD---PYNEFSNQKIFEALKRVNLVSEEQLQQGTVREVATDTSSADSEN-VNKFL 1526

Query: 600  DGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLM 659
            D  E+ +   G+ LS GQ+Q + +AR+L++ P I++LDEAT+++D  S+  I  T+ +  
Sbjct: 1527 D-LESEVSEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRKEF 1585

Query: 660  KSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKL 711
            +    TI++IAHRL ++   + ++V+ D G V E      L  +K+S  Y +
Sbjct: 1586 QGS--TILTIAHRLRSVIDYDKILVM-DAGEVKEYDHPYSLLLNKQSIFYSM 1634

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 112/233 (48%), Gaps = 9/233 (3%)

Query: 468 PGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNP 527
           P      FEN + S+   + +    +LN    +G    V+GP+G GK+++   LL     
Sbjct: 689 PNGKRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 528 TSGRITIDGQDISK---ISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRS 584
            +G++ +   D  +   + A      +    Q   L++ ++++NI +   +  T    ++
Sbjct: 749 LNGKVVVPALDPRQELVVEANGTTNSIAYCSQAAWLLNDTVKNNILFNSQFNET--RYKA 806

Query: 585 VSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALD 644
           V + C           G  T IG KG  LSGGQKQR+++ARAL      ++LD+  SA+D
Sbjct: 807 VVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAVD 866

Query: 645 VESEGAI--NYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMG 695
             +   I  N   G LM+ R  T I ++H ++   R+  ++VL +DG V + G
Sbjct: 867 SHTASWIYDNCITGPLMEDR--TCILVSHNIALTLRNAELVVLLEDGRVKDQG 917

>TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4.6
            YHL035C
          Length = 1691

 Score =  152 bits (383), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 135/548 (24%), Positives = 248/548 (45%), Gaps = 39/548 (7%)

Query: 197  FLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKVGDLIS 256
            +L+++ G  VL +     + +L    G     ++ ++++K ++H    FFD   +G +++
Sbjct: 1137 YLSIYFGIGVLHSSIFAIKDILCTYAGLAASRKMFNSLLKNSLHAKLRFFDSTPLGRIMN 1196

Query: 257  RLSSDAYVVSRSMTQNISDGFKAII-CGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIY 315
            R S D   V + +   +   F  ++ C  + + +                    VGA +Y
Sbjct: 1197 RFSKDIEAVDQEVPMYLGGTFACLVECFSIIVLITLITPQFLGVAIFIAVFYWFVGA-VY 1255

Query: 316  GRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREA 375
                R + R    +   + +   E L+G+ TV+++  E + ++     I +         
Sbjct: 1256 ISGSRELKRFDSITKSPIYQHFSETLAGITTVRAYGDESRFMRENLEKIDENNKPFFYMW 1315

Query: 376  LTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFY 435
            ++N      T ++G  +F+I+ A G  +     +  G     + Y      A   L  FY
Sbjct: 1316 VSNRWLSFRTQIIG--AFVILGAGGFSIWNINKIDSGLAGISLTYALTFSDAALWLVRFY 1373

Query: 436  SELMKGAGAASRLFELT--DHQPSIYATKGVPY-VPGKGEIKFENVSFSYPTRSANQIFN 492
             +      +  R+ E    D +P    T   P   P  G+I+  +VS  Y   +  ++  
Sbjct: 1374 GDTEMNMNSTERIQEYMNIDQEPYNEGTVEPPADWPENGKIEINDVSLRYAP-NLPRVIK 1432

Query: 493  NLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLG 552
            N++FT+DS S V +VG +G GKSTI + L ++  P +G I ID  DI  I  + LRR + 
Sbjct: 1433 NVSFTVDSKSKVGIVGRTGAGKSTIITALFRFLEPETGNIKIDNIDIVSIDLQKLRRSIS 1492

Query: 553  VVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITK--------------- 597
            ++ Q+P L +G+IR N+    PYT   D  + +     C N +++               
Sbjct: 1493 IIPQDPTLFTGTIRSNLD---PYTQYSD--KEIFDSLICVNLVSREELAQVQSPSSNDTS 1547

Query: 598  --FSDGY------ETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEG 649
               S+ +      E  +   G+ +S GQ+Q + +AR+L+ KP I++LDEAT+++D ES+ 
Sbjct: 1548 SIVSENFNHFLDLEYNVSEGGSNISQGQRQLLCLARSLLGKPKIILLDEATASIDYESDK 1607

Query: 650  AINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLY 709
             I  T+     +   TI++IAHRL ++   + ++V+ D G V E      L  +K S  Y
Sbjct: 1608 KIQETIRNEFGNS--TILTIAHRLRSVIDYDKILVM-DAGEVEEYDHPYSLLLNKNSIFY 1664

Query: 710  KLLNEKAK 717
             +  +  +
Sbjct: 1665 SMCEQSGE 1672

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 123/528 (23%), Positives = 225/528 (42%), Gaps = 73/528 (13%)

Query: 214 GRVVLLR----ILGEKLVARLRSNVIKKT-----------------IHQDAEFFDRNKVG 252
           GR + +R    I+ E  +  LR  +I KT                 I  D E      VG
Sbjct: 481 GRRICIRMRSIIISEIYIKALRRQIITKTKKSTDEVDPEQLNEDSKIDGDEESTASANVG 540

Query: 253 DLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGA 312
            +I+ ++ DA+ V+  +   +      II   V I ++F++                +GA
Sbjct: 541 AIINLIAVDAFKVAE-IGAYLHTFIGTIIMTFVSIYLLFNL----------LGSAAFIGA 589

Query: 313 -TI-----YGRKIRSISRDLQQ----STGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNH 362
            TI        KI +   +LQQ    +T    +   E    ++ ++ F + +K  +   H
Sbjct: 590 LTIIVLIPVNYKIANWLGNLQQKNLKTTDKRIQKLNETFQAIRIIK-FFSWEKNFENDIH 648

Query: 363 AIRK--VFDVGKR---EALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAF 417
            IR+  ++ +  R    + +   FF S +++   SF    AY  ++ +Q      +LT+ 
Sbjct: 649 KIREEELYILLLRCLVWSFSTFIFFISPTIVTSLSF----AY--YIFIQKQ----ELTSP 698

Query: 418 MLYTEYSGSAVFG-----LSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGE 472
           + +T  S  A+       ++N  S +++   +  R+    D +P     + +     K +
Sbjct: 699 VAFTALSLFALLKIPLDQMANMLSYVVQSKVSLDRVQTFLD-EPDTKKYEQLTVPVEKNK 757

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           + F+N + S+   + +    NL+     G    V+GP+G GK+++   LL     T G+I
Sbjct: 758 LSFKNATMSWGNDNDSFKLRNLDIDFKIGQLNVVIGPTGSGKTSLLMALLGEMTLTEGQI 817

Query: 533 TIDGQDISK---ISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKC 589
            I   D      I +      +    Q   L++ ++R+NI +  PY    D   +     
Sbjct: 818 NIPSLDPRHDLIIESDGHTNSIAYCSQAAWLLNDTVRNNILFNSPYNK--DRYDAAIVAA 875

Query: 590 FCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEG 649
                    + G  T IG +G  LSGGQKQRI++ARAL      ++LD+  SA+D  +  
Sbjct: 876 GLKRDFEILAAGDLTEIGERGITLSGGQKQRISLARALYSNARHVLLDDCLSAVDAHTAA 935

Query: 650 AI--NYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMG 695
            I  N   G LM+ R  T + ++H ++   ++ +++V+  +G V + G
Sbjct: 936 WIYDNCISGPLMEGR--TCVLVSHNIALTLKNASLVVMLKNGRVADQG 981

>Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar to
            Ashbya gossypii ACL072C
          Length = 1678

 Score =  152 bits (383), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 137/550 (24%), Positives = 250/550 (45%), Gaps = 48/550 (8%)

Query: 195  YDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKVGDL 254
            + +L+++     L    +  +V+L  I G K   ++ + ++KK ++    FFD    G +
Sbjct: 1124 FYYLSIYILLGTLRALISTVKVILSYISGLKASRKIFTLLLKKVLYAKLRFFDSTPTGRI 1183

Query: 255  ISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATI 314
            ++R S D   +   +       F +++     I ++ +I+               +    
Sbjct: 1184 MNRFSRDVEAIDEELIPFFEGAFASLVQCITTILLIGYITPVFLFFAIVICVSYYIVGYF 1243

Query: 315  YGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQK----EIKRYNHAIRKVFDV 370
            Y    R + R    +   + +   E L GV T+++F  E++     + + +   R  F +
Sbjct: 1244 YLVGSRELQRFESITKSPIHQHFSETLVGVTTIRAFGDERRFLADNLSKVDTHNRPFFYL 1303

Query: 371  GKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQ-GSLSIGDLTAFMLYTEYSGSAVF 429
                 +TN         +G F   ++LA G  ++L   SL  G     ++Y         
Sbjct: 1304 W----VTNRWLAFRIDFIGAF---VILASGIFILLNVNSLDAGLAGISLIYAISFTEGAL 1356

Query: 430  GLSNFYSELMKGAGAASRLFELT--DHQPSIYATKGVPYVPGKGEIKFENVSFSYPTRSA 487
             L   YS +     +  RL E    + +PS    +  P  P +G+I+  N+S  Y + + 
Sbjct: 1357 WLVRLYSNVEMTMNSVERLKEYMKIEQEPSTGLYEPPPEWPDRGKIEVNNLSLRYAS-NL 1415

Query: 488  NQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSL 547
             ++  N+ FT++  S V +VG +G GKSTI + L ++ +P +G I +D  DI+ I  K L
Sbjct: 1416 PKVIKNVTFTVEPQSKVGIVGRTGAGKSTIITALFRFLDPDTGTIKLDNVDITSIRLKRL 1475

Query: 548  RRHLGVVQQEPILMSGSIRDNITYGVPY-----------------------TPTIDEIRS 584
            R+ + ++ Q+P+L +G+I+ N+    PY                       TPT  +I S
Sbjct: 1476 RQSITIIPQDPVLFAGTIKSNLD---PYSEYADDRIFEALKRVNLIVQEELTPT--DIPS 1530

Query: 585  VSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALD 644
             S      N + KF D   + I   G+ LS GQ+Q + +AR+L++ P  ++LDEAT+++D
Sbjct: 1531 SSSSLSFEN-VNKFLD-LTSEITEGGSNLSQGQRQLVCLARSLLRNPKAILLDEATASID 1588

Query: 645  VESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASK 704
              S+  I  T+ +       TI++IAHRL +I   + V+V+ D G + E      L  +K
Sbjct: 1589 YASDAKIQQTIREEFSGS--TILTIAHRLRSIIDYDKVLVI-DSGELAEYDHPYTLLLNK 1645

Query: 705  ESKLYKLLNE 714
             S  Y++  +
Sbjct: 1646 GSLFYRMCED 1655

 Score = 93.6 bits (231), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 117/238 (49%), Gaps = 10/238 (4%)

Query: 470 KGEIKFENVSFSYPTRSANQI-FNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPT 528
           K  + F N +  +   SA      NLN     G    +VGP+G GK+++   LL   N +
Sbjct: 708 KDRLGFSNATIGWDHDSATDFKLKNLNIDFKIGKLNVIVGPTGSGKTSLLMGLLGEINLS 767

Query: 529 SGRITIDGQDISK---ISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSV 585
            G+I +   +  +   + A  +   +G   Q   L++ ++R+NI +  PY    +   +V
Sbjct: 768 EGKIYVPALNPREDLVVDADGMTDSIGYCSQSAWLLNDTLRNNILFSAPYEA--NRYNAV 825

Query: 586 SKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDV 645
              C     +   + G +T +G KG  LSGGQKQR+++ARA+  +   ++LD+  SA+D 
Sbjct: 826 IHACGLTRDLEILNAGDQTEVGEKGITLSGGQKQRVSLARAMYSRARHILLDDCLSAVDS 885

Query: 646 ESEGAI--NYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELY 701
            +   I  +   G LM+ R  T + ++H  +   ++ + +V+ ++  V   G+  EL+
Sbjct: 886 HTAQWIYKHCITGPLMEGR--TCVLVSHNTALTLKNADWVVILENAKVTAQGEPLELF 941

>Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar to
            Ashbya gossypii AGR047W
          Length = 1505

 Score =  151 bits (382), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 147/532 (27%), Positives = 230/532 (43%), Gaps = 17/532 (3%)

Query: 189  VWG-LGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFD 247
            +W  LG+Y FL  F+ +L  ST      + L      K  ARL   + K  +     FF+
Sbjct: 980  IWKYLGIY-FLLCFSASL--STLLR--SITLCMFCTIKASARLHDAMAKAVLRAPMSFFE 1034

Query: 248  RNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXX 307
               VG +++R S+D Y V   + ++ S  F  +      + ++  I+             
Sbjct: 1035 TTPVGRILNRFSNDIYKVDELLGRSFSQFFIHVTKVVFTMIVICSITWQFIFFILPLSVL 1094

Query: 308  XXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKV 367
                   Y R  R + R    +   +    +E L+GV TV+SF  + + I      I   
Sbjct: 1095 YLFYQQYYLRTSRELRRLASVTKSPVYAHFQETLTGVTTVRSFKKQDRFIHINQSRINTY 1154

Query: 368  FDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSA 427
                      N         +G    L         + QG L+ G L   + Y      +
Sbjct: 1155 MCAYYLSINANRWLAFRLEFMGSIVILAAAVLSVFRLKQGKLTAGMLGLGLSYALQITQS 1214

Query: 428  VFGLSNFYSELMKGAGAASRLFELTDHQPS---IYATKGVPY-VPGKGEIKFENVSFSYP 483
            +  +     E+     +  R+ E TD +P    I  T   P   P  G+IKFE+ S  Y 
Sbjct: 1215 LNWIVRMTVEVETNIVSVERIKEYTDLKPEAPMIIPTSRPPKNWPANGDIKFEHFSTRYR 1274

Query: 484  TRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKIS 543
                + I  ++N  I     V +VG +G GKS++   L +     +GRI ID   I  I 
Sbjct: 1275 PE-LDLILEDINLHIHPREKVGIVGRTGAGKSSLTVSLFRLIEAAAGRILIDDLPIDSIG 1333

Query: 544  AKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFC-HNFITKFSDGY 602
               LR  L ++ Q+  +  G+ R+NI     +T   DEI +  +      + +T  ++G 
Sbjct: 1334 LNDLRSSLSIIPQDSEVFEGTFRENIDPCNKFTD--DEIWNALELAHLKQHVMTLGTEGL 1391

Query: 603  ETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSR 662
             T +   G+ LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE++  I  T+    K R
Sbjct: 1392 NTSLKEGGSNLSVGQRQLMCLARALLVPSKILVLDEATAAIDVETDKLIQRTIRTAFKDR 1451

Query: 663  DITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNE 714
              TI++IAHRL+TI  S+ ++VL D G + E      L   + S  Y L NE
Sbjct: 1452 --TILTIAHRLNTIMDSDKIVVL-DKGRIAEFDTPCNLLKDETSIFYSLCNE 1500

 Score = 99.4 bits (246), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 103/432 (23%), Positives = 196/432 (45%), Gaps = 57/432 (13%)

Query: 334 TKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSF 393
           T++  E L+ +K+++ +  EQ    + ++       V   + L N      T+ +  F F
Sbjct: 471 TRIISEILNNIKSLKLYAWEQPYKAKLDY-------VRNEKELKNLVKIGITNTISVFQF 523

Query: 394 LIV------LAYGSHLVLQGSLSIG-DLTAFMLYTEYSGSAVFGLSNF--------YSEL 438
            +V        +G+ ++ Q   ++  DL        +   A+F L +F         +  
Sbjct: 524 SVVPFMVSCATFGTFVLTQKDKALSTDLI-------FPALALFNLLSFPLGFIPMAATSF 576

Query: 439 MKGAGAASRLFE-LTDHQPSIYATKGVPYVPGKGEIKFE---NVSFSYPTRSANQI-FNN 493
           ++ + +  RL   LT  +    A + +P V   G+I      + ++ +  +   ++   N
Sbjct: 577 IEASVSIKRLHSFLTSGEIQRDAIQHLPKVEEIGDISVNISGDATYLWQRQPEYKVALKN 636

Query: 494 LNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGV 553
           +NF    G   C+VG  G GKS +   +L       G  T+ G              +  
Sbjct: 637 INFQARKGELSCIVGKVGTGKSALIQAMLGDLFRVKGSATLHGS-------------VAY 683

Query: 554 VQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALL 613
           V Q   +M+G+I+DNI +G  Y     E     K C     +    DG +T +G +G  L
Sbjct: 684 VSQVSWIMNGTIKDNILFGYKYDAEFYE--KTIKACALSLDLNTLPDGDQTFVGERGISL 741

Query: 614 SGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTLGQ--LMKSRDITIISIA 670
           SGGQK R+A+ARA+  K ++  LD+  +A+D   S+  + Y +G   L+K++  T I   
Sbjct: 742 SGGQKARLALARAVYAKADVYFLDDPLAAVDEHVSKHLVKYVIGPTGLLKTK--TRILTT 799

Query: 671 HRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNE--KAKDTTSKMNAETV 728
           +++  +  ++++ +L D+G +V+ G + ++ ++K+S L+KL+    K K    + N +TV
Sbjct: 800 NKIHVLSVADSITLL-DNGVIVQQGSYDQVNSNKDSPLFKLIANFGKQKSQAIENNEDTV 858

Query: 729 EKNDPSPKTEKL 740
            +   S  +  L
Sbjct: 859 AEVKTSSSSSPL 870

>CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {ON}
            highly similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281w YOR1 ATP-binding cassette transporter protein
          Length = 1477

 Score =  151 bits (382), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 151/558 (27%), Positives = 258/558 (46%), Gaps = 78/558 (13%)

Query: 192  LGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKV 251
            +GLY F  VF G L ++    F  + ++ I+  K    L    +K+ +H    + D   +
Sbjct: 936  MGLYSFF-VFGGYLFMNI--QFTMLCMMGIMASKW---LNLKAVKRILHAPMSYLDTTPL 989

Query: 252  GDLISRLSSDAYVVSRSMTQNIS---DGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXX 308
            G +++R + D   +   +T+NI      F  II  GV +  + ++               
Sbjct: 990  GRILNRFTKDTDSLDNELTENIRLMMSQFANII--GVCVLCIVYLPWFAIAIPFLLLVFV 1047

Query: 309  XVGATIY--GRKIRSISRDLQQS--TGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAI 364
             +       GR+I+ +   +Q+S    NL +V    L G+ T++++ ++ + + + +  I
Sbjct: 1048 LIADHYQSAGREIKRLEA-IQRSFVYNNLIEV----LGGMDTIKAYKSQDRYMTKMDFLI 1102

Query: 365  RKVFDVGKREALTN---ATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYT 421
             K+ +V           A F    +V   F+ +I L   +        ++G L  ++L  
Sbjct: 1103 NKMNEVSYMVVSVQRWVAIFLDMIAVA--FALIISLLCVTRQFHISPSAVGVLLTYVL-- 1158

Query: 422  EYSGSAVFGLSNF----YSELMKGAGAASRLFELTDHQPSIYATKGVPY-----VPGKGE 472
                  + GL N      ++      +A RL       P   A +   Y      P  GE
Sbjct: 1159 -----QLPGLLNTVLRALTQTENDMNSAERLVTYATELPQEAAYRKSDYSPPDNWPTNGE 1213

Query: 473  IKFENVSFSY----PTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPT 528
            + FE+VSF+Y    PT     +  N+N +I  G  + + G +G GKSTI + L +    T
Sbjct: 1214 VIFEDVSFAYRPGLPT-----VLKNVNLSIAGGEKIGICGRTGAGKSTIMTALYRLNELT 1268

Query: 529  SGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDE------I 582
            SGRI IDG D  K+    LRR L ++ Q+P+L  G+IR N+    P+    D+      I
Sbjct: 1269 SGRIFIDGIDTFKLGLYDLRRKLSIIPQDPVLFRGTIRKNLD---PFNEFSDDSLWNSLI 1325

Query: 583  R--SVSK------------KCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALI 628
            R  ++ K            K   +N + KF    + ++   GA  S G++Q +A+ RAL+
Sbjct: 1326 RGGAIEKDDLEDIKHQKPDKNGSYNNMHKFH--LDQIVEEDGANFSLGERQVLALTRALV 1383

Query: 629  KKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDD 688
            ++  ILILDEATS++D E++G I   +    + +D TI+ IAHRL TI   + ++VL + 
Sbjct: 1384 RQSKILILDEATSSVDYETDGKIQTRIAT--EFQDCTILCIAHRLKTILNYDRILVL-EK 1440

Query: 689  GSVVEMGKFKELYASKES 706
            G V E  K + L+ +++S
Sbjct: 1441 GEVAEFDKPEILFNNEKS 1458

 Score =  100 bits (249), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 68/211 (32%), Positives = 113/211 (53%), Gaps = 20/211 (9%)

Query: 491 FNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRH 550
           F+NLNF I  G  + + GP G GKS++ + +  +   T+G + I+G             H
Sbjct: 617 FSNLNFEIKKGEFIMITGPIGTGKSSLLNAMAGFMPQTTGELDING-------------H 663

Query: 551 LGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKG 610
           + ++   P + + ++RDNI +G PY    ++ + V + C     I     G  T IG +G
Sbjct: 664 M-LLCGYPWIQNATVRDNIIFGSPYDR--EKYKEVIRVCSLQADIDILPAGDMTEIGERG 720

Query: 611 ALLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTLGQLMKSRDITIISI 669
             LSGGQK RI +AR++ K  +I + D+  SA+D    +  ++    Q ++S+  T I  
Sbjct: 721 ITLSGGQKARINLARSVYKNKDIYLFDDVLSAVDSRVGKHIMDECFLQTLQSK--TRILA 778

Query: 670 AHRLSTIRRSENVIVLGDDGSVVEMGKFKEL 700
            H+LS I +++ VIVL  +GS V++G  +EL
Sbjct: 779 THQLSLIEKADRVIVLSTNGS-VDIGTVEEL 808

>KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1650

 Score =  151 bits (381), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 135/555 (24%), Positives = 259/555 (46%), Gaps = 56/555 (10%)

Query: 197  FLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKVGDLIS 256
            +L+++ G  V     +  + ++  + G +   ++ + ++K  ++    FFD   +G +++
Sbjct: 1099 YLSIYLGIGVFQALCSSSKAIINFVAGIRASRKIFNLLLKNVLYAKLRFFDSTPIGRIMN 1158

Query: 257  RLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIYG 316
            R S D   + + +T  +   F ++I     I ++ +I+                 A  Y 
Sbjct: 1159 RFSKDIESIDQELTPYMEGAFGSLIQCVSTIIVIAYITPQFLIVAAIVMLLFYFVAYFYM 1218

Query: 317  RKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQK----EIKRYNHAIRKVFDVGK 372
               R + R    S   + +   E L G+ T+++F  E++     +K+ +   R  F +  
Sbjct: 1219 SGARELKRLESMSRSPIHQHFSETLVGITTIRAFSDERRFLVDNMKKIDDNNRPFFYLW- 1277

Query: 373  REALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQ--------GSLSIGDLTAFMLYTEYS 424
               + N        ++G    LIVLA GS ++L           +S+G         +++
Sbjct: 1278 ---VCNRWLSYRIELIGA---LIVLAAGSFILLNIKSIDSGLAGISLG------FAIQFT 1325

Query: 425  GSAVFGLSNFYSELMKGAGAASRLFELT--DHQPSIYATKGVPY-VPGKGEIKFENVSFS 481
              A++ +   YS +     +  RL E T  + +PS       P   P  G+I+ +++S  
Sbjct: 1326 DGALW-VVRLYSNVEMNMNSVERLKEYTTIEQEPSNVGALVPPCEWPQNGKIEVKDLSLR 1384

Query: 482  YPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISK 541
            Y      ++  N+ FT+DS   V +VG +G GKSTI + L ++ +P +G I ID  DI+ 
Sbjct: 1385 YAA-GLPKVIKNVTFTVDSKCKVGIVGRTGAGKSTIITALFRFLDPETGYIKIDDVDITT 1443

Query: 542  ISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTP----------------TIDEI--R 583
            I  K LR+ + ++ Q+P L +G+++ N+    PY                  + +E+   
Sbjct: 1444 IGLKRLRQSITIIPQDPTLFTGTLKTNLD---PYNEYSEAEIFEALKRVNLVSSEELGNP 1500

Query: 584  SVSKKCFCHNF-ITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSA 642
            S S     H+  + KF D  E  +   G+ LS GQ+Q I +AR+L++ P +++LDEAT++
Sbjct: 1501 STSDSTSVHSANMNKFLD-LENEVSEGGSNLSQGQRQLICLARSLLRCPKVILLDEATAS 1559

Query: 643  LDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYA 702
            +D  S+  I  T+ +  +  + TI++IAHRL +I   + ++V+ D G V E      L  
Sbjct: 1560 IDYNSDSKIQATIRE--EFSNSTILTIAHRLRSIIDYDKILVM-DAGEVKEYDHPYSLLL 1616

Query: 703  SKESKLYKLLNEKAK 717
            +++S  Y +  +  +
Sbjct: 1617 NRDSIFYHMCEDSGE 1631

 Score = 95.5 bits (236), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 86/338 (25%), Positives = 163/338 (48%), Gaps = 31/338 (9%)

Query: 375 ALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVF----- 429
           AL++  +F + S++   SF +      ++ +QG      LT  + +T  S  A+      
Sbjct: 609 ALSSLVWFITPSIVTSASFAV------YIYVQGQ----TLTTPVAFTALSLFALLRNPLD 658

Query: 430 GLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKFENVSFSYPTRSANQ 489
            LS+  S +++   +  R+ E  + + +    K       + ++  +N +F++     NQ
Sbjct: 659 MLSDMLSFVIQSKVSLDRVQEFLNEEET---KKYEQLTVSRNKLGLQNATFTWDKN--NQ 713

Query: 490 IFNNLNFTIDS--GSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI---TIDGQDISKISA 544
            F   N TID   G    +VGP+G GK+++   LL      +G++   +++ ++   + A
Sbjct: 714 DFKLKNLTIDFKIGKLNVIVGPTGSGKTSLLMGLLGEMELLNGKVFVPSLNPREELVVEA 773

Query: 545 KSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYET 604
             +   +    Q   L++ ++R+NI +  PY    +   +V   C         S G +T
Sbjct: 774 DGMTNSIAYCSQAAWLLNDTVRNNILFNAPYNE--NRYNAVISACGLKRDFEILSAGDQT 831

Query: 605 VIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI--NYTLGQLMKSR 662
            IG KG  LSGGQKQR+++AR+L      L+LD+  SA+D  +   I  N   G LM+ R
Sbjct: 832 EIGEKGITLSGGQKQRVSLARSLYSSSRHLLLDDCLSAVDSHTALWIYENCITGPLMEGR 891

Query: 663 DITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKEL 700
             T + ++H ++   ++ + +++ ++G V E G+  EL
Sbjct: 892 --TCVLVSHNVALTLKNADWVIIMENGRVKEQGEPVEL 927

>SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1653

 Score =  150 bits (378), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 137/553 (24%), Positives = 251/553 (45%), Gaps = 51/553 (9%)

Query: 197  FLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKVGDLIS 256
            +LA++    VL       + ++  I G     ++ + V+KK ++    FFD   +G +++
Sbjct: 1101 YLAIYFAIGVLHAVIASSKTIINFIAGLNASRKIFNLVLKKVLYAKLRFFDSTPIGRIMN 1160

Query: 257  RLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIYG 316
            R S D   V + +T  +   F +++     + ++ +I+               +    Y 
Sbjct: 1161 RFSKDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYITPGFLVVAIFIGFLYYLVGYFYM 1220

Query: 317  RKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQK----EIKRYNHAIRKVFDVGK 372
               R + R    S   + +   E L G+ T+++F  E++     +++ +   +  F +  
Sbjct: 1221 AGSRELKRFESVSRSPIHQHFSETLVGITTIRAFGDERRFMLENLQKIDENNKPFFYLW- 1279

Query: 373  REALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQ-----GSLSIGDLTAFMLYTEYSGSA 427
               + N        ++G     +V A G  ++L        L+   LT  + +TE     
Sbjct: 1280 ---VANRWLAFRIDMIGA---CVVFAAGVFILLNIKKLDSGLAGISLTYAISFTE----G 1329

Query: 428  VFGLSNFYSELMKGAGAASRLFE--LTDHQPSIYATKGVPY-VPGKGEIKFENVSFSYPT 484
               L   YS +     +  RL E  + + +PS       P   P +G+I+  ++S  Y T
Sbjct: 1330 ALWLVRLYSNVEMTMNSVERLKEYMVIEQEPSNDGAFNPPIEWPDQGKIEVNDLSLRYAT 1389

Query: 485  RSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISA 544
             +  ++  N++FT+D    V +VG +G GKSTI + L ++ +P +G I ID  DI+ I  
Sbjct: 1390 -NLPRVIKNVSFTVDPKCKVGIVGRTGAGKSTIITALFRFLDPETGHIKIDNVDITSIGL 1448

Query: 545  KSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDE--------IRSVSKKCFCH---- 592
            K LR+ + ++ Q+P L SG+++ N+    PY    DE        +  V+     H    
Sbjct: 1449 KRLRQSITIIPQDPTLFSGTVKSNLD---PYDEYTDEQIFKALKRVNLVTADELDHVPDS 1505

Query: 593  --------NFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALD 644
                      + KF D     I   GA LS GQ+Q + +AR+L++ P I++LDEAT+++D
Sbjct: 1506 ADNASVNSENVNKFLD-LRNEITEGGANLSQGQRQLVCLARSLLRSPKIILLDEATASID 1564

Query: 645  VESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASK 704
              S+  I  T+ +  +  D TI++IAHRL +I   + ++V+ D G V E      L  +K
Sbjct: 1565 YSSDAKIQQTIRE--EFGDSTILTIAHRLRSIIDYDKILVM-DAGEVREYDHPYSLLLNK 1621

Query: 705  ESKLYKLLNEKAK 717
             S  Y +  +  +
Sbjct: 1622 SSIFYSMCEDSGE 1634

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 89/328 (27%), Positives = 162/328 (49%), Gaps = 19/328 (5%)

Query: 375 ALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNF 434
           AL +  +F + S++   SF   + Y    VL   ++   L+ F L      + +  LS+ 
Sbjct: 602 ALMSLVWFITPSIVTSVSFAFYI-YVQGEVLTTPIAFTALSLFTLLR----NPLDQLSDM 656

Query: 435 YSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKFENVSFSYPTRSANQIFNNL 494
            S +++   +  R+ E  D + +    K       + +I FEN +F++  ++ +    NL
Sbjct: 657 LSFVIQSKVSLDRVQEFLDEEET---EKYNQLTISRNKIAFENATFAWDKKNPSFKLKNL 713

Query: 495 NFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI---TIDGQDISKISAKSLRRHL 551
           N     G    V+G +G GK+++   LL   +   G++   ++D ++   I +  +   +
Sbjct: 714 NVEFKLGKLNVVIGSTGSGKTSLLMGLLGEMDLIEGKVYVPSLDPREELVIESDGMTNSI 773

Query: 552 GVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGA 611
               Q   L++ ++R+NI +  PY  T    ++V + C         S G +T IG KG 
Sbjct: 774 AYCSQAAWLLNDTVRNNILFNSPYNET--RYKAVVEACGLKRDFEILSAGDQTEIGEKGI 831

Query: 612 LLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI--NYTLGQLMKSRDITIISI 669
            LSGGQKQR+++ARAL      ++LD+  SA+D  +   I  N   G LM+ R  T I +
Sbjct: 832 TLSGGQKQRVSLARALYSSSRHVLLDDCLSAVDSHTALWIYENCITGPLMQGR--TCILV 889

Query: 670 AHRLS-TIRRSENVIVLGDDGSVVEMGK 696
           +H ++ T++ +E V+VL D+G + + G+
Sbjct: 890 SHNVALTLKNAEWVVVL-DNGRIKDQGE 916

>NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10
          Length = 1491

 Score =  149 bits (377), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 144/550 (26%), Positives = 256/550 (46%), Gaps = 62/550 (11%)

Query: 192  LGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKV 251
            +GLY F  VFAG L  S+     +  LL  +G +    L    + + +H    + D   +
Sbjct: 952  MGLYSFF-VFAGYLFTSS-----QFTLLCAIGIRASKWLNLKAVHRILHTPMSYLDTTPL 1005

Query: 252  GDLISRLSSDAYVVSRSMTQNISDG-FKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXV 310
            G +++R + D   +   +T++I    F+     GV +  + ++                +
Sbjct: 1006 GRILNRFTKDTDSLDNELTESIRLMLFQTANIVGVCVMCIIYLP-----WFAIAIPFLFI 1060

Query: 311  GATIYGRKIRSISRDLQQ----STGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRK 366
            G T+     +S  R++++        +     E L G+ T++S+ +E++ + + ++ I K
Sbjct: 1061 GFTLITDHYQSTGREVKRLEAIQRSFVYNNFNEILGGMDTIKSYGSEERFLAKSDYLINK 1120

Query: 367  VFDVGKREALTN---ATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEY 423
            + + G          A F    +V   F+ +I L   +      ++S+G L  ++L  + 
Sbjct: 1121 MNEAGYLSVALQRWVAIFLDLVAVC--FALIITLLCVTRAFHISAVSVGVLLTYVL--QL 1176

Query: 424  SGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYV------PGKGEIKFEN 477
             G  + G+    ++      +A RL       P + A    P V      P +G+I+F++
Sbjct: 1177 PG-LLNGVLRALTQTENDMNSAERLVSYATELP-LEAAYRRPEVSPPENWPSEGKIEFKH 1234

Query: 478  VSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQ 537
            V FSY       +  +L+  I SG  + + G +G GKSTI S L +    + G I ID  
Sbjct: 1235 VDFSYRP-GLPIVLKDLDLDIKSGEKIGICGRTGAGKSTIMSALYRLNEISQGEILIDNV 1293

Query: 538  DISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVS----------- 586
            DISK+    LRR L ++ Q+P+L  G+IR N+    P+    D++   S           
Sbjct: 1294 DISKLGLYDLRRKLAIIPQDPVLFRGTIRKNLD---PFNEHDDDLLWDSLVRGGAIERAA 1350

Query: 587  ---------KKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILD 637
                      K   H  + KF    + ++  +GA  S G++Q +A+ RAL+++  +LILD
Sbjct: 1351 LNKIKNQKVDKDGTHADMFKFH--LDQLVEEEGANFSLGERQLLALTRALVRQAKVLILD 1408

Query: 638  EATSALDVESEGAINYTLGQLMKSR-DITIISIAHRLSTIRRSENVIVLGDDGSVVEMGK 696
            EATS++D E++G I     +++K   D TI+ IAHRL+TI   + ++VL + G V E  K
Sbjct: 1409 EATSSVDYETDGKIQ---ARIVKEFGDCTILCIAHRLNTILNYDRILVL-EKGEVAEFEK 1464

Query: 697  FKELYASKES 706
             K L+  ++S
Sbjct: 1465 PKVLFDQEDS 1474

 Score = 97.1 bits (240), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 72/235 (30%), Positives = 120/235 (51%), Gaps = 22/235 (9%)

Query: 491 FNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRH 550
           F+++   I  G  + +VGP G GK++  + L  + N T GRI ++G D+           
Sbjct: 627 FHDITLDIKKGEFIIMVGPIGTGKTSFLNALAGFMNKTEGRIQVNG-DL----------- 674

Query: 551 LGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKG 610
             ++   P + + ++RDNI +G PY     +   V + C     +     G  T IG +G
Sbjct: 675 --LLCGYPWIQNATVRDNILFGSPYDKK--KYEEVLRCCSLEADLDILPAGDSTEIGERG 730

Query: 611 ALLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTLGQLMKSRDITIISI 669
             LSGGQK RI +AR + KK +I + D+  SA+D    +  ++     L+K+   T I  
Sbjct: 731 ITLSGGQKARINLARCVYKKKDIYLFDDVLSAVDSRVGKHIMDECFLGLLKNE--TRILA 788

Query: 670 AHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLL--NEKAKDTTSK 722
            H+LS + R+  VIVLG DGS  E+G    L  + ++ +  LL  N+++K+  ++
Sbjct: 789 THQLSLLERASRVIVLGTDGS-FEIGPVDVLKRTNQTLINLLLFSNQESKEEDTE 842

>Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR281W
            (REAL)
          Length = 1477

 Score =  149 bits (375), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 146/565 (25%), Positives = 262/565 (46%), Gaps = 73/565 (12%)

Query: 182  LRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQ 241
             ++ PP  + +GLY F  VFA  + ++     G+  +L ++G      L    +K+ +H 
Sbjct: 926  FKNRPPSFY-MGLYSFF-VFAAFIFMN-----GQYTILCVMGIMASKWLNLKAVKRILHT 978

Query: 242  DAEFFDRNKVGDLISRLSSDAYVVSRSMTQNI---SDGFKAIICGGVGIGMMFHISSXXX 298
               + D   +G +++R + D   +   +T+++   +  F  I+  GV +  + ++     
Sbjct: 979  PMSYIDTTPLGRILNRFTKDTDSLDNELTESLRLLTSQFANIV--GVCVMCIVYLPWFAI 1036

Query: 299  XXXXXXXXXXXVGATIY--GRKIRSISRDLQQS--TGNLTKVAEEQLSGVKTVQSFVAEQ 354
                       +       GR+I+ +   +Q+S    NL +V    L G+ T++++ +++
Sbjct: 1037 AIPFLLVIFVLIADHYQSSGREIKRLEA-VQRSFVYNNLNEV----LGGMDTIKAYRSQE 1091

Query: 355  KEIKRYNHAIRKVFDVGKREALTN---ATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSI 411
            + + + +  I K+ + G    +       F    +++  F+ ++ L   +      + S+
Sbjct: 1092 RFLAKSDFLINKMNEAGYLVVVLQRWVGVFLDMVAIV--FALIVTLLCVTRAFPISAASV 1149

Query: 412  GDLTAFMLYTEYSGSAVFGLSNFYSELM----KGAGAASRLFELTDHQPSIYATKGVPYV 467
            G L  ++L        + GL N     M        +A RL       P + A    P +
Sbjct: 1150 GVLLTYVL-------QLPGLLNTILRAMTQTENDMNSAERLVSYATELP-LEADYRKPEM 1201

Query: 468  ------PGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLL 521
                  P KGEI  ENV FSY       +  NLN  I+SG  + + G +G GKSTI S L
Sbjct: 1202 TPPESWPSKGEIVLENVCFSY-RPGLPVVLKNLNLNIESGEKIGICGRTGAGKSTIMSAL 1260

Query: 522  LKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDE 581
             +    ++G+I ID  DISK+    LRR L ++ Q+P+L  G+IR N+    P+    D+
Sbjct: 1261 YRLNELSAGKILIDDVDISKLGLFDLRRKLAIIPQDPVLFRGTIRKNLD---PFDERTDD 1317

Query: 582  ------IR--SVSK------------KCFCHNFITKFSDGYETVIGPKGALLSGGQKQRI 621
                  +R  +++K            K   H  + KF    +  +  +G+  S G++Q +
Sbjct: 1318 ELWDALVRGGAIAKNDLSEAKLQKPDKNGTHGRMHKFH--LDQAVEEEGSNFSLGERQLL 1375

Query: 622  AIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSEN 681
            A+ RAL+++  ILILDEATS++D E++G I   + +  +  D TI+ IAHRL TI   + 
Sbjct: 1376 ALTRALVRQSKILILDEATSSVDYETDGKIQARIVE--EFGDCTILCIAHRLQTIVNYDR 1433

Query: 682  VIVLGDDGSVVEMGKFKELYASKES 706
            ++VL + G V E      L+  + S
Sbjct: 1434 ILVL-EKGEVAEFDTPWTLFTQENS 1457

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 71/233 (30%), Positives = 119/233 (51%), Gaps = 21/233 (9%)

Query: 491 FNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRH 550
           F +LNF I  G  + + GP G GKS++ + +      T G+I ++G D+           
Sbjct: 604 FKDLNFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKIEVNG-DL----------- 651

Query: 551 LGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKG 610
             ++   P + +  +RDNI +G P+    ++   V + C     +     G  T IG +G
Sbjct: 652 --LMCGYPWIQNAPVRDNIIFGSPFIK--EKYNEVIRVCSLKADLDILPAGDMTEIGERG 707

Query: 611 ALLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTLGQLMKSRDITIISI 669
             LSGGQK RI +AR++ K+  I + D+  SA+D    +  ++  L  ++ ++  T I  
Sbjct: 708 ITLSGGQKARINLARSVYKRKEIYLFDDVLSAVDSRVGKHIMDECLTGMLANK--TRILA 765

Query: 670 AHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKDTTSK 722
            H+LS I R+  VIVLG DG  V++G   EL A  ++ L KLL   ++++  +
Sbjct: 766 THQLSLIERASRVIVLGTDGQ-VDIGTVDELKARNQT-LIKLLQFSSQNSKEE 816

>YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}
            YBT1Transporter of the ATP-binding cassette (ABC) family
            involved in bile acid transport; similar to mammalian
            bile transporters
          Length = 1661

 Score =  147 bits (372), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 136/537 (25%), Positives = 238/537 (44%), Gaps = 62/537 (11%)

Query: 214  GRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNI 273
            G+ +L  + G     ++ + ++ K +H    FFD    G +++R S D   + + +T  I
Sbjct: 1121 GKTILNFVAGINASRKIFNMILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYI 1180

Query: 274  SDGFKAII-CGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGN 332
               F ++I C    I + F                  VG   Y    R + R    S   
Sbjct: 1181 QGAFYSLIECLSTVILITFITPQFLSVAIVVSILYYFVGY-FYMAGSRELKRFESISRSP 1239

Query: 333  LTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFS 392
            + +   E L GV T+++F  E + ++   H I +           N  FF         +
Sbjct: 1240 IYQHFSETLVGVTTIRAFGDEGRFMQENLHKIDE----------NNKPFFYLWVANRWLA 1289

Query: 393  FLI-----VLAYGSHLVLQGSLSIGD-------LTAFMLYTEYSGSAVFGLSNFYSELMK 440
            F I     ++ +G+ L +  +++  D       LT  + +TE        L   YSE+  
Sbjct: 1290 FRIDMIGSLVIFGAGLFILFNINNLDSGMAGISLTYAISFTE----GALWLVRLYSEVEM 1345

Query: 441  GAGAASRLFELTDHQPSIYATKG---VPYVPGKGEIKFENVSFSYPTRSANQIFNNLNFT 497
               +  R+ E  + +   Y        P  P  G+I+  ++S  Y   +  ++  N++F+
Sbjct: 1346 NMNSVERVKEYMEIEQEPYNEHKEIPPPQWPQDGKIEVNDLSLRYAP-NLPRVIKNVSFS 1404

Query: 498  IDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQE 557
            +D+ S + +VG +G GKSTI + L ++  P +G I ID  DIS +  + LRR + ++ Q+
Sbjct: 1405 VDAQSKIGIVGRTGAGKSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQD 1464

Query: 558  PILMSGSIRDNITYGVPYTPTIDE---------------------IRSVSKKCFCHNF-- 594
            P L SG+I+ N+    PY    D                       R  S +    N   
Sbjct: 1465 PTLFSGTIKTNLD---PYDEFSDRQIFEALKRVNLISEEQLQQGATRETSNEASSTNSEN 1521

Query: 595  ITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYT 654
            + KF D   + I   G+ LS GQ+Q + +AR+L++ P I++LDEAT+++D  S+  I  T
Sbjct: 1522 VNKFLD-LSSEISEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQET 1580

Query: 655  LGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKL 711
            + +  +    TI++IAHRL ++   + ++V+ D G V E      L  +K+S  Y +
Sbjct: 1581 IRKEFQGS--TILTIAHRLRSVIDYDKILVM-DAGEVKEYDHPYSLLLNKQSAFYSM 1634

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 112/233 (48%), Gaps = 9/233 (3%)

Query: 468 PGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNP 527
           P      FEN + S+   + +    +LN    +G    V+GP+G GK+++   LL     
Sbjct: 689 PNGNRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 528 TSGRITIDGQDISK---ISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRS 584
            +G++ +   +  +   + A      +    Q   L++ ++++NI +  P+       ++
Sbjct: 749 LNGKVVVPALEPRQELIVDANGTTNSIAYCSQAAWLLNDTVKNNILFNSPFNEA--RYKA 806

Query: 585 VSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALD 644
           V + C           G  T IG KG  LSGGQKQR+++ARAL      ++LD+  SA+D
Sbjct: 807 VVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAVD 866

Query: 645 VESEGAI--NYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMG 695
             +   I  N   G LM+ R  T I ++H ++   R+  ++VL +DG V + G
Sbjct: 867 SHTASWIYDNCITGPLMEDR--TCILVSHNIALTLRNAELVVLLEDGRVKDQG 917

>CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1659

 Score =  147 bits (372), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 144/576 (25%), Positives = 252/576 (43%), Gaps = 66/576 (11%)

Query: 194  LYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKVGD 253
            LY     FA  +  + FA   + V+  + G     R+   ++ K +H    F D   +G 
Sbjct: 1107 LYYLSIYFAIGITQALFAG-TKTVINFVAGINASRRIFKKLLSKVLHSRLRFIDSTPIGR 1165

Query: 254  LISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGAT 313
            +++R S D   V + +T  +   F  ++     I ++  I+               +   
Sbjct: 1166 IMNRFSKDIEAVDQELTPFLEAAFFCLVQCISTIILITFITPQFLFVAVLVCVLYYLVGY 1225

Query: 314  IYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKR 373
             Y    R + R    +   + +   E L+GV T+++F     EI+   H + K+ +    
Sbjct: 1226 FYINTSRELKRIESITKSPIYQHFSETLTGVATIRAF---GDEIRFIMHNLEKIDE---- 1278

Query: 374  EALTNATFFSSTSVLGDFSFLI-----VLAYGSHLVLQGSLSIGD-------LTAFMLYT 421
                N  FF         +F I     ++ +GS + +  +L+  D       LT  + +T
Sbjct: 1279 ---NNKPFFYLWVANRWLAFRIDMIGALIIFGSGVFILLNLNRIDSGMAGISLTYAISFT 1335

Query: 422  EYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPY---VPGKGEIKFENV 478
            E        L  FYS +     +  RL E  D     Y    +      P +G+I+ +++
Sbjct: 1336 E----GALWLVRFYSTVEMNMNSVERLKEYMDVPQEPYNEGTITTSTNWPTEGKIEVKDL 1391

Query: 479  SFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQD 538
            S  Y   +  ++   ++F I+  + V +VG +G GKSTI + L ++  P +G I IDG D
Sbjct: 1392 SLRY-AENLPRVIKEVSFDIEPHNMVGIVGRTGAGKSTIITALFRFLEPETGSIKIDGID 1450

Query: 539  ISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDE--IRSVSKKCFCHN--- 593
            I+ I  ++LRR + ++ Q+P L +G+IR N+    P+    DE   R + +     +   
Sbjct: 1451 ITSIDLQTLRRSITIIPQDPTLFTGTIRSNLD---PFGKYPDEEIFRVLHRVNLIDDDEM 1507

Query: 594  -------------FITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEAT 640
                          + KF +  E  I   G  LS GQKQ + +ARAL++ P +++LDEAT
Sbjct: 1508 TAQSSDNNSLSSDNVNKFLN-LENEITEGGNNLSQGQKQLMCLARALLRNPKVILLDEAT 1566

Query: 641  SALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKEL 700
            +++D  S+  I  T+  +      T+++IAHRL ++   + ++V+ D G V+E  +   L
Sbjct: 1567 ASIDYASDAKIQQTIRNVFDKS--TVLTIAHRLRSVIDYDKILVM-DAGEVIEYDQPYTL 1623

Query: 701  YASKESKLYK----------LLNEKAKDTTSKMNAE 726
               K S  Y           L++   K    KMNAE
Sbjct: 1624 LLDKNSHFYSMCEQSGELETLIDLAKKAFVKKMNAE 1659

 Score =  107 bits (266), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 91/366 (24%), Positives = 164/366 (44%), Gaps = 19/366 (5%)

Query: 339 EQLSGVKTVQSFVAEQK---EIKRYNHA-IRKVFDVGKREALTNATFFSSTSVLGDFSFL 394
           E L  ++ ++ F  E     EI     A I+   +     A +   +F + +++   SF 
Sbjct: 581 EALQAIRIIKFFSWEDNFFSEIDEIREAEIQMYINKAYAWAFSAFIWFLTPTIVTGASFT 640

Query: 395 IVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDH 454
           + + Y    VL   ++   L  F L  +     +  LSN  S +++   +  R+    D 
Sbjct: 641 VYI-YVQKQVLTAPVAFTALALFQLLKQ----PLDQLSNMLSYVIQSKVSLDRVQNFLDE 695

Query: 455 QPSIYATKGVPYVPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGK 514
           + +      +   P   ++ FEN + ++   + +    +L+     G    V+GP+G GK
Sbjct: 696 EDT-QKYNQLKVAPDGNKLAFENATIAWSNNNQDFKLKDLDINFKIGKLNVVIGPTGSGK 754

Query: 515 STIASLLLKYYNPTSGRITI---DGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITY 571
           +++   LL      SGRI +   D +    I +  +   +    Q   L++ ++R+NI +
Sbjct: 755 TSLLLALLGEMQLLSGRIVVPSLDARHEMLIDSDGMTNSIAYCSQSAWLLNDTVRNNILF 814

Query: 572 GVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKP 631
             PY    D  + V   C        F  G +T IG KG  LSGGQKQRI++ARAL    
Sbjct: 815 YSPYNE--DRYKEVIIACGLKRDFELFDAGDQTEIGEKGITLSGGQKQRISLARALYSNC 872

Query: 632 NILILDEATSALDVESEGAI--NYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDG 689
             L+LD+  SA+D  +   I  N   G LM+ R  T + ++H ++   ++  ++V+ ++G
Sbjct: 873 RHLLLDDCLSAVDSHTAAWIYDNCITGPLMEGR--TCVLVSHNIALTLKNAELVVMLENG 930

Query: 690 SVVEMG 695
            +   G
Sbjct: 931 RITNRG 936

>NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {ON} 
          Length = 1654

 Score =  147 bits (370), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 142/547 (25%), Positives = 244/547 (44%), Gaps = 51/547 (9%)

Query: 192  LGLYDFLAVFAGALV--LSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRN 249
            L +Y FL   A AL+  L    NF        LG K   ++  +++KK +H    FFD  
Sbjct: 1109 LSIY-FLIGIAQALLGSLKVLINF-------FLGVKASRKIFIDLLKKVMHSKLRFFDST 1160

Query: 250  KVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXX 309
             +G +++R S D   + + +   +   F +++     I ++  I+               
Sbjct: 1161 PIGRIMNRFSKDIEAIDQELAPVVQGAFYSLVSCVTTILLITFITPQFLSVAILVTGLYY 1220

Query: 310  VGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAE----QKEIKRYNHAIR 365
            +    Y    R   R    +   + +   E L GV T+++F  E    Q+ + + +   R
Sbjct: 1221 LIGYFYLAASREFKRFDSITKSPIYQHFSETLVGVTTIRAFGDEGRFMQENLSKIDENNR 1280

Query: 366  KVF--DVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEY 423
              F   V  R          +  V G  SF+I   +    +  G   I  LT  + +TE 
Sbjct: 1281 PFFYLWVANRWLSFRIDMVGALVVFGSGSFII---WNIKNIDAGMAGIS-LTYAISFTE- 1335

Query: 424  SGSAVFGLSNFYSELMKGAGAASRLFELT--DHQPSIYAT-KGVPYVPGKGEIKFENVSF 480
                   L   YS +     +  RL E    + +P   AT    P  P +G+I+  ++S 
Sbjct: 1336 ---GALWLVRLYSNVEMNMNSVERLKEYMKIEQEPYEDATCTPPPEWPQEGKIEVCDLSL 1392

Query: 481  SYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDIS 540
             Y      ++  N+ FT+   + + +VG +G GKSTI + L ++ +P +G I ID  DI+
Sbjct: 1393 RY-AEGLPRVIKNVTFTVAPKAKIGIVGRTGAGKSTIITALFRFLDPETGYIKIDNIDIT 1451

Query: 541  KISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDE-----IRSVS--------- 586
             I+   LRR + ++ Q+P L +G+I+ N+    PY    DE     +R V+         
Sbjct: 1452 SINLNKLRRSINIIPQDPTLFTGTIKSNLD---PYGEYSDEDMFTALRRVNLVPEDVSSN 1508

Query: 587  --KKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALD 644
               +      + KF +     I   G+ LS GQ+Q + +AR+L++ P I++LDEAT+++D
Sbjct: 1509 IETESISSQNVNKFLN-LNNEISEGGSNLSQGQRQLVCLARSLLRSPKIMLLDEATASID 1567

Query: 645  VESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASK 704
              S+  I  T+ +   S   TI++IAHRL ++   + ++V+ D G V E      L  +K
Sbjct: 1568 YNSDAKIQETIRKEFNSS--TILTIAHRLRSVIDYDKILVM-DAGEVKEYDHPYSLLLNK 1624

Query: 705  ESKLYKL 711
            +S  Y +
Sbjct: 1625 KSIFYNM 1631

 Score = 95.1 bits (235), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 79/287 (27%), Positives = 139/287 (48%), Gaps = 21/287 (7%)

Query: 468 PGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNP 527
           P   +++F+N + S+ + + +    +LN     G    V+GP+G GK+++   LL     
Sbjct: 704 PQGDQLEFKNTTVSWDSSAQDFKLKDLNIDFKIGKLNVVIGPTGSGKTSLLMALLGEMKI 763

Query: 528 TSGRI---TIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIR- 583
             G I   ++D ++   +        +    Q   L++ ++R+NI +  PY    +E R 
Sbjct: 764 MEGEIIVPSLDPREDLVVDENGTTNSIAYCSQAAWLLNDTVRNNILFNSPY----NEARY 819

Query: 584 -SVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSA 642
            SV + C           G  T IG KG  LSGGQKQR+++ARA+      ++LD+  SA
Sbjct: 820 TSVIEACGLKRDFEILKAGDMTEIGEKGITLSGGQKQRVSLARAMYSNSRHILLDDCLSA 879

Query: 643 LDVESEGAI--NYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKEL 700
           +D  +   I  N   G LM  R  T I ++H ++   ++ +++V+ +DG V + G   EL
Sbjct: 880 VDSHTALWIYDNCITGPLMDGR--TCILVSHNIALTLKNADLVVILEDGKVKDQGDPMEL 937

Query: 701 YAS---KESKLYK--LLNEKAK--DTTSKMNAETVEKN-DPSPKTEK 739
                  E +L K  +L+  A   +  S+ +  T++ +  P P+T K
Sbjct: 938 LQKGLLGEDELVKSSILSRHASSVNLNSQKSTTTLQASKHPKPETSK 984

>YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Plasma
            membrane ATP-binding cassette (ABC) transporter,
            multidrug transporter mediates export of many different
            organic anions including oligomycin; similar to human
            cystic fibrosis transmembrane receptor (CFTR)
          Length = 1477

 Score =  146 bits (368), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 145/565 (25%), Positives = 261/565 (46%), Gaps = 73/565 (12%)

Query: 182  LRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQ 241
             ++ PP  + +GLY F  VFA  + ++     G+  +L  +G      L    +K+ +H 
Sbjct: 926  FKNRPPSFY-MGLYSFF-VFAAFIFMN-----GQFTILCAMGIMASKWLNLRAVKRILHT 978

Query: 242  DAEFFDRNKVGDLISRLSSDAYVVSRSMTQNI---SDGFKAIICGGVGIGMMFHISSXXX 298
               + D   +G +++R + D   +   +T+++   +  F  I+  GV +  + ++     
Sbjct: 979  PMSYIDTTPLGRILNRFTKDTDSLDNELTESLRLMTSQFANIV--GVCVMCIVYLPWFAI 1036

Query: 299  XXXXXXXXXXXVGATIY--GRKIRSISRDLQQS--TGNLTKVAEEQLSGVKTVQSFVAEQ 354
                       +       GR+I+ +   +Q+S    NL +V    L G+ T++++ +++
Sbjct: 1037 AIPFLLVIFVLIADHYQSSGREIKRLEA-VQRSFVYNNLNEV----LGGMDTIKAYRSQE 1091

Query: 355  KEIKRYNHAIRKVFDVGKREALTN---ATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSI 411
            + + + +  I K+ + G    +       F    ++   F+ +I L   +      + S+
Sbjct: 1092 RFLAKSDFLINKMNEAGYLVVVLQRWVGIFLDMVAIA--FALIITLLCVTRAFPISAASV 1149

Query: 412  GDLTAFMLYTEYSGSAVFGLSNFYSELM----KGAGAASRLFELTDHQPSIYATKGVPYV 467
            G L  ++L        + GL N     M        +A RL       P + A+   P +
Sbjct: 1150 GVLLTYVL-------QLPGLLNTILRAMTQTENDMNSAERLVTYATELP-LEASYRKPEM 1201

Query: 468  ------PGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLL 521
                  P  GEI FENV F+Y       +  NLN  I SG  + + G +G GKSTI S L
Sbjct: 1202 TPPESWPSMGEIIFENVDFAY-RPGLPIVLKNLNLNIKSGEKIGICGRTGAGKSTIMSAL 1260

Query: 522  LKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDE 581
             +    T+G+I ID  DIS++    LRR L ++ Q+P+L  G+IR N+    P+    D+
Sbjct: 1261 YRLNELTAGKILIDNVDISQLGLFDLRRKLAIIPQDPVLFRGTIRKNLD---PFNERTDD 1317

Query: 582  ------IR--SVSKKCF------------CHNFITKFSDGYETVIGPKGALLSGGQKQRI 621
                  +R  +++K                H  + KF    +  +  +G+  S G++Q +
Sbjct: 1318 ELWDALVRGGAIAKDDLPEVKLQKPDENGTHGKMHKFH--LDQAVEEEGSNFSLGERQLL 1375

Query: 622  AIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSEN 681
            A+ RAL+++  ILILDEATS++D E++G I   + +  +  D TI+ IAHRL TI   + 
Sbjct: 1376 ALTRALVRQSKILILDEATSSVDYETDGKIQTRIVE--EFGDCTILCIAHRLKTIVNYDR 1433

Query: 682  VIVLGDDGSVVEMGKFKELYASKES 706
            ++VL + G V E      L++ ++S
Sbjct: 1434 ILVL-EKGEVAEFDTPWTLFSQEDS 1457

 Score = 97.8 bits (242), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 68/217 (31%), Positives = 112/217 (51%), Gaps = 20/217 (9%)

Query: 491 FNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRH 550
           F +LNF I  G  + + GP G GKS++ + +      T G++ ++G D+           
Sbjct: 604 FKDLNFDIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKVEVNG-DL----------- 651

Query: 551 LGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKG 610
             ++   P + + S+RDNI +G P+    ++   V + C     +     G  T IG +G
Sbjct: 652 --LMCGYPWIQNASVRDNIIFGSPFNK--EKYDEVVRVCSLKADLDILPAGDMTEIGERG 707

Query: 611 ALLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTLGQLMKSRDITIISI 669
             LSGGQK RI +AR++ KK +I + D+  SA+D    +  ++  L  ++ ++  T I  
Sbjct: 708 ITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLANK--TRILA 765

Query: 670 AHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKES 706
            H+LS I R+  VIVLG DG  V++G   EL A  ++
Sbjct: 766 THQLSLIERASRVIVLGTDGQ-VDIGTVDELKARNQT 801

>KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1649

 Score =  146 bits (368), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 129/523 (24%), Positives = 235/523 (44%), Gaps = 64/523 (12%)

Query: 234  VIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHI 293
            ++KK ++    FFD   +G +++R S D   V + +T  +   F +++     + ++ +I
Sbjct: 1133 ILKKVLYAKLRFFDSTPIGRIMNRFSRDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYI 1192

Query: 294  SSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAE 353
            +               +    Y    R + R    S   + +   E L G+ T+++F  E
Sbjct: 1193 TPDFFFVAIFIGIFYYLVGYFYMAGSRELKRYESISRSPIHQHFSETLVGITTIRAFGDE 1252

Query: 354  ----QKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQ-GS 408
                Q+ + + +   +  F +     + N        ++G     ++ A G  ++L   S
Sbjct: 1253 RRFMQENLTKIDENNKPFFYLW----VANRWLAFRIDMIGA---CVIFAAGIFVLLNIKS 1305

Query: 409  LSIG----DLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFEL--TDHQPSIYATK 462
            L  G     LT  + +TE        L   YS +     +  RL E    + +P   +T 
Sbjct: 1306 LDSGLAGISLTYAISFTE----GALWLVRLYSNVEMTMNSVERLKEYMEVEQEPHYQSTH 1361

Query: 463  GVP-YVPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLL 521
              P   P +G+I+  ++S  Y   S  ++  N+ FT+D    V +VG +G GKSTI + L
Sbjct: 1362 NPPPEWPSQGKIEVNDLSLRYAP-SLPKVIKNVTFTVDPNCKVGIVGRTGAGKSTIITAL 1420

Query: 522  LKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPY------ 575
             ++ +P SG I ID  DI+ +  K LR+ + ++ Q+P L +G+++ N+    PY      
Sbjct: 1421 FRFLDPESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFTGTVKSNLD---PYDEYSDK 1477

Query: 576  ---------------------TPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLS 614
                                  P+ D   +VS+       + KF    E  I   G+ LS
Sbjct: 1478 QIFEALKRVNLVTQEELDHAANPSPDNASAVSEN------VNKFL-FLENEISEGGSNLS 1530

Query: 615  GGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLS 674
             GQ+Q + +AR+L++ P +++LDEAT+++D +S+  I  T+    +  D TI++IAHRL 
Sbjct: 1531 QGQRQLVCLARSLLRSPKVMLLDEATASIDYQSDARIQQTIRS--EFSDSTILTIAHRLR 1588

Query: 675  TIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAK 717
            +I   + ++V+ D G V E      L  +K S  Y +  +  +
Sbjct: 1589 SIIDYDKILVM-DAGEVKEYDHPYSLLLNKNSIFYSMCEDSGE 1630

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 68/237 (28%), Positives = 119/237 (50%), Gaps = 9/237 (3%)

Query: 470 KGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTS 529
           + +I FEN +FS+  ++ +    N+N     G    V+GP+G GK+++   LL   +   
Sbjct: 686 RNKIGFENATFSWDRKNPDFKLKNMNIDFKLGKLNVVIGPTGSGKTSLLMGLLGEMDLLE 745

Query: 530 GRI---TIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVS 586
           G++    +D ++   I    +   +    Q   L++ ++++NI +  P+        +V 
Sbjct: 746 GKVYAPCLDPREDMVIENDGMTNSIAYCSQAAWLLNDTVKNNILFSSPFNE--GRYNAVI 803

Query: 587 KKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVE 646
           + C         S G +T IG KG  LSGGQKQR+++ARAL      L+LD+  SA+D  
Sbjct: 804 EACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHLLLDDCLSAVDSH 863

Query: 647 SEGAI--NYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELY 701
           +   I  N   G LM+ R  T I ++H ++   ++   +V  ++G V + G+  ELY
Sbjct: 864 TALWIYENCISGPLMEGR--TCILVSHNVALTLKNAEWVVFMENGRVKDQGEPLELY 918

>Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL015W
            (BPT1) - ABC-type transmembrane transporter; highly
            homologous to human MRP1 and to C. elegans mrp-1 [contig
            184] FULL
          Length = 1538

 Score =  145 bits (366), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 143/555 (25%), Positives = 245/555 (44%), Gaps = 52/555 (9%)

Query: 188  VVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFD 247
            V++ +G+Y F+++ A  L     +N   +VLL +   K   +L   +    I     FF+
Sbjct: 1004 VLFYVGIYVFISLSAALL-----SNARTIVLLLVCSIKASRKLHDTMALAVIRSPMSFFE 1058

Query: 248  RNKVGDLISRLSSDA--------YVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXX 299
               VG +I+R SSD         YV+S  +  +I D    +I  G  + +   +++    
Sbjct: 1059 TTPVGRIINRFSSDMNSLDDSVQYVMSFFLV-SILDYLVVVIIIGYQVPLFLIVNAVLLV 1117

Query: 300  XXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQK---- 355
                           Y    R + R +  S   +  +  E L+G   + +F    +    
Sbjct: 1118 IYFYYQ-------VYYVTLSRELKRLMSTSFSPIMSMLSETLAGHMIIDAFRHSDRFDYL 1170

Query: 356  EIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAY--GSHLVLQGSLSIGD 413
             ++     I  +F+        +    S  +++   + L+ LA   G H     +LS G 
Sbjct: 1171 NVENVQFNINCLFNFRSTNRWLSIRLESIGALMILTTALLSLATKNGGH-----ALSTGM 1225

Query: 414  LTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPS----IYATKGVPYVPG 469
            +   M Y     + +  +     +L     +  R+ E  D  P     I  ++     P 
Sbjct: 1226 VGLLMSYALQVTNKLMWIVRMSVQLETNIVSVERIVEYCDLPPEAPPVIEDSRPPKNWPS 1285

Query: 470  KGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTS 529
            +G I+F+N S  Y   + + +  +L+  I     + +VG +G GKST++  L +   P+ 
Sbjct: 1286 QGLIRFKNYSTRYRA-NLDPVLRHLDLEIKPQEKIGIVGRTGAGKSTLSLALFRILEPSE 1344

Query: 530  GRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKC 589
            G I IDG DISKI  K LR +L ++ Q+     G++R N+     Y+   +EI    +  
Sbjct: 1345 GTIDIDGVDISKIGLKDLRSNLSIIPQDAQAFEGTVRTNLDPFEQYSD--EEIWKALELS 1402

Query: 590  FCHNFITKFS----------DGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEA 639
                 I K +          D  +T I   G+ LS GQ+Q + ++RAL+ +  IL+LDEA
Sbjct: 1403 HLKPHILKMAKDDADPEKKEDLLQTKISENGSNLSVGQRQLLCLSRALLNRSRILVLDEA 1462

Query: 640  TSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKE 699
            T+A+D E++  I  T+    K R  TI++IAHR+ T+  S+ ++VL D G V E      
Sbjct: 1463 TAAVDSETDRLIQETIRAEFKDR--TILTIAHRIDTVMDSDKIMVL-DKGEVKEFDSPSN 1519

Query: 700  LYASKESKLYKLLNE 714
            L A K+S  Y L ++
Sbjct: 1520 LLAQKDSIFYNLCDQ 1534

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 111/450 (24%), Positives = 200/450 (44%), Gaps = 46/450 (10%)

Query: 316 GRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDV---GK 372
            RK++++ +          K   E L+ VKTV+ +  E+  +KR +H +R   ++    K
Sbjct: 449 SRKVKTLIQQQMTYKDARIKTITELLNSVKTVKLYAWEEPMLKRLDH-VRNDLELQNFKK 507

Query: 373 REALTNATFFSSTSV--LGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFG 430
              +TN   F+   V  L   S  ++ A    + L   +    L+ F +  +   +    
Sbjct: 508 ISIITNLILFAWNCVPILVASSTFLIYALTMDVPLTPQIVFPSLSLFDILNDCIYTIPRT 567

Query: 431 LSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKFENVSF---------- 480
           ++NF  E     G         +   S    + +P       I+  N +F          
Sbjct: 568 ITNFI-ETGVSLGRLKDFLLAKEIDKSFIEFESLPSDGKVPVIEVHNATFLRKIPNDSTD 626

Query: 481 --SYPTRSA---NQI-FNNLN-FTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRIT 533
             SY   +A   +Q+   N++ F +  G  VCVVG  G GKST    LL       G++ 
Sbjct: 627 DESYDEEAAVESSQVALKNIDGFQVFKGQLVCVVGRVGAGKSTFLQALL-------GQLP 679

Query: 534 IDGQDISKISAKSLRR--HLGVVQQEPILMSGSIRDNITYGVPYTPTIDE--IRSVSKKC 589
                 S  S     R   + +  Q+  +M+ S++DN+ +G  +    DE   ++  + C
Sbjct: 680 CISNSPSHASPTVHFRANSVALCSQQSWIMNASVKDNVLFGHRF----DEATYKATLEAC 735

Query: 590 FCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SE 648
                +   +DG ET++G KG  LSGGQK R+++ARA+  + ++ +LD+  SA+D E  +
Sbjct: 736 QLVPDLEILADGDETLVGEKGISLSGGQKARLSLARAVYSRSDVYLLDDILSAVDAEVCK 795

Query: 649 GAINYTLGQ---LMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKE 705
             I   L +   L+K++  T+I   + +S ++ S+++  L +DG +VE G F ++    +
Sbjct: 796 RIIEQVLSKKTGLLKNK--TVILTTNSISVLKHSQSIYAL-EDGEIVESGSFNDIMRRDD 852

Query: 706 SKLYKLLNEKAKDTTSKMNAETVEKNDPSP 735
           S   K L  + +   +K   E V+    +P
Sbjct: 853 SSKLKRLIVECESENTKAKIEPVDSEIKAP 882

>Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON}
            YHL035C (REAL)
          Length = 1587

 Score =  144 bits (364), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 143/523 (27%), Positives = 243/523 (46%), Gaps = 68/523 (13%)

Query: 229  RLRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIG 288
            ++ +N++   +H +  FFD   VG +++R + D   V + +   +      I C    + 
Sbjct: 1074 KIFNNMLDLVLHANIRFFDVTPVGRIMNRFAKDIEGVDQELIPYLE---VTIFCLIQCLS 1130

Query: 289  MMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQ----STGNLTKVAEEQLSGV 344
            ++F I+               V     G+   S  R+L++    +   + +   E L+GV
Sbjct: 1131 IIFLIT-IITPRFLVVAVVVLVLYYFVGKCYLSAGRELKRIDSITKSPIFQYFSETLAGV 1189

Query: 345  KTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSF-------LIVL 397
             T+++F  E++ I      I +           N  FF  +  +  F+F        IVL
Sbjct: 1190 CTIRAFGDEKRFILENMDKIDQ----------NNRAFFYLSVAVKWFAFRVDIIGAFIVL 1239

Query: 398  AYGSHLVLQ-----GSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELT 452
              GS ++L       SL+   LT  +L+T+        L   YS       +  RL E +
Sbjct: 1240 GSGSFILLNIGDIDSSLAGISLTYSILFTD----GALWLVRLYSTFEMNMNSVERLKEYS 1295

Query: 453  DHQPSIYATKGVPYV-----PGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVV 507
              +   Y    +  +     P  G+I+ +N+S  Y + +   +  N++FT+D  + + +V
Sbjct: 1296 GIEQENYNENHIQALQNSLWPEHGKIEVDNLSLRYAS-NLPPVIKNVSFTVDPQTKIGIV 1354

Query: 508  GPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRD 567
            G +G GKSTI + L +   P +G I IDG DISKI   +LRR + ++ Q+PIL +G+I+ 
Sbjct: 1355 GRTGAGKSTIITALFRLLKPVTGCIKIDGYDISKIDLVTLRRAITIIPQDPILFTGTIKS 1414

Query: 568  NITYGVPYTPTIDEIRSVSKKCFCHNFIT------------KFSDGY------ETVIGPK 609
            N+    PY    DE R + K     N I+             FS  +       T I   
Sbjct: 1415 NLD---PYDEY-DE-RRIFKVLSQVNLISSRELEETLNREENFSGVHNRFLNLRTEIVEG 1469

Query: 610  GALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTL-GQLMKSRDITIIS 668
            G  LS G+KQ + IAR+L+++P I++LDEATS++D +S+  I   +  +  +S   TI++
Sbjct: 1470 GLNLSQGEKQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRNEFSRS---TILT 1526

Query: 669  IAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKL 711
            IAHRL ++   + V+V+ D G V E     EL  ++ S  Y +
Sbjct: 1527 IAHRLRSVIDYDKVLVM-DAGEVKEYDHPYELLKNERSIFYSM 1568

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 95/377 (25%), Positives = 164/377 (43%), Gaps = 28/377 (7%)

Query: 339 EQLSGVKTVQSFVAEQK---EIKRYNH-AIRKVFDVGKREALTNATFFSSTSVLGDFSFL 394
           E L  ++ V+ F  E     +IK      ++ +F      A+++  +F + +++   +F 
Sbjct: 530 ECLQNIRIVKYFAWENNISNDIKSSRQKELKFLFRKSLLWAVSSFLWFVTPTLVTSVTFA 589

Query: 395 IVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDH 454
           + + +     L   L+   L+ F L      + +  LSN  S + +   +  R+ E  + 
Sbjct: 590 VYI-FVQQQELNAPLAFTTLSLFTLLK----TPLDQLSNMLSFMNQSKVSLERIVEFLNE 644

Query: 455 QPSIYATKGVPYVPGKGEIKFENVSFSYPTRSANQI----FNNLNFTIDSGSNVCVVGPS 510
           + +    + +   P K +IKF+  +  +   + N I      +LN     G    ++G +
Sbjct: 645 EDTAKYNQ-LTVSPDKNKIKFKKATLVW-NENDNDINKFRLCDLNINFRIGKLNLILGST 702

Query: 511 GRGKSTIASLLLKYYNPTSGRITIDG----QDISKISAKSLRRHLGVVQQEPILMSGSIR 566
           G GKS +   LL      SG I + G     D+       L        Q   L++G++R
Sbjct: 703 GSGKSALLMGLLGELYLLSGSIIVPGLEPRHDMIP-DLNGLTNSFAYCSQSAWLLNGTVR 761

Query: 567 DNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARA 626
           +NI +   Y    +  ++V   C     +     G  T IG KG  LSGGQKQRI++ARA
Sbjct: 762 NNIIFNGVYDE--NRYKNVIDACGLKRDLEILPAGDSTEIGEKGITLSGGQKQRISLARA 819

Query: 627 LIKKPNILILDEATSALDVESEGAINYTL---GQLMKSRDITIISIAHRLSTIRRSENVI 683
           +      ++LD+  SA+D  +   I Y +   G LMK+R  T I + H +S   R     
Sbjct: 820 IYSNAKHVLLDDCLSAVDSHTAIWI-YEICITGLLMKNR--TCILVTHNISLAIRKAYFA 876

Query: 684 VLGDDGSVVEMGKFKEL 700
           V+ ++G V   G   EL
Sbjct: 877 VILENGKVKSQGTITEL 893

>Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  144 bits (363), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 136/531 (25%), Positives = 238/531 (44%), Gaps = 50/531 (9%)

Query: 214  GRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNI 273
            G+ +L    G     ++ + ++ K +H    FFD    G +++R S D   + + +T  I
Sbjct: 1121 GKTILNFAAGINASRKIFNMILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYI 1180

Query: 274  SDGFKAII-CGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGN 332
               F ++I C    I + F                  VG   Y    R + R    S   
Sbjct: 1181 QGAFYSLIECLSTVILITFITPQFLSIAIVVSILYYFVG-YFYMAGSRELKRFESISRSP 1239

Query: 333  LTKVAEEQLSGVKTVQSFVAE----QKEIKRYNHAIRKVF--DVGKREALTNATFFSSTS 386
            + +   E L GV T+++F  E    Q+ +++ +   +  F   V  R          S  
Sbjct: 1240 IYQHFSETLVGVTTIRAFGDEGRFMQENLQKIDENNKPFFYLWVANRWLAFRIDMIGSLV 1299

Query: 387  VLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAAS 446
            + G  + L +L    H+     ++   LT  + +TE        L   YSE+     +  
Sbjct: 1300 IFG--AGLFILFNIDHI--DSGMAGISLTYAISFTE----GALWLVRLYSEVEMNMNSVE 1351

Query: 447  RLFELTDHQPSIY-ATKGVP--YVPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSN 503
            R+ E    +   Y   K VP    P  G+I+  ++S  Y   +  ++ NN++F++D+ S 
Sbjct: 1352 RVKEYMKIEQEPYNQHKEVPPSQWPQDGKIEVNDLSLRYAP-NLPRVINNVSFSVDAQSK 1410

Query: 504  VCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSG 563
            + +VG +G GKSTI + L ++  P +G I ID  DIS +  + LRR + ++ Q+P L SG
Sbjct: 1411 IGIVGRTGAGKSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSG 1470

Query: 564  SIRDNITYGVPYTPTIDE---------------------IRSVSKKCFCHNF--ITKFSD 600
            +I+ N+    PY    D+                     +R        ++   I KF D
Sbjct: 1471 TIKTNLD---PYDEFSDKKIFEALKRVNLISEEQSHQGAVREADNDTSSNSSENINKFLD 1527

Query: 601  GYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMK 660
               + +   G+ LS GQ+Q + +AR+L++ P I++LDEAT+++D  S+  I  T+ +  +
Sbjct: 1528 -LSSEVSEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRKEFQ 1586

Query: 661  SRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKL 711
                TI++IAHRL ++   + ++V+ D G V E      L  +K+S  Y +
Sbjct: 1587 GS--TILTIAHRLRSVIDYDKILVM-DAGEVKEYDHPYSLLLNKQSIFYSM 1634

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 104/473 (21%), Positives = 203/473 (42%), Gaps = 28/473 (5%)

Query: 236 KKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISS 295
           +K+I+ D E      +G +I+ ++ DA+ VS  +   +    +A +   V + +++H+  
Sbjct: 460 QKSINGDEESTSSANLGAIINLMAIDAFKVSE-ICGYLHSFLEAFVMTVVALALLYHL-- 516

Query: 296 XXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQS----TGNLTKVAEEQLSGVKTVQSFV 351
                         V       K+     DLQ+     T N  +   E    ++ ++ F 
Sbjct: 517 --LGFAAIVGVLIIVAMLPLNYKLAKYIGDLQKKNLAVTDNRIQKLNEAFQAIRIIKYFS 574

Query: 352 AEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLA--YGSHLVLQGSL 409
            E+     +   I  + +      L  +  +S +S +   +  IV A  +  ++ +QG +
Sbjct: 575 WEEN----FEKEINTIRENELSLLLMRSIIWSISSFVWFVTPTIVTAASFAYYIYVQGEV 630

Query: 410 SIGDL--TAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYV 467
               +  TA  L+T      +  LS+  S +++   +  R+ +  + + +      +   
Sbjct: 631 LTTPVAFTALSLFTLLR-DPLDRLSDMLSFVVQSKVSLDRVQDFLNEKDT-KKYDQLTID 688

Query: 468 PGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNP 527
           P       EN + S+   + +    +LN    +G    V+GP+G GK+++   LL     
Sbjct: 689 PNGKRFALENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 528 TSGRITIDGQDISK---ISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRS 584
            +G+I +   +  +   + A      +    Q   L++ +I+ NI +  P+       ++
Sbjct: 749 LNGKIVVPALEPRQELVVDANGTTNSIAYCSQGAWLLNDTIKHNILFNSPFNEA--RYKA 806

Query: 585 VSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALD 644
           V + C           G  T IG KG  LSGGQKQR+++ARAL      ++LD+  SA+D
Sbjct: 807 VVEACGLKRDFEILKAGDLTEIGEKGIALSGGQKQRVSLARALYSNARHVLLDDCLSAVD 866

Query: 645 VESEGAI--NYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMG 695
             +   I  N   G LM+ R  T I ++H ++   R+  ++VL +DG + + G
Sbjct: 867 SHTASWIYDNCITGPLMEDR--TCILVSHNIALTLRNAELVVLLEDGRIKDQG 917

>Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  144 bits (362), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 136/533 (25%), Positives = 240/533 (45%), Gaps = 54/533 (10%)

Query: 214  GRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNI 273
            G+ +L  + G     ++ + ++ K +H    FFD    G +++R S D   + + +T  I
Sbjct: 1121 GKTILNFVAGINASRKIFNMILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYI 1180

Query: 274  SDGFKAII-CGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGN 332
               F ++I C    I + F                  VG   Y    R + R    S   
Sbjct: 1181 QGAFYSLIECLSTVILITFITPQFLSVAIVVSILYYFVGY-FYMAGSRELKRFESISRSP 1239

Query: 333  LTKVAEEQLSGVKTVQSFVAE----QKEIKRYNHAIRKVF--DVGKREALTNATFFSSTS 386
            + +   E L GV T+++F  E    Q+ +++ +   +  F   V  R          S  
Sbjct: 1240 IYQHFSETLVGVTTIRAFGDEGRFMQENLQKIDENNKPFFYLWVANRWLAFRIDMIGSLV 1299

Query: 387  VLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAAS 446
            + G  + L +L   +HL     ++   LT  + +TE        L   Y+E+     +  
Sbjct: 1300 IFG--AGLFILFNINHL--DSGMAGISLTYAISFTE----GALWLVRLYAEVEMNMNSVE 1351

Query: 447  RLFELTDHQPSIY-ATKGVP--YVPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSN 503
            R+ E  + +   Y   K VP    P  G+I+  ++S  Y   +  ++  N++F++D+ S 
Sbjct: 1352 RVKEYMEIEQEPYNQHKEVPPPQWPQDGKIEVNDLSLRYAP-NLPRVIKNVSFSVDAQSK 1410

Query: 504  VCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSG 563
            + +VG +G GKSTI + L ++  P +G I ID  DIS +  + LRR + ++ Q+P L SG
Sbjct: 1411 IGIVGRTGAGKSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSG 1470

Query: 564  SIRDNITYGVPYTPTIDEIRSVSKKCFCHNFIT-------------------------KF 598
            +I+ N+    PY    D  R + +     N I+                         KF
Sbjct: 1471 TIKTNLD---PYDEFSD--RKIFEALKRVNLISEEQSQQGTTREADNDNSSTNSENVNKF 1525

Query: 599  SDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQL 658
             D   + +   G+ LS GQ+Q + +AR+L++ P I++LDEAT+++D  S+  I  T+ + 
Sbjct: 1526 LD-LSSEVSEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYGSDAKIQETIRKE 1584

Query: 659  MKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKL 711
             +    TI++IAHRL ++   + ++V+ D G V E      L  +K+S  Y +
Sbjct: 1585 FQGS--TILTIAHRLRSVIDYDKILVM-DAGEVKEYDHPYSLLLNKQSIFYSM 1634

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 112/233 (48%), Gaps = 9/233 (3%)

Query: 468 PGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNP 527
           P      FEN + S+   + +    +LN    +G    V+GP+G GK+++   LL     
Sbjct: 689 PNGKRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 528 TSGRITIDGQDISK---ISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRS 584
            SG++ +   +  +   + A      +    Q   L++ ++++NI +  P+       ++
Sbjct: 749 LSGKVVVPALEPRQELVVDANGTTNAIAYCSQGAWLLNDTVKNNILFNSPFNEA--RYKA 806

Query: 585 VSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALD 644
           V + C           G  T IG KG  LSGGQKQR+++ARAL      ++LD+  SA+D
Sbjct: 807 VVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAVD 866

Query: 645 VESEGAI--NYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMG 695
             +   I  N   G LM+ R  T I ++H ++   R+  ++VL +DG V + G
Sbjct: 867 SHTASWIYDNCITGPLMEDR--TCILVSHNIALTLRNAELVVLLEDGRVKDQG 917

>KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1515

 Score =  143 bits (360), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 144/524 (27%), Positives = 236/524 (45%), Gaps = 56/524 (10%)

Query: 217  VLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAY----VVSRSMTQN 272
            V   I G + +  L ++ + K       FF+   +G +++R S+D Y    ++ R+ +Q 
Sbjct: 1014 VFCTIRGSRYLHDLMTDAVLKA---PMSFFETTPIGRILNRFSNDIYKIDSILGRTFSQF 1070

Query: 273  ISDGFK-----AIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQ 327
              +  K     A+IC       +F I                    +  R++ SI+R   
Sbjct: 1071 FVNAVKVVFVMAVICATTW-QFIFVIIPLGVFYIYYQQYYLRTSREL--RRLDSITRSPV 1127

Query: 328  QSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSV 387
             S        +E L G+ T++ +  E    KR+ H  +   D         + F+ S + 
Sbjct: 1128 YSH------FQETLGGITTIRGYNQE----KRFGHINQCRVDNNM------SAFYPSINA 1171

Query: 388  LGDFSFLIVLAYGSHLVL-----------QGSLSIGDLTAFMLYTEYSGSAVFGLSNFYS 436
                +F + L  GS ++L           +G+L+ G +   + Y       +  +     
Sbjct: 1172 NRWLAFRLELI-GSIIILGAATLSIFRLKEGTLTPGMVGLSLSYALQITQTLNWIVRMTV 1230

Query: 437  ELMKGAGAASRLFE---LTDHQPSIYATKGVPYV-PGKGEIKFENVSFSYPTRSANQIFN 492
            E+     +  R+ E   L    P I   K    + P +G+IKFEN S  Y     + +  
Sbjct: 1231 EVETNIVSVERVKEYAQLESEAPRIVEEKRPDEMWPTEGDIKFENYSTRYRPE-LDLVLK 1289

Query: 493  NLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLG 552
            N+N  I     V +VG +G GKS++   L +    T+G I IDG  I++I    LR  L 
Sbjct: 1290 NINVHIRPTEKVGIVGRTGAGKSSLTLALFRIIEATAGNIIIDGIPINEIGLYDLRHKLS 1349

Query: 553  VVQQEPILMSGSIRDNITYGVPYTPTIDE--IRSVSKKCFCHNFITKFSDGYETVIGPKG 610
            ++ Q+  +  G++R+NI    P     DE   R +       + ++  +DG +  +   G
Sbjct: 1350 IIPQDSQVFEGTLRENID---PTNLFTDEEIWRVLELSHLKEHVLSMGADGLDVQLTEGG 1406

Query: 611  ALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIA 670
            + LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE++  +  T+    K R  TI++IA
Sbjct: 1407 SNLSVGQRQLMCLARALLIPSKILVLDEATAAVDVETDKIVQETIRTAFKDR--TILTIA 1464

Query: 671  HRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNE 714
            HRL+TI  S+ +IVL D G +VE     EL A  ES  Y L NE
Sbjct: 1465 HRLNTIMDSDRIIVL-DKGEIVEFDTPDELLAKPESLFYSLCNE 1507

 Score =  109 bits (273), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 99/411 (24%), Positives = 194/411 (47%), Gaps = 36/411 (8%)

Query: 320 RSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHA-----IRKVFDVGKRE 374
           R + +   Q     T V  E L+ +K+++ +  E     + NH      +  +  +G   
Sbjct: 467 RKLQKQQMQFKDERTGVISEILNNIKSLKLYAWEVPYQTKLNHVRNDKELHNLTKLGCYM 526

Query: 375 ALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNF 434
           A+T+  F +    L   +   V  Y  +  L   L    LT F L +      +  + N 
Sbjct: 527 AVTSFQF-NIVPFLVSCATFAVFVYTENKPLTTDLVFPALTLFNLLS----FPLMVVPNV 581

Query: 435 YSELMKGAGAASRLFE-LTDHQPSIYATKGVPYVPGKGEIKF---ENVSFSYPTRSANQI 490
            +  ++ + + +RLF  LT+ +    + + +P V  KG++     +N +F +  +   ++
Sbjct: 582 ITSFVEASVSVNRLFSFLTNEELQKDSIQRLPKVENKGDVAINLGDNATFLWKRKPEYKV 641

Query: 491 -FNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRR 549
              N+NF    G   C+VG  G GKS +   +L       G  T+ G             
Sbjct: 642 ALKNINFQAKKGDLTCIVGKVGSGKSALIQSILGDLFRVKGFATVHG------------- 688

Query: 550 HLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPK 609
           ++  V Q P +M+G++++NI +G  Y     E     K C     +    DG +T++G K
Sbjct: 689 NVAYVSQVPWIMNGTVKENILFGHKYDQEFYE--KTIKACALTIDLGILVDGDQTLVGEK 746

Query: 610 GALLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTLGQ--LMKSRDITI 666
           G  LSGGQK R+++ARA+  + +  +LD+  +A+D   S+  + + LG   L+ S+  T 
Sbjct: 747 GISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVSKHLVEHVLGPTGLLHSK--TK 804

Query: 667 ISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAK 717
           +   +++S +  ++++ +L ++G +V+ G ++E+ + ++S L+KL+ E  +
Sbjct: 805 VLCTNKISVLSIADSITLL-ENGEIVQQGSYEEVNSDEDSPLFKLIKEYGR 854

>KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] {ON} 
          Length = 1537

 Score =  143 bits (360), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 144/561 (25%), Positives = 249/561 (44%), Gaps = 62/561 (11%)

Query: 189  VWG-LGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFD 247
            VW  +G+Y  + + + A     F N   ++LL     +   +L  N+    ++   +FF+
Sbjct: 1003 VWKFVGIYALIGIASAA-----FNNLRTIILLVYCTIRGAKKLHDNMAHAIVYSSMQFFE 1057

Query: 248  RNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXX 307
               +G +++R S+D   V  ++       FK+I    + + ++  IS             
Sbjct: 1058 TTPIGRILNRFSADIDTVDSTLQMVFMVFFKSIFSYLITV-ILITISMPLFLVFCLFLMV 1116

Query: 308  XXVGATIYGRKIRSI-SRDLQQSTG----NLTKVAEEQLSGVKTVQSF----VAEQKEIK 358
                  IY +K+  + SR+L++ T      +  +  E L G+  ++++    + +    +
Sbjct: 1117 IY----IYYQKLFIVQSRELKRMTSISYSPIMSLVGESLGGLAVIRAYKHFSMFKYLNNE 1172

Query: 359  RYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIV-LAYGSHLVLQGSLSIGDLTAF 417
            R    I  VFD       TN         +G    LI  +   S +     L+ G +   
Sbjct: 1173 RVQFNINCVFDYRS----TNRWLSIRLQTIGALMVLITGMLSLSTISSSKPLTAGMVGLL 1228

Query: 418  MLYTEYSGSAVFGLSNFYSELMKGAGAASRLFE-----------LTDHQPSIYATKGVPY 466
            M Y     +++  +      +  G  +  R+ E           + D++P+         
Sbjct: 1229 MSYVLQVTTSLMWIVRSSVMIETGIVSVERIMEYCELPSEAEQIVDDYRPA-------SN 1281

Query: 467  VPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYN 526
             P KG I+F+N S  Y   + + +  N++  I+ G  V +VG +G GKST+   L +   
Sbjct: 1282 WPSKGAIQFKNYSTRYRA-NLDPVLKNISININPGEKVGIVGRTGAGKSTLTLALFRLLE 1340

Query: 527  PTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTP--------- 577
            P  G I IDG DISKI    LR HL ++ Q+     G++R N+    P+           
Sbjct: 1341 PIEGTIIIDGMDISKIGISDLRSHLAIIPQDAQAFEGTVRSNLD---PFNMFSDKELDTA 1397

Query: 578  -TIDEIRSVSKKCFCHN-FITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILI 635
             T+  ++   KK    +      +D  E  I   G+ LS GQ+Q + +ARAL+ +  IL+
Sbjct: 1398 ITLSHLKPHLKKLMEESGSELPLNDYLELGIKESGSSLSVGQRQLLCLARALLNRSKILV 1457

Query: 636  LDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMG 695
            LDEAT+++DVE++  I  T+ +    R  TII+IAHR+ T+  S+ ++VL + G V E  
Sbjct: 1458 LDEATASVDVETDKIIQATIRESFSDR--TIITIAHRIDTVLDSDRILVL-EQGEVKEFN 1514

Query: 696  KFKELYASKESKLYKLLNEKA 716
                L A K +  Y+L  EKA
Sbjct: 1515 SPASLLADKSTLFYQLC-EKA 1534

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 108/223 (48%), Gaps = 30/223 (13%)

Query: 505 CVVGPSGRGKSTIASLLLKYYNPTSG-------RITIDGQDISKISAKSLRRHLGVVQQE 557
           CVVG  G GK+T+   +L     TSG       ++ I G+ ++               QE
Sbjct: 663 CVVGRVGSGKTTLLKSILGQLPCTSGSQKAIPPKLIIRGESVA------------YCPQE 710

Query: 558 PILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQ 617
             +M+ SI++NI +G  Y  T   +    K C          DG  T++G KG  LSGGQ
Sbjct: 711 AWIMNDSIKENILFGHRYDETFYNL--TVKACELRPDFKILPDGDNTLVGEKGITLSGGQ 768

Query: 618 KQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQ----LMKSRDITIISIAHRL 673
           K R+++ARA+  + +I +LD+  SA+D     +I + +      L+K++   II   + +
Sbjct: 769 KARLSLARAVYSRSDIYLLDDVLSAVDAGVRKSIIHRVLDSDTGLLKNK--AIILTTNDI 826

Query: 674 STIRRSENVIVLGDDGSVVEMGKFKELYASKESK--LYKLLNE 714
           S +  S+ + VL  DG ++E   + E     + K  LYKLL E
Sbjct: 827 SVLEHSDRIYVL-QDGRIIEESTYAEAIEDNDVKPFLYKLLKE 868

>NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] {ON}
            Anc_8.303
          Length = 1517

 Score =  143 bits (360), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 135/525 (25%), Positives = 234/525 (44%), Gaps = 48/525 (9%)

Query: 217  VLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDG 276
            V   I G + +  L +N +   +     FF+   +G +++R S+D Y V   + +  S  
Sbjct: 1018 VFCTIQGSRYLHTLMTNAV---LRAPMSFFETTPIGRILNRFSNDIYKVDSVLGRTFSQF 1074

Query: 277  FKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKV 336
            F   +     IG++   +                    Y R  R + R    +   +   
Sbjct: 1075 FVNAVKVSFTIGVICVTTWQFIFVIVPLGVFYIYYQQYYLRTSRELRRLDSITRSPVYSH 1134

Query: 337  AEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSF--- 393
             +E L G+ T++ +  +QK   + N           R     + F+ S +     ++   
Sbjct: 1135 FQETLGGIVTIRGY-GQQKRFSQINQC---------RVDNNMSAFYPSVNANRWLAYRLE 1184

Query: 394  ----LIVLAYGSHLVL---QGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAAS 446
                +I+L   +  V+   QG+L+ G +   + Y      ++  +     E+     +  
Sbjct: 1185 LIGSIIILGAATLSVMRLKQGTLTAGMVGLSLSYALQITQSLNWIVRMTVEVETNIVSVE 1244

Query: 447  RLFE-----------LTDHQPSIYATKGVPYVPGKGEIKFENVSFSYPTRSANQIFNNLN 495
            R+ E           + DH+P           P +G+IKFE+ S  Y     + +  ++N
Sbjct: 1245 RIKEYADLKSEAPEIIEDHRPQ-------ETWPEEGDIKFEHYSTRYRPE-LDLVLKDIN 1296

Query: 496  FTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQ 555
            F I     + +VG +G GKS++   L +    + G I ID  DIS I    LR  L ++ 
Sbjct: 1297 FHIKPKEKIGIVGRTGAGKSSLTLALFRIIEASEGNIIIDNVDISDIGLYDLRHKLSIIP 1356

Query: 556  QEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFI-TKFSDGYETVIGPKGALLS 614
            Q+  +  G+IR+NI     YT   ++I  V +     + I T   DG +T +   G+ LS
Sbjct: 1357 QDSQVFEGTIRENIDPTNQYTD--EQIWRVLELSHLRDHIATMGGDGLDTKLNEGGSNLS 1414

Query: 615  GGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLS 674
             GQ+Q + +ARAL+    IL+LDEAT+A+DVE++  +  T+    K R  TI++IAHR++
Sbjct: 1415 VGQRQLMCLARALLVPSKILVLDEATAAVDVETDKVLQETIRTSFKDR--TILTIAHRIN 1472

Query: 675  TIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKDT 719
            TI  ++ ++VL D+GS+ E  + K+L  +K S  Y L  E    T
Sbjct: 1473 TIMDNDRIMVL-DNGSIKEFDEPKKLLENKSSLFYSLCEEAGLTT 1516

 Score =  100 bits (250), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 104/428 (24%), Positives = 188/428 (43%), Gaps = 54/428 (12%)

Query: 334 TKVAEEQLSGVKTVQSFVAE-----QKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVL 388
           T+V  E L+ +K+++ +  E     + E  R N  ++ +  +G   AL +  F +    L
Sbjct: 483 TRVISEILNNIKSLKLYAWETPYKAKLENVRNNKELKNLTKLGCYMALMSFQF-NVVPFL 541

Query: 389 GDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRL 448
              S   V  Y     L   L    LT F L        +  + N  + L++ + +  RL
Sbjct: 542 VSCSTFAVFVYTEDRPLTTDLVFPALTLFNLL----HFPLMVIPNVLTALIECSVSVGRL 597

Query: 449 FE-LTDHQPSIYATKGVPYVPGKGEIKF---ENVSFSYPTRSANQI-FNNLNFTIDSGSN 503
           F  LT+ +    + + +P V   G++     ++ +F +  +   ++   N+NF    G  
Sbjct: 598 FSFLTNEELQKDSVQRLPKVTEIGDVAINVGDDATFLWQRKPEYKVALKNVNFQAKKGEL 657

Query: 504 VCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSG 563
            C+VG  G GKS +   +L       G  TI G             ++  V Q   +M+G
Sbjct: 658 TCIVGRVGSGKSALIQSILGDLFRVKGFATIHG-------------NVAYVSQVAWIMNG 704

Query: 564 SIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAI 623
           +++DNI +G  Y     E     K C     ++   DG +T++G KG  LSGGQK R+++
Sbjct: 705 TVKDNILFGHKYDAEFYE--KTIKACALTIDLSVLVDGDQTLVGEKGISLSGGQKARLSL 762

Query: 624 ARALIKKPNILILDEATSALDVE-SEGAINYTLG---------QLMKSRDITIISIAHRL 673
           ARA+  + +  +LD+  +A+D   +   I + LG         +++ +  ++++S+A  +
Sbjct: 763 ARAVYSRADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTKTKVLATNKVSVLSVADSV 822

Query: 674 STIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKDTTSKMNAETVEKNDP 733
           S          L ++G +V+ G + E+     S+L KL+ E  K    K N      N  
Sbjct: 823 S----------LLENGEIVQQGSYDEIMKDGASQLNKLIMEYGK----KSNGNPASSNAI 868

Query: 734 SPKTEKLN 741
           +P +   N
Sbjct: 869 TPASSSTN 876

>TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8.303
            YDR135C
          Length = 1523

 Score =  143 bits (360), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 141/536 (26%), Positives = 236/536 (44%), Gaps = 44/536 (8%)

Query: 208  STFANFGRVVLLRIL----GEKLVARLRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAY 263
            S+ AN  + ++L I     G K   +L S++          FF+   +G +++R S+D Y
Sbjct: 996  SSLANLIQTIILWIFCTIQGSK---QLHSSMTSSIFRAPMSFFETTPIGRILNRFSNDVY 1052

Query: 264  VVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSIS 323
             +   + ++ S  F+  I     I ++   +                    + R  R + 
Sbjct: 1053 KIDEILGRSFSQFFQNTIRVSFTIVVICSTTWQFIFLIIPMAFLYIYYQQYFLRTSRELR 1112

Query: 324  RDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFS 383
            R    +   L    +E L GV T++ F  + + I      +            +N     
Sbjct: 1113 RLDSTTRSPLYAHFQETLCGVSTIRGFAQQDRFIHINQSRVDSNMMAYYPSINSNRWLAF 1172

Query: 384  STSVLGDFSFLIVLAYGSHLVLQ---GSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMK 440
                LG    LI+L   +  + +   GSL+ G +   M Y      ++  +     ++  
Sbjct: 1173 RLEFLGS---LIILGAATLSIFRLKNGSLTAGMIGLSMSYALQVTQSLNWIVRMTVDVES 1229

Query: 441  GAGAASRLFELTDHQPS-----IYATKGVPYVPGKGEIKFENVSFSYPTRSANQIFNNLN 495
               +  R+ E + H PS     I   +     P KG I+F+N S  Y     + +  N+N
Sbjct: 1230 NIVSVERIEEYS-HLPSEAPLIIENNRPSEEWPSKGAIEFKNYSTRYRPE-LDLVLKNIN 1287

Query: 496  FTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQ 555
              I     V +VG +G GKS++   L +    +SG I IDG +I+++    LR  L ++ 
Sbjct: 1288 LKILPKEKVGIVGRTGAGKSSLTLALFRIIEASSGSIEIDGVNINELGLYDLRHKLSIIP 1347

Query: 556  QEPILMSGSIRDNI-----------------TYGVPYTPTIDEIRSVSKKCFCHNFITKF 598
            Q+  +  GSIR+NI                  +  P+   ++EI   S+    +    + 
Sbjct: 1348 QDSQVFEGSIRENIDPTQQFSEQEIWNALEMAHLKPHILKMNEISPESENSDTN----QS 1403

Query: 599  SDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQL 658
            S+  +  I   G+ LS GQ+Q I +ARAL+   N+LILDEAT+A+DVE++  I +T+   
Sbjct: 1404 SNPLDAKITEGGSNLSVGQRQLICLARALLVPSNVLILDEATAAVDVETDELIQHTIRTA 1463

Query: 659  MKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNE 714
             K R  TI++IAHR++TI  S+ +IVL D+G V E  K + L  +K S  Y L  E
Sbjct: 1464 FKDR--TILTIAHRINTIMDSDKIIVL-DNGEVAEFDKPEILLTNKNSLFYSLCYE 1516

 Score =  106 bits (265), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 98/354 (27%), Positives = 169/354 (47%), Gaps = 52/354 (14%)

Query: 423 YSGSAVFGLSNF--------YSELMKGAGAASRLFE-LTDHQPSIYATKGVPYVPGKGEI 473
           +    +F L NF         S  ++ + + SRL+  LT+ +    A + +P+V   GE 
Sbjct: 553 FPALTLFNLLNFPLVAVPITISAFIEASVSISRLYSYLTNEELQKDAIQRLPFVKQNGET 612

Query: 474 KF---ENVSFSYPTRSANQI-FNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTS 529
                +N +F +  +   ++   N+NF    G   C+VG  G GKS     +L       
Sbjct: 613 TVKIGDNATFLWKRKPEYKVALKNINFEARKGELACIVGKVGSGKSAFIQSILGDLFRVK 672

Query: 530 GRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKC 589
           G  +I G             ++  V Q   +M+G+++DNI +G  Y P   E     K C
Sbjct: 673 GFASIHG-------------NVAYVSQLAWIMNGTVKDNIIFGHRYDPEFYE--KTIKAC 717

Query: 590 FCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SE 648
                ++   DG +T++G KG  LSGGQK R+++ARA+  + +I +LD+  +A+D   S+
Sbjct: 718 ALTIDLSILPDGDQTLVGEKGISLSGGQKARLSLARAVYARADIYLLDDPLAAVDEHVSK 777

Query: 649 GAINYTLGQ--LMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKES 706
             I   LG   L+KS+  T I   +++  +  ++++ +L ++G + E G + ++ A++ S
Sbjct: 778 HLIQNVLGAKGLLKSK--TRILTTNKIPVLSIADSITLL-ENGEITEQGTYFDVMATEGS 834

Query: 707 KLYKLLNE--KAKDTT---------------SKMNAE-TVEKNDPSPKTEKLND 742
            L KL+ E  K KD++               S +N E TV   D   + +KLND
Sbjct: 835 SLSKLITEYGKKKDSSESEAAKDNVNSESDESSVNRELTVPIEDELRELDKLND 888

>Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..10453)
            [4974 nt, 1658 aa]
          Length = 1657

 Score =  142 bits (359), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 131/518 (25%), Positives = 234/518 (45%), Gaps = 47/518 (9%)

Query: 229  RLRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIG 288
            ++ S ++ K +H +  FFD   +G +++R S D   V + +   +      II     I 
Sbjct: 1139 KIFSLLLNKALHANLRFFDSTPIGRIMNRFSKDMEAVDQELVPYLEAALYCIIDISSTIL 1198

Query: 289  MMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQ 348
            ++ +I+                   +Y    R + R    +   + +   E L GV TV+
Sbjct: 1199 LITYITPEFLIIAILVAGLYYAIGVLYLAGSRELKRFDSITKSPIYQHFSETLVGVTTVR 1258

Query: 349  SFVAEQKEIKRYNHAIRKVFDVGKRE----ALTNATFFSSTSVLGDFSFLIVLAYGSHLV 404
            ++  E     R+     K+ D   +      ++N        V+G    L++   G  ++
Sbjct: 1259 AYGDEA----RFMRENLKMIDENNKPFFYLWVSNRWLAFRIDVVGA---LVIFGSGVFVL 1311

Query: 405  LQ-----GSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFEL--TDHQPS 457
            L        L+   L+  + +TE    +   L   YS L     +  RL E    + +P 
Sbjct: 1312 LNIDKIDSGLAGISLSFAISFTE----SALWLVRHYSNLEMNMNSVERLMEYMEVEQEPY 1367

Query: 458  IYATKGVPY-VPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKST 516
              ++  VP   P +G+I+  +VS  Y   +  ++  N  FT+D    V +VG +G GKST
Sbjct: 1368 KSSSLDVPSSWPEEGKIEVNDVSLRYAP-NLPRVIKNATFTVDPKMKVGIVGRTGAGKST 1426

Query: 517  IASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYT 576
            I + L ++ +P +G I ID  DIS I  K LRR + ++ Q+P L SG+I+ N+    PY 
Sbjct: 1427 IITALFRFLDPETGSIKIDNVDISTIELKKLRRSITIIPQDPTLFSGTIKSNLD---PYD 1483

Query: 577  --------PTIDEIRSVSKKCFC------HNFITKFSDGYETV---IGPKGALLSGGQKQ 619
                      +  +  V++K          +  +  ++ +  V   I   G+ LS GQ+Q
Sbjct: 1484 EYSEKQIFEALKRVNLVTEKELASGNSDQQSIASGNANKFLNVNNEISEGGSNLSQGQRQ 1543

Query: 620  RIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRS 679
             + +AR+L++ P +++LDEAT+++D  S+  I  T+    +  D TI++IAHRL T+   
Sbjct: 1544 LVCLARSLLRCPKVILLDEATASIDYASDAKIQETIRN--EFDDSTILTIAHRLRTVIDY 1601

Query: 680  ENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAK 717
            + ++V+ D G V E      L  +K S  Y +  +  +
Sbjct: 1602 DKILVM-DAGEVKEFDHPYSLLLNKNSIFYGMCEQSGE 1638

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 64/232 (27%), Positives = 116/232 (50%), Gaps = 9/232 (3%)

Query: 470 KGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTS 529
           + +I F+N + ++     +    N++     G    ++GP+G GK+++   LL   +   
Sbjct: 700 QNKIAFKNATTTWNKEKQDFKLRNIDIDFKIGKLNVIIGPTGSGKTSLLMALLGEMDLID 759

Query: 530 GRITI---DGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVS 586
           G I +   D ++  K+ A  L   +    Q   L++ ++R+NI +  PY    +   +V 
Sbjct: 760 GEIIVPCLDPREDLKLDANGLTNSIAYCSQAAWLLNDTVRNNILFNSPYCE--ERYNAVV 817

Query: 587 KKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVE 646
           +           + G  T IG +G  LSGGQKQR+++ARAL      L+LD+  SA+D  
Sbjct: 818 EASGLKRDFEILNAGDMTEIGERGITLSGGQKQRVSLARALYSNSKHLLLDDCLSAVDSH 877

Query: 647 SEGAI--NYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGK 696
           +   I  N   G LM++R  T I ++H ++   R+ + +V  ++G +VE G+
Sbjct: 878 TATWIYDNCISGPLMENR--TCILVSHNIALTLRNADYVVKLENGKIVEHGE 927

>Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {ON}
            YLL048C (YBT1) - bile acid transporter of ABC family
            [contig 274] PARTIAL
          Length = 1436

 Score =  142 bits (358), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 127/516 (24%), Positives = 235/516 (45%), Gaps = 50/516 (9%)

Query: 234  VIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHI 293
            ++KK ++    FFD   +G +++R S D   V + +T  +   F +++     + ++ +I
Sbjct: 920  ILKKVLYAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYI 979

Query: 294  SSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAE 353
            +               +    Y    R + R    S   + +   E L G+ T+++F  E
Sbjct: 980  TPGFFVVAIFIAILYYLVGYFYMAGSRELKRFESISRSPIHQHFSETLVGITTIRAFGDE 1039

Query: 354  ----QKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQ-GS 408
                Q+ +++ +   +  F +     + N        ++G     ++ A G  ++L   S
Sbjct: 1040 RRFMQENLEKIDENNKPFFYLW----VANRWLAFRIDMIGA---CVIFAAGIFVLLNIKS 1092

Query: 409  LSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFEL--TDHQPSIYATKGVP- 465
            L  G     + Y          L   YS +     +  RL E    + +P   +T   P 
Sbjct: 1093 LDSGLAGISLTYAISFTEGALWLVRLYSNVEMTMNSVERLKEYMEVEQEPHYQSTHTPPP 1152

Query: 466  YVPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYY 525
              P +G+I+  ++S  Y   S  ++  N++FT+D    V +VG +G GKSTI + L ++ 
Sbjct: 1153 EWPSQGKIEVNDLSLRYAP-SLPKVIKNVSFTVDPNCKVGIVGRTGAGKSTIITALFRFL 1211

Query: 526  NPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTID-EIRS 584
            +P SG I ID  DI+ +  K LR+ + ++ Q+P L +G+++ N+    PY    D +I  
Sbjct: 1212 DPESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFTGTVKSNLD---PYDEYSDGQIFE 1268

Query: 585  VSKKCFCHNFITKF--------SDGYETV--------------IGPKGALLSGGQKQRIA 622
              K+    N +T+         + G  ++              I   GA LS GQ+Q + 
Sbjct: 1269 ALKRV---NLLTEEELNSAGSPAPGNSSIHSENVNKFLRLDNEITEGGANLSQGQRQLVC 1325

Query: 623  IARALIKKPNILILDEATSALDVESEGAINYTL-GQLMKSRDITIISIAHRLSTIRRSEN 681
            +AR+L++ P +++LDEAT+++D  S+  I  T+ G+   S   TI++IAHRL +I   + 
Sbjct: 1326 LARSLLRSPKVMLLDEATASIDYTSDARIQQTIRGEFSNS---TILTIAHRLRSIIDYDK 1382

Query: 682  VIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAK 717
            ++V+ D G V E      L  +K S  Y +  +  +
Sbjct: 1383 ILVM-DAGEVKEYDHPYSLLLNKNSIFYSMCEDSGE 1417

 Score = 99.4 bits (246), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 111/457 (24%), Positives = 212/457 (46%), Gaps = 52/457 (11%)

Query: 318 KIRSISRDLQQSTGNLT----KVAEEQLSGVKTVQSFVAEQ---KEIKRY-NHAIRKVFD 369
           K+ ++  +LQ+ T + T    +   E    ++ ++ F  E+   K+I+   +  ++ +  
Sbjct: 320 KLANLLGNLQKETLSFTDKRIQKLNETFQAIRIIKFFSWEENFEKDIQNIRDQELKMLVK 379

Query: 370 VGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDL--TAFMLYTEYSGSA 427
                ALT   +F + S++   SF       +++ +QG +    +  TA  L+T    + 
Sbjct: 380 RSIVWALTAFVWFVTPSIVTTVSF------ATYIYIQGEVLTTPVAFTALSLFTLLR-NP 432

Query: 428 VFGLSNFYSELMKGAGAASRL-FELTDHQPSIYATKGVPYVPGKGEIKFENVSFSYPTRS 486
           +  LS+  S +++   +  R+   L + +   Y    V     +  I FEN +FS+  ++
Sbjct: 433 LDMLSDMLSYVIQSKVSLDRVQVFLEEDETEKYDQITV----SRKRIGFENATFSWDRKN 488

Query: 487 ANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI---TIDGQDISKIS 543
            +    N++     G    V+GP+G GK+++   LL   +   G++    +D ++   + 
Sbjct: 489 PDFKLKNMSIEFRLGKLNVVIGPTGSGKTSLLMGLLGEMDLLEGKVYAPCLDPREDLIVE 548

Query: 544 AKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIR--SVSKKCFCHNFITKFSDG 601
              +   +    Q   L++ ++++NI +  P+    +E R  +V + C         S G
Sbjct: 549 NDGMTNSIAYCSQGAWLLNDTVKNNILFSSPF----NEARYDAVVEACGLKRDFEILSAG 604

Query: 602 YETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI--NYTLGQLM 659
            +T IG KG  LSGGQKQR+++ARAL      L+LD+  SA+D  +   I  N   G LM
Sbjct: 605 DQTEIGEKGITLSGGQKQRVSLARALYSSSRHLLLDDCLSAVDSHTALWIYENCITGPLM 664

Query: 660 KSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYAS---KESKLYK------ 710
           + R  T I ++H ++   ++ + +V  ++G V + G+  EL+      E +L K      
Sbjct: 665 EGR--TCILVSHNVALTLKNADWVVFMENGKVKDQGEPLELFQKGLLGEDELVKTSILSR 722

Query: 711 ------LLNEKAKD--TTSKMNAETVEKNDPSPKTEK 739
                 L  +K K     SK+NA+  E++ P  KT +
Sbjct: 723 GNSSASLARQKGKSGIDLSKLNAKIQEESTPPKKTTQ 759

>Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR281W
            (REAL)
          Length = 1478

 Score =  141 bits (356), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 143/556 (25%), Positives = 257/556 (46%), Gaps = 74/556 (13%)

Query: 192  LGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKV 251
            +GLY F  VFA  + ++     G+  +L  +G      L    +K+ +H    + D   +
Sbjct: 936  MGLYSFF-VFAAFIFMN-----GQYTILCAMGIMASKWLNLKAVKRILHTPMSYIDTTPL 989

Query: 252  GDLISRLSSDAYVVSRSMTQNI---SDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXX 308
            G +++R + D   +   +T+++   +  F  I+  GV +  + ++               
Sbjct: 990  GRILNRFTKDTDSLDNELTESLRLMTSQFANIV--GVCVMCIVYLPWFAIAIPFLLIIFV 1047

Query: 309  XVGATIY--GRKIRSISRDLQQS--TGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAI 364
             +       GR+I+ +   +Q+S    NL +V    L G+ T++++ ++++ + + +  I
Sbjct: 1048 LIADHYQSSGREIKRLEA-VQRSFVYNNLNEV----LGGMDTIKAYRSQERFLAKSDFLI 1102

Query: 365  RKVFDVGKREALTN---ATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYT 421
             K+ + G    +       F    +++  F+ +I L   +      + S+G +  ++L  
Sbjct: 1103 NKMNEAGYLVVVLQRWVGIFLDMVAIV--FALIITLLCVTRAFPISAASVGVMLTYVL-- 1158

Query: 422  EYSGSAVFGLSNFY----SELMKGAGAASRLFELTDHQPSIYATKGVPYV------PGKG 471
                  + GL N      ++      +A RL       P + A    P +      P KG
Sbjct: 1159 -----QLPGLLNTLLRALTQTENDMNSAERLVSYATELP-LEADYRKPEMAPPESWPSKG 1212

Query: 472  EIKFENVSFSY-PTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSG 530
            EI F+NV FSY P      +  NLN  I SG  + + G +G GKSTI S L +    + G
Sbjct: 1213 EIAFKNVDFSYRPGLPV--VLKNLNLNIKSGEKIGICGRTGAGKSTIMSALYRLNELSGG 1270

Query: 531  RITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTP-TIDEIR------ 583
             I ID  +IS+I    LRR L ++ Q+P+L  G+IR N+    P+   T DE+       
Sbjct: 1271 EILIDDVNISQIGLFDLRRKLAIIPQDPVLFRGTIRKNLD---PFNERTEDELWDALVRG 1327

Query: 584  -SVSKKCF------------CHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKK 630
             +++K                H  + KF    +  +  +G+  S G++Q +A+ RAL+++
Sbjct: 1328 GAIAKNDLPEVKLQKPEENGTHGKMHKFH--LDQAVEEEGSNFSLGERQLLALTRALVRQ 1385

Query: 631  PNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGS 690
              ILILDEATS++D E++G I   + +  +  D TI+ IAHRL TI   + ++VL + G 
Sbjct: 1386 SKILILDEATSSVDYETDGKIQVRIVE--EFGDCTILCIAHRLKTIVNYDRILVL-EKGE 1442

Query: 691  VVEMGKFKELYASKES 706
            V E      L++ ++S
Sbjct: 1443 VAEFDTPWALFSQEDS 1458

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 66/218 (30%), Positives = 113/218 (51%), Gaps = 22/218 (10%)

Query: 491 FNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRH 550
           F +L+F I  G  + + GP G GKS++ + +      T G+I ++G D+           
Sbjct: 604 FKDLDFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKIEVNG-DL----------- 651

Query: 551 LGVVQQEPILMSGSIRDNITYGVPYT-PTIDEIRSVSKKCFCHNFITKFSDGYETVIGPK 609
             ++   P + + +++DNI +G P+     DE+  V   C     +     G  T IG +
Sbjct: 652 --LMCGYPWIQNATVKDNIIFGSPFNKEKYDEVIHV---CSLKADLDILPAGDMTEIGER 706

Query: 610 GALLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTLGQLMKSRDITIIS 668
           G  LSGGQK RI +AR++ K+ +I + D+  SA+D    +  ++  L  L++++  T + 
Sbjct: 707 GITLSGGQKARINLARSVYKRKDIYLFDDVLSAVDSRVGKHIMDECLTGLLENK--TRVL 764

Query: 669 IAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKES 706
             H+LS I ++  VIVLG DG  V++G   EL A  ++
Sbjct: 765 ATHQLSLIEKASRVIVLGTDGD-VDIGTVDELKARNQT 801

>Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON}
            YHL035C (REAL)
          Length = 1585

 Score =  140 bits (354), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 140/536 (26%), Positives = 241/536 (44%), Gaps = 80/536 (14%)

Query: 223  GEKLVARLRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIIC 282
            G +   ++ ++++   +H    FFD   VG +++R S D   + + +   +         
Sbjct: 1067 GMQASKKIFNSMLDLVLHAKIRFFDVTPVGRIMNRFSKDIEGIDQELIPYLE-------- 1118

Query: 283  GGVGIGMMFHISSXXXXXXXXXXXXXXVGATIY------GRKIRSISRDLQQ----STGN 332
              V +  +   SS              V   ++      G+     SRDL++    +   
Sbjct: 1119 --VTVFCLIQCSSILLLIVVITPRFFSVAVIVFILYYFVGKWYLKASRDLKRIDSITKSP 1176

Query: 333  LTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFS 392
            + +   E L GV T+++F  E++ I      I +           N  FF  +  +  F+
Sbjct: 1177 IFQHFSETLVGVCTIRAFGDEKRFILENMEKIDQ----------NNKAFFYLSVAVKWFA 1226

Query: 393  F-------LIVLAYGSHLV-----LQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMK 440
            F        IVL  GS ++     +   L+   LT  +L+T+    +   L   YS    
Sbjct: 1227 FRVDMIGAFIVLGSGSFILFNIDNIDSGLAGISLTYAILFTD----SALWLVQLYSRFEM 1282

Query: 441  GAGAASRLFELTDHQPSIYATKGVPY------------VPGKGEIKFENVSFSYPTRSAN 488
               +  RL E +    SI   K + Y             P  G+I+ EN+S  Y + +  
Sbjct: 1283 NMNSVERLKEYS----SIVQEKYLGYDEDHIQALNDSSWPKHGKIEVENLSLRYAS-NLP 1337

Query: 489  QIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLR 548
             +  N+ F +D  S V +VG +G GKSTI + L +   P +G I ID QDISKI   +LR
Sbjct: 1338 LVLKNVCFKVDPQSKVGIVGRTGAGKSTIIAALFRLLEPVTGCIKIDDQDISKIDLITLR 1397

Query: 549  RHLGVVQQEPILMSGSIRDNITYGVPYTP--------TIDEIRSVS-KKCF----CHNFI 595
            R + ++ Q+P+L +G+I+ NI     Y           ++ I S+  K+ F      N  
Sbjct: 1398 RSITIIPQDPVLFAGTIKSNIDPHDEYDERRIFKVLLQVNLISSLEFKQVFNLKENFNIH 1457

Query: 596  TKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTL 655
             KF +  ++ I   G  LS G++Q + IAR+L+++  I++LDEATS++D +S+  I   +
Sbjct: 1458 NKFLN-LQSEIVEGGLNLSQGERQLLFIARSLLRESKIILLDEATSSIDYDSDHLIQSII 1516

Query: 656  GQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKL 711
                K    TI++IAHRL ++   + ++V+ D G + E G   EL  ++ S  Y++
Sbjct: 1517 RS--KFNKSTILTIAHRLRSVIYYDKILVM-DAGEIKEYGHPYELLKNERSTFYRM 1569

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 79/277 (28%), Positives = 128/277 (46%), Gaps = 21/277 (7%)

Query: 468 PGKGEIKFENVSFSYPTRSANQI----FNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLK 523
           P + +I+F+  +  +   + N I      +LN     G    V+G +G GKS +   LL 
Sbjct: 659 PDRNKIEFKKANLVW-NENDNDINKFKLCDLNIIFSIGKLNLVLGSTGSGKSALLMSLLG 717

Query: 524 YYNPTSGRITIDG----QDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTI 579
             +  SG I I G     D+       L        Q   L+S +I++NI +   Y  + 
Sbjct: 718 ELDLVSGFIIIPGLEPRHDLIP-DHDGLTNSFAYCSQSAWLVSDTIKNNIVFNGSYDKS- 775

Query: 580 DEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEA 639
              + V   C  +  +     G  T IG KG  LSGGQKQRI++ARA+      ++LD+ 
Sbjct: 776 -RYKKVIDACGLNRDLNILPAGDLTEIGEKGITLSGGQKQRISLARAVYSHAKHVLLDDC 834

Query: 640 TSALDVESEGAI--NYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKF 697
            SA+D  +   I  N   GQLMK+R  T I + H +    R+ +  ++ +DG V   G  
Sbjct: 835 LSAVDSHTAVWIYENCITGQLMKNR--TCILVTHNVPLAIRNAHFAIILEDGKVKNQGTI 892

Query: 698 KELYASKESKLYK--LLNEKAKDTTSKMNAETVEKND 732
           KEL   ++  ++K  +     +DT +K     +++N+
Sbjct: 893 KEL---QKKGIFKEEIAQLSHQDTITKKTVNNLDENN 926

>CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1 or uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1
          Length = 1535

 Score =  140 bits (353), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 141/537 (26%), Positives = 239/537 (44%), Gaps = 38/537 (7%)

Query: 197  FLAVFAGALVLSTFANFGRVVLLRIL----GEKLVARLRSNVIKKTIHQDAEFFDRNKVG 252
            +LA++    V S F+   + V+L I     G   +  L +N + +       FF+   +G
Sbjct: 1013 YLAIYFALGVGSAFSTLIQTVILWIFCTIHGSTYLHNLMTNAVFRA---PMSFFETTPIG 1069

Query: 253  DLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGA 312
             +++R S+D Y V   + +  S  F   +     IG++ + +                  
Sbjct: 1070 RILNRFSNDIYKVDSILGRTFSQFFVNTVKVLFTIGVIAYTTWQFVFVIVPLGIFYIYYQ 1129

Query: 313  TIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGK 372
              Y R  R + R    +   +    +E L G+ T++ +  +QK  +  N           
Sbjct: 1130 QYYLRTSRELRRLESVTRSPIFSHFQETLGGLATIRGY-GQQKRFEHINEC--------- 1179

Query: 373  REALTNATFFSSTSVLGDFSFLIVLAYGSHLVL-QGSLSI-----GDLTAFML-----YT 421
            R     + F+ S +     ++ +    GS ++L   +LSI     G +TA M+     Y 
Sbjct: 1180 RVDNNMSAFYPSINANRWLAYRLEFI-GSVIILGAATLSIFKLRAGTMTAGMIGLSLSYA 1238

Query: 422  EYSGSAVFGLSNFYSELMKGAGAASRL---FELTDHQPSIYATKGVP-YVPGKGEIKFEN 477
                  +  +     E+     +  R+    EL    P +  +   P   P  GEIKFE+
Sbjct: 1239 LQITQTLNWIVRMTVEVETNIVSVERIKEYSELKSEAPLVIESNRPPKEWPVAGEIKFEH 1298

Query: 478  VSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQ 537
                Y     + +  ++N  I     + +VG +G GKS++   L +    TSG I IDG 
Sbjct: 1299 YYTRY-REDLDYVLKDINLEIKPREKIGIVGRTGAGKSSLTLALFRIIEATSGGILIDGV 1357

Query: 538  DISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITK 597
             I++I    LR HL ++ Q+  +  G+IR+NI     +T   D  R++       + +  
Sbjct: 1358 HINEIGLHDLRHHLSIIPQDSQVFEGTIRENIDPTNQFTDA-DIWRALELSHLKEHIMQM 1416

Query: 598  FSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQ 657
              DG  T++   G+ LS GQ+Q + +ARAL+    +L+LDEAT+A+DVE++  I  T+  
Sbjct: 1417 GGDGLMTMMTEGGSNLSVGQRQLMCLARALLVPSKVLVLDEATAAVDVETDKVIQETIRT 1476

Query: 658  LMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNE 714
              K R  TI++IAHR++TI  ++ +IVL D G VVE    + L  +  S  Y L  E
Sbjct: 1477 SFKDR--TILTIAHRINTIMDNDRIIVL-DKGKVVEFDTPEALLKNTNSIFYSLSKE 1530

 Score =  109 bits (272), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 107/413 (25%), Positives = 189/413 (45%), Gaps = 40/413 (9%)

Query: 319 IRSISRDLQQSTGNL----TKVAEEQLSGVKTVQSFVAEQK-----EIKRYNHAIRKVFD 369
           +  I ++LQ+S        T+V  E L+ +K+++ +  EQ      E  R    ++ +  
Sbjct: 484 LMKIQKNLQKSQMKFKDERTRVISEILNNMKSLKLYAWEQPYKEKLEYVRNEKELKNLKK 543

Query: 370 VGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVF 429
           +G   A T+  F +    L   S   V  Y     L   L    LT F L +      + 
Sbjct: 544 LGVYMACTSFQF-NIVPFLVSCSTFAVFVYTEDKALTTDLVFPALTLFNLLS----FPLM 598

Query: 430 GLSNFYSELMKGAGAASRLFE-LTDHQPSIYATKGVPYVPGKGEIKF---ENVSFSYPTR 485
            + N  + +++ + + SRLF  LT+ +    A + +P V   G++     +N +F +  +
Sbjct: 599 VIPNVITAIIESSVSVSRLFNFLTNEELQKDAVQRLPKVKEIGDVAVNVGDNATFLWKRK 658

Query: 486 SANQI-FNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISA 544
              ++   N+N+    G   C+VG  G GKS     LL       G  TI G        
Sbjct: 659 PEYKVALKNINYQAKKGELSCIVGKVGSGKSAFLQSLLGDLFRVKGFATIHGS------- 711

Query: 545 KSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYET 604
                 +  V Q   +M+G++RDN+ +G  Y P   E     K C     +    DG +T
Sbjct: 712 ------VAYVSQVAWIMNGTVRDNVLFGHKYDPEFYE--KTIKACALTIDLATLVDGDQT 763

Query: 605 VIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTLGQ--LMKS 661
           ++G KG  LSGGQK R+++ARA+  + +  +LD+  +A+D   S   + + LG   L+ S
Sbjct: 764 LVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVSRHLVEHVLGPNGLLHS 823

Query: 662 RDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNE 714
           +  T I   +++S +  ++++ +L ++G + + G + +    +ES L KLL E
Sbjct: 824 K--TRILATNKISVLSAADSITLL-ENGEITQQGTYADCRKDEESALGKLLKE 873

>Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON}
            YHL035C (REAL)
          Length = 1599

 Score =  140 bits (353), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 141/544 (25%), Positives = 246/544 (45%), Gaps = 76/544 (13%)

Query: 229  RLRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNIS-DGFKAIICGGVGI 287
            ++  N++   +H    FFD   +G +++R + D   V + +T  +    F  I C  + I
Sbjct: 1079 KIFDNMLDLVLHAKIRFFDVTPIGRIMNRFAKDIEGVDQELTPYLEVTMFCLIQCTSI-I 1137

Query: 288  GMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTV 347
             ++  I+                    Y    R + R    +   + +   E L GV T+
Sbjct: 1138 FLITIITPHFLIVAVVVFILYYFVGMWYLTASRELKRIDSITKSPIFQHFSETLVGVCTI 1197

Query: 348  QSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSF-------LIVLAYG 400
            ++F  E++ I      I +           N  FF  +  +  F+F        IVLA G
Sbjct: 1198 RAFGDEKRFILENLDKIDQ----------NNRAFFYLSVAVKWFAFRVDIIGAFIVLASG 1247

Query: 401  SHLVLQ-GSLSIG----DLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQ 455
            S +++  G++  G     LT  +L+T+        L   YS       +  RL E +  +
Sbjct: 1248 SFILINIGNIDSGLAGISLTYAILFTD----GALWLVRLYSTFEMSMNSVERLKEYSSIE 1303

Query: 456  PSIYATKGVPYV--------PGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVV 507
               Y      ++        P  G+I+ +N+S  Y + +   +  N++FTI+  S V +V
Sbjct: 1304 QENYFDYNKDHIQELQQSSWPEHGQIEVDNLSLRYAS-NLPPVIKNVSFTIEPQSKVGIV 1362

Query: 508  GPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRD 567
            G +G GKSTI + L +   P +G I IDG DIS+I   +LRR + ++ Q+PIL +G+I+ 
Sbjct: 1363 GRTGAGKSTIITALFRLLEPETGHIKIDGYDISQIDLVTLRRAITIIPQDPILFTGTIKS 1422

Query: 568  NITYGVPYTPTIDEIRSVSKKCFCHNFIT-------------------KFSDGYETVIGP 608
            N+     Y     + + + K     N I+                   KF +  +T I  
Sbjct: 1423 NVDPCDEY-----DNKKIFKVLSQVNLISTGEMEAAQNMGDDSNTARNKFVN-LQTEITE 1476

Query: 609  KGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTL-GQLMKSRDITII 667
             G  +S G++Q + IAR+L+++P I++LDEATS++D ES+  I   +  +  KS   TI+
Sbjct: 1477 GGQNISQGERQLLFIARSLLREPKIILLDEATSSIDYESDHLIQGIIRNEFNKS---TIL 1533

Query: 668  SIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLY---------KLLNEKAKD 718
            +IAHRL ++   + V+V+ D G + E      L  +++S  Y         +LL + AK 
Sbjct: 1534 TIAHRLRSVIDYDRVLVM-DAGEIKEYDHPYNLLKNEQSIFYSMCRDSGDLQLLKQLAKQ 1592

Query: 719  TTSK 722
            ++ +
Sbjct: 1593 SSER 1596

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 98/377 (25%), Positives = 169/377 (44%), Gaps = 28/377 (7%)

Query: 339 EQLSGVKTVQSFVAEQ---KEIKRY-NHAIRKVFDVGKREALTNATFFSSTSVLGDFSFL 394
           E L  ++ V+ F  E    K+IK    + +R +F      AL++  +F + +++   +F 
Sbjct: 534 ECLQNIRIVKYFAWENNISKDIKSIRQNELRFLFQKALVWALSSFLWFVTPTLVTGVTFA 593

Query: 395 IVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDH 454
           I + +  H  L   L+   L+ F L      + +  LSN  S + +   +  R+ +  + 
Sbjct: 594 IYI-FVQHQELNAPLAFTTLSLFTLLK----TPLDQLSNMLSFMNQSIVSLDRIVKFINE 648

Query: 455 QPSIYATKGVPYVPGKGEIKFENVSFSYPTRSANQ-IFN--NLNFTIDSGSNVCVVGPSG 511
             +      +   P + +I+F+N + ++     +  IF    LN T   G    ++G +G
Sbjct: 649 DDT-EKYNQLTVSPDENKIEFKNATLTWNENDKDSTIFKLCGLNITFQIGKLNLILGSTG 707

Query: 512 RGKSTIASLLLKYYNPTSGRITIDG----QDISKISAKSLRRHLGVVQQEPILMSGSIRD 567
            GKS +   LL   +  SG IT+ G     D+       L        Q   L++ ++++
Sbjct: 708 SGKSALLMGLLGELHLISGSITVPGLEPRHDLIP-DHNGLTNSFAYCSQSAWLLNDTVKN 766

Query: 568 NITYGVPYTPTIDEIR--SVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIAR 625
           NI +   Y    D++R   V   C     +     G  T IG KG  LSGGQKQRI++AR
Sbjct: 767 NIIFNGAY----DDVRYKEVIDACGLKRDLEILPAGDSTEIGEKGITLSGGQKQRISLAR 822

Query: 626 ALIKKPNILILDEATSALDVESEGAI--NYTLGQLMKSRDITIISIAHRLSTIRRSENVI 683
           A+      ++LD+  SA+D  +   I  N   G +M++R  T I + H +S   R     
Sbjct: 823 AVYSNAKHVLLDDCLSAVDSHTAVWIYENCITGPIMENR--TCILVTHNVSLTIREAYFA 880

Query: 684 VLGDDGSVVEMGKFKEL 700
           V+ ++G V   G  K+L
Sbjct: 881 VILENGKVKNQGTIKQL 897

>Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {ON}
            complement(13248..17630) [4383 nt, 1461 aa]
          Length = 1460

 Score =  140 bits (352), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 145/554 (26%), Positives = 254/554 (45%), Gaps = 80/554 (14%)

Query: 192  LGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKV 251
            +GLY F  VF G + +++     +  ++  +G     +L  + +++ +H    F D   +
Sbjct: 920  MGLYSFF-VFGGYIFMTS-----QFTIVCFIGVNASKKLNLSAVRRILHTPMAFLDTTPL 973

Query: 252  GDLISRLSSDAYVVSRSMTQNIS---DGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXX 308
            G +++R + D   +   +T+N+      F  II  GV +  + ++               
Sbjct: 974  GRILNRFTKDTDSLDNELTENVRLMLAQFANII--GVCVMCIIYLPWFAIAIPFILLIFV 1031

Query: 309  XVGATIY--GRKIRSISRDLQQS--TGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAI 364
             V       GR+I+ +   +Q+S    NL +V    L G+ T++ + +E++ + + ++ I
Sbjct: 1032 LVSNHYQSAGREIKRLEA-IQRSFVYNNLNEV----LGGMDTIRFYNSEERFMAKSDYLI 1086

Query: 365  RKVFDVGKREALTN---ATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLY- 420
             K+ + G          A      +V   F+ +I L   +      + S+G L  ++L  
Sbjct: 1087 DKMNEAGYLVVCVQRWVAVLLDMIAVC--FALIIALLCVTRQFHISASSVGVLLTYVLQL 1144

Query: 421  -------------TEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYV 467
                         TE   ++V  L ++ +EL   A      +   +  P        P  
Sbjct: 1145 PGLLNTVLRALTQTENDMNSVERLVSYATELPTEAA-----YRKPESSPD-------PSW 1192

Query: 468  PGKGEIKFENVSFSY-PTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYN 526
            P +G+I FE VSF+Y P   A  +  NL+ +I+ G  + + G +G GKSTI S L +   
Sbjct: 1193 PQEGKIDFEEVSFAYRPGLPA--VLKNLSMSINGGEKIGICGRTGAGKSTIMSALYRLNE 1250

Query: 527  PTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTP-TIDEIR-- 583
              SGRI IDG +IS I    LRR L ++ Q+P+L  G+IR N+    P+   + DE+   
Sbjct: 1251 LESGRIIIDGVNISNIGLFDLRRSLSIIPQDPVLFRGTIRKNLD---PFGERSDDELWDA 1307

Query: 584  -----SVSKKCFCHNFITKFSDGYETV-----------IGPKGALLSGGQKQRIAIARAL 627
                 S+ K+       T+ S G   V           +  +G+  S G++Q +A+ARAL
Sbjct: 1308 LSRGGSIDKESL-EEVKTQKSTGNSKVQELHKFHLDQEVEEEGSNFSLGERQLLALARAL 1366

Query: 628  IKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGD 687
            ++   +LILDEATS++D E++  I   + +     + TI+ IAHRL TI   + ++VL +
Sbjct: 1367 VRNSKVLILDEATSSVDYETDNKIQNRIIEAFS--ECTILCIAHRLKTILNYDRILVL-E 1423

Query: 688  DGSVVEMGKFKELY 701
             G + E      LY
Sbjct: 1424 KGEIAEFDSPYNLY 1437

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 63/211 (29%), Positives = 104/211 (49%), Gaps = 20/211 (9%)

Query: 491 FNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRH 550
           F ++N  I  G  + + GP G GK+++ + +      T G + I+G+ +           
Sbjct: 604 FKDINLEIHKGEFIMITGPIGTGKTSLLNAMSGLMEKTEGSVQINGELL----------- 652

Query: 551 LGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKG 610
              +   P + + ++RDNI +G P+  +  +   V K C     +     G  T IG +G
Sbjct: 653 ---MGGYPWIQNATVRDNIIFGSPFDKS--KYNMVVKACCLDADLDILPAGDMTEIGERG 707

Query: 611 ALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI-NYTLGQLMKSRDITIISI 669
             LSGGQK RI +AR + K  +I + D+  SA+D      I +  L  L+  +  T +  
Sbjct: 708 INLSGGQKARINLARCVYKNKDIYLFDDVLSAVDSRVGKLIMDECLLGLLNGK--TRVLA 765

Query: 670 AHRLSTIRRSENVIVLGDDGSVVEMGKFKEL 700
            H+LS +  +  VIVLG+DGS V++G  +EL
Sbjct: 766 THQLSLVENASRVIVLGNDGS-VDIGTVEEL 795

>Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015W
            (REAL)
          Length = 1557

 Score =  140 bits (352), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 147/551 (26%), Positives = 246/551 (44%), Gaps = 47/551 (8%)

Query: 189  VWG-LGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFD 247
            VW  +G+Y  + V + A     F N   +++L     +   +L  ++ K  I     FF+
Sbjct: 1017 VWMFVGVYSLIGVGSAA-----FNNLRSIMMLLYCSIRGSKKLHESMAKSVIKSPMIFFE 1071

Query: 248  RNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXX 307
               VG +I+R SSD   V  S+    S  FK+I+   V + ++ +               
Sbjct: 1072 TTPVGRIINRFSSDMDAVDSSLQYIFSFFFKSILTYLVTVILVGYNMPWFLVFNMFLLGI 1131

Query: 308  XXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTV------QSFVAEQKEIKRYN 361
                 T Y    R + R +  S   +  +  E L+G   +      + F+    E  +YN
Sbjct: 1132 YIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYN 1191

Query: 362  HAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYT 421
                  F    R          +T VL   + ++ LA    +  +  LS G +   M Y+
Sbjct: 1192 IDFVFNFRSTNRWLSVRLQTIGATIVLA--TAMLTLA---TMNTKKQLSSGMVGLLMSYS 1246

Query: 422  -EYSGSAVFGLSNFYSELMKGAGAAS-----RLFELTDHQPSIYATKGV-PYVPGKGEIK 474
             E +GS  + +    + +M      S        EL     SI   K      P +G I+
Sbjct: 1247 LEVTGSLTWIVR---TTVMIETNIVSVERIVEYCELPSEAQSINPEKRPDKNWPSRGSIE 1303

Query: 475  FENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITI 534
            F++ S  Y   + + +  ++N  I+    V +VG +G GKST++  L +   PT G+I I
Sbjct: 1304 FKDYSTKY-RENLDPVLKDINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIII 1362

Query: 535  DGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNF 594
            DG +IS +    LR HL ++ Q+     G+++ N+     Y+   DE++   +       
Sbjct: 1363 DGINISDLGLFDLRSHLAIIPQDAQAFEGTVKTNLDPFNRYSE--DELKKAVELAHLKPH 1420

Query: 595  ITKF-----SDGYETV---------IGPKGALLSGGQKQRIAIARALIKKPNILILDEAT 640
            + K      SD  E+          I   G+ LS GQ+Q + +ARAL+ +  IL+LDEAT
Sbjct: 1421 LEKMLENEPSDSEESCDIKDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDEAT 1480

Query: 641  SALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKEL 700
            +++D+E++  I  T+ +  K R  TI++IAHR+ T+  S+ +IVL D+GSV E     +L
Sbjct: 1481 ASIDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DEGSVKEFDSPSKL 1537

Query: 701  YASKESKLYKL 711
             ++K S  Y L
Sbjct: 1538 LSNKASIFYSL 1548

 Score =  103 bits (256), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 118/479 (24%), Positives = 218/479 (45%), Gaps = 80/479 (16%)

Query: 278 KAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVA 337
           KA+I G + + +M  I++                     RK++ +S+   +      K  
Sbjct: 434 KAVIGGLITMAIMMPINA------------------FLSRKVKKLSKTQMRYKDMRIKTI 475

Query: 338 EEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVG---KREALTNATFFS--------STS 386
            E L+ +K+++ +  E+  +KR NH +R   ++    K   ++N  +F+        + S
Sbjct: 476 TELLNAIKSIKLYAWEEPMMKRLNH-VRNDMELKNFRKIGIVSNLIYFAWNCVPLMVACS 534

Query: 387 VLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAAS 446
             G FS        +   L  ++    L+ F +      SA++ + +  + +++ + +  
Sbjct: 535 TFGLFSLF------NDSPLSPAIVFPSLSLFNIL----NSAIYSVPSMINTIIETSVSMK 584

Query: 447 RL--FELTDHQPSIYATKGVPYVPGKG--EIKFENVSFSYPTRSA---NQIFNNL----- 494
           RL  F L+D     +  +  P V  +    I+  N++F + ++ A   +Q+ NN      
Sbjct: 585 RLKSFLLSDEIDDSFIERIDPSVDERTLPVIEMNNITFLWKSKEALASSQLENNSRADEE 644

Query: 495 --------------NFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSG-RITIDGQDI 539
                         +F    G+ VC+VG  G GKST    +L      SG + +I  + I
Sbjct: 645 SAMGSSQIALKNIDHFEAKRGNLVCIVGRVGAGKSTFLKAILGQLPCMSGSKESIPPKLI 704

Query: 540 SKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFS 599
            + S+      L    QE  +M+ S+++NI +G  +     ++    K C     +    
Sbjct: 705 IRSSS------LAYCSQESWIMNASVKENILFGHKFDKAYYDL--TIKACQLLPDLRILP 756

Query: 600 DGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTL-GQ 657
           DG ET++G KG  LSGGQK R+++ARA+  + +I +LD+  SA+D E S+  I Y L G+
Sbjct: 757 DGDETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGK 816

Query: 658 LMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELY--ASKESKLYKLLNE 714
               ++ TII   + +S ++ S+ +  L ++G +VE G +  +    +  SKL KLL E
Sbjct: 817 KALLKNKTIILTTNTVSILKHSQMIYAL-ENGEIVEQGNYDSVMNRENSTSKLKKLLEE 874

>NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_4.6
          Length = 1657

 Score =  140 bits (352), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 136/560 (24%), Positives = 247/560 (44%), Gaps = 67/560 (11%)

Query: 217  VLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDG 276
            VL  +LG +   ++  +++ +T+H    FFD   +G +++R S D   V + +T  +   
Sbjct: 1128 VLNFVLGIRASRKIFESLLYRTLHAKLGFFDATPIGRIMNRFSKDIESVDQELTPYLEAA 1187

Query: 277  FKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKV 336
            F  ++     + ++  I+               +    Y    R + R    S   + + 
Sbjct: 1188 FFCLVQCIATMALITFITPQFLSVAILVGCLYYLVGYFYMAASRELKRFESISKSPIYQH 1247

Query: 337  AEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLI- 395
              E L GV T++++  E + +    H I +           N  FF         SF I 
Sbjct: 1248 FSETLVGVATIRAYGDESRFMLENLHKIDE----------NNKPFFYLWVFNRWLSFRID 1297

Query: 396  ----VLAYGSHLVLQGSLSIGD-------LTAFMLYTEYSGSAVFGLSNFYSELMKGAGA 444
                 + +G+ + +  ++   D       LT  + +TE        L  FY+++     +
Sbjct: 1298 MIGAFVIFGAGVFILTNIKNIDSGMAGISLTYAISFTE----GALWLVRFYADVEMNMNS 1353

Query: 445  ASRLFELTDHQPSIYATKGVPYV----PGKGEIKFENVSFSYPTRSANQIFNNLNFTIDS 500
              RL E  + +   Y       +    P  G+I+ +++S  Y   +  ++  N++F ++ 
Sbjct: 1354 VERLKEYMEIEQEPYDEYKDTLLHDEWPSNGKIEVKDLSLRYAP-NLPKVIKNVSFVVEP 1412

Query: 501  GSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPIL 560
             + + +VG +G GKSTI + + ++ NP SG I ID  +I+ I+   LRR + ++ Q+P L
Sbjct: 1413 KTKIGIVGRTGAGKSTIITAMFRFLNPESGYIKIDDVNIASINLTKLRRSITIIPQDPTL 1472

Query: 561  MSGSIRDNITYGVPYTP-TIDEIRSVSKKCFCHNFIT------------------KFSDG 601
             +G+I+ N+    PY   T D I    K+    N +T                  KF + 
Sbjct: 1473 FTGTIKLNLD---PYNEFTDDAIFEALKRV---NLVTEEELQNNGTQTGTSENANKFLN- 1525

Query: 602  YETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKS 661
             E  I   G+ LS GQ+Q + +AR+L++ P I++LDEAT+++D  S+  I  T+ +    
Sbjct: 1526 LENEITEGGSNLSHGQRQLVCLARSLLRNPKIILLDEATASIDYASDAKIQETIRKEFSQ 1585

Query: 662  RDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKDTTS 721
               TI++IAHRL ++   + +IV+ D G V E      L   K S  Y +  +  +    
Sbjct: 1586 S--TILTIAHRLRSVIDYDKIIVM-DAGEVKEYDHPYSLLLDKNSNFYSMCEQSGE---- 1638

Query: 722  KMNAETVEKNDPSPKTEKLN 741
                ET+ +   +   EKLN
Sbjct: 1639 ---LETLIEMAKAAFVEKLN 1655

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 109/229 (47%), Gaps = 11/229 (4%)

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           I F+NV+ ++     +    +LN     G+   V+GP+G GK+++   LL       G I
Sbjct: 711 IAFKNVTVTWDNGEEDFKLRDLNIEFKPGALNVVIGPTGSGKTSLLLALLGEMCLEKGEI 770

Query: 533 TIDG----QDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKK 588
            +      QD+  I    L   +    Q   L++ ++R+NI +  PY    +   +V   
Sbjct: 771 IVPALNPRQDLV-IDKFGLTNSIAYCSQAAWLLNETVRNNILFNSPYNE--ERYNAVIDA 827

Query: 589 CFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESE 648
           C     +        T IG KG  LSGGQKQR+++ARAL      ++LD+  SA+D  + 
Sbjct: 828 CGLRRDLKILKASDMTEIGEKGITLSGGQKQRVSLARALYSNSKHVLLDDCLSAVDSHTA 887

Query: 649 GAI--NYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMG 695
             I  N   G LM  R  T I ++H ++   ++  ++V+ ++G V + G
Sbjct: 888 LWIYDNCITGPLMSGR--TCILVSHNIALTLKNAELVVILENGRVKDQG 934

>TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4.6
            YHL035C
          Length = 1649

 Score =  139 bits (351), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 134/528 (25%), Positives = 230/528 (43%), Gaps = 49/528 (9%)

Query: 234  VIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHI 293
            ++ + ++    FFD   +G +++R S D  V+   +   +   F   I     + ++  I
Sbjct: 1139 LLYRVVNSKLTFFDNTPIGRIMNRFSKDIQVLDSELAPFLDGVFSCFIQAVTALMLIVFI 1198

Query: 294  SSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAE 353
            +                   +Y    R + R    S   + +   E LSG+ T+++F  E
Sbjct: 1199 TPKFLIIAIFIICSSITIGYLYLCCSRELKRFESSSKSPVYQHFTETLSGLVTIRAFGNE 1258

Query: 354  QKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLI-------VLAYGSHLVLQ 406
             K +K     I +           N  FF   SV    SF I       V   G+ ++L 
Sbjct: 1259 IKFLKENLDFIDE----------NNKFFFYMWSVNSWLSFRIDLLGAITVFGSGAFILLN 1308

Query: 407  GS-----LSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYAT 461
                   L+   LT  + +TE+       +  FYS +     +  RL E  + +    A 
Sbjct: 1309 ADKIDAGLAGISLTYAVTFTEF----CLWMVKFYSTVEMSMNSVERLKEYMEIEEEALAD 1364

Query: 462  KGV----PYVPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTI 517
             G        P +G I F N S  Y  +  + +   LN  ID GS + VVG +G GKSTI
Sbjct: 1365 PGAITPSENWPVQGAITFANYSLRYAPKLPD-VLKQLNLKIDGGSKIGVVGRTGAGKSTI 1423

Query: 518  ASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYT- 576
             S L ++ + +SG+I ID  DIS+I+ + LR  L ++ Q+P L  G+IR N+     Y  
Sbjct: 1424 ISALFRFLDCSSGKILIDDLDISEINLRRLRSCLTIIPQDPSLFVGTIRSNLDPNEEYEN 1483

Query: 577  ----PTIDEIRSVSKKCFCH-NFITKFSDGY--------ETVIGPKGALLSGGQKQRIAI 623
                  + ++  +++    + N+       Y        ++ I   G  LS GQ+Q I +
Sbjct: 1484 KDIYDALVKVHLLTEDYLANLNYDANADVAYDENIFLNLDSPISEGGINLSQGQRQLICL 1543

Query: 624  ARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVI 683
            AR+++    I++LDEAT+++D +S+  +  T+      +  TI++IAHR+ ++   + ++
Sbjct: 1544 ARSILHCSKIVLLDEATASIDYKSDFKVQETIRNEFSQK--TILTIAHRIKSVIDYDKIL 1601

Query: 684  VLGDDGSVVEMGKFKELYASKESKLYKLLNEKAK-DTTSKMNAETVEK 730
            VL D G  +E      L  +K S  Y +  +  + D   K+  E  EK
Sbjct: 1602 VL-DAGQALEFDHPYVLLQNKSSIFYSMCMQSGELDILLKLAREAYEK 1648

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 69/211 (32%), Positives = 115/211 (54%), Gaps = 13/211 (6%)

Query: 493 NLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKIS----AKSLR 548
           N+N   + G    V+GP+G GK+++   LL   +  SG++ +   + SK +    + +L 
Sbjct: 734 NINAEFEMGKLNLVIGPTGSGKTSLLMALLGELHLFSGKVFVPNLE-SKFNLIPESDNLL 792

Query: 549 RHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGP 608
             +    Q P + + +IR+NI + + Y    D   +V   C         + G +T++G 
Sbjct: 793 NSIAYCSQLPWIFNDTIRNNIIFDMGYDK--DRYENVVIACGLERDFQILNLGDKTIVGD 850

Query: 609 KGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI-NYTL-GQLMKSRDITI 666
           KG+ LSGGQKQRI++ARAL  K   LILD+  SA+D  S   I N  + G LM+ R  T 
Sbjct: 851 KGSCLSGGQKQRISLARALYSKSRHLILDDCLSAVDSHSAKWIYNVCITGPLMQGR--TC 908

Query: 667 ISIAHRLS-TIRRSENVIVLGDDGSVVEMGK 696
           I ++H +S TI+++  V ++ ++G +V  G+
Sbjct: 909 ILVSHNVSLTIKKASKVFMI-ENGYIVASGR 938

>Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON}
            YGR281W (REAL)
          Length = 1477

 Score =  139 bits (350), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 144/569 (25%), Positives = 262/569 (46%), Gaps = 74/569 (13%)

Query: 182  LRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQ 241
             ++ PP  + +GLY F  VFA  + ++     G+  +L  +G      L    +++ +H 
Sbjct: 926  FKNRPPSFY-MGLYSFF-VFAAFIFMN-----GQFTILCAMGIMASKCLNLRAVRRILHT 978

Query: 242  DAEFFDRNKVGDLISRLSSDAYVVSRSMTQNI---SDGFKAIICGGVGIGMMFHISSXXX 298
               + D   +G +++R + D   +   +T+++   +  F  I+  GV +  + ++     
Sbjct: 979  PMSYIDTTPLGRILNRFTKDTDSLDNELTESLRLMTSQFANIV--GVCVMCIVYLPWFAI 1036

Query: 299  XXXXXXXXXXXVGATIY--GRKIRSISRDLQQS--TGNLTKVAEEQLSGVKTVQSFVAEQ 354
                       +       GR+I+ +   +Q+S    NL +V    L G+ T++++ +++
Sbjct: 1037 AIPFLLVVFVLIADHYQSSGREIKRLEA-VQRSFVYNNLNEV----LGGMDTIKAYRSQE 1091

Query: 355  KEIKRYNHAIRKVFDVGKREALTN---ATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSI 411
            + + + +  I K+ + G    +       F    ++   F+ +I L   +      + S+
Sbjct: 1092 RFLAKSDFLINKMNEAGYLVVVLQRWVGIFLDMVAIA--FALIITLLCVTRAFPISAASV 1149

Query: 412  GDLTAFMLYTEYSGSAVFGLSNFYSELM----KGAGAASRLFELTDHQPSIYATKGVPYV 467
            G L  ++L        + GL N     M        +A RL       P + A    P +
Sbjct: 1150 GVLLTYVL-------QLPGLLNTILRAMTQTENDMNSAERLVSYATKLP-LEADYRKPEM 1201

Query: 468  ------PGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLL 521
                  P KG+I FENV F+Y       +  N N  I SG  + + G +G GKSTI S L
Sbjct: 1202 TPPESWPSKGKIVFENVDFAY-RPGLPIVLKNFNLDIKSGEKIGICGRTGAGKSTIMSAL 1260

Query: 522  LKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDE 581
             +    T+G+I ID  DIS++    LR+ L ++ Q+P+L  G+IR N+    P+    D+
Sbjct: 1261 YRLNELTAGQIFIDDVDISQLGLFDLRKKLAIIPQDPVLFRGTIRKNLD---PFDERTDD 1317

Query: 582  ------IR--SVSKKCF------------CHNFITKFSDGYETVIGPKGALLSGGQKQRI 621
                  +R  +++K                H  + KF    +  +  +G+  S G++Q +
Sbjct: 1318 ELWDALVRGGAIAKNDLPEVRLQKPDENGTHGRMHKFH--LDQAVEEEGSNFSLGERQLL 1375

Query: 622  AIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSEN 681
            A+ RAL+++  ILILDEATS++D E++G I   + +  +  D TI+ IAHRL TI   + 
Sbjct: 1376 ALTRALVRQSKILILDEATSSVDYETDGKIQTRIVE--EFGDCTILCIAHRLKTIVNYDR 1433

Query: 682  VIVLGDDGSVVEMGKFKELYASKESKLYK 710
            ++VL + G V E      L+ S+E  ++K
Sbjct: 1434 ILVL-EKGEVAEYDTPWALF-SQEDSIFK 1460

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 69/218 (31%), Positives = 112/218 (51%), Gaps = 22/218 (10%)

Query: 491 FNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRH 550
           F +LNF I  G  + + GP G GKS++ + +        G+I ++G D+           
Sbjct: 604 FKDLNFDIQKGEFIMITGPIGTGKSSLLNAMAGSMRKVDGKIEVNG-DL----------- 651

Query: 551 LGVVQQEPILMSGSIRDNITYGVPYT-PTIDEIRSVSKKCFCHNFITKFSDGYETVIGPK 609
             ++   P + + ++RDNI +G P+     DE+  V   C     +     G  T IG +
Sbjct: 652 --LMCGYPWIQNATVRDNIIFGSPFNKEKYDEVIHV---CSLKADLDILPAGDMTEIGER 706

Query: 610 GALLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTLGQLMKSRDITIIS 668
           G  LSGGQK RI +AR++ KK +I + D+  SA+D    +  ++  L  ++ ++  T I 
Sbjct: 707 GITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLSNK--TRIL 764

Query: 669 IAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKES 706
             H+LS I R+  VIVLG DG  V++G  +EL A  ++
Sbjct: 765 ATHQLSLIERASRVIVLGTDGK-VDIGTVEELKARNKT 801

>KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1546

 Score =  139 bits (349), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 150/558 (26%), Positives = 241/558 (43%), Gaps = 75/558 (13%)

Query: 201  FAGALVL----STFANFGR-VVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKVGDLI 255
            F G  VL    + F N  R +VLL +   +   +L  ++    +     FF+   VG +I
Sbjct: 1016 FVGIYVLISLGAAFFNSARSIVLLLVCSIRASRKLHDSMAVAVLRSPMSFFETTPVGRII 1075

Query: 256  SRLSSDA--------YVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXX 307
            +R SSD         YV+S  +  +I D    ++  G  + +   +++            
Sbjct: 1076 NRFSSDMNSVDDNVQYVISFFLI-SILDYVVVVVIIGYQVPLFLLVNAAL---------- 1124

Query: 308  XXVGATIYGRKI-----RSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNH 362
              +G  +Y +       R + R +  S   +  +  E L+G   + +F          NH
Sbjct: 1125 --LGIYLYYQVFYVTLSRELKRLMSTSFSPIMSMLSETLAGHMVINAF----------NH 1172

Query: 363  AIRKVFDVGKREAL---TNATF-FSSTSV-----LGDFSFLIVL--AYGSHLVLQG--SL 409
              R  FD    EA+    N  F F ST+      L     L++L  A  S     G  +L
Sbjct: 1173 FSR--FDYLNIEAVQFNINCVFNFRSTNRWLSIRLESIGALMILTTALLSLATTTGDKAL 1230

Query: 410  SIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPS----IYATKGVP 465
            S G +   M Y     + +  +     +L     +  R+ E  D  P     I   +   
Sbjct: 1231 STGMVGLLMSYALQVTNKLMWIVRMSVQLETNVVSVERIVEYCDLPPEAPPVIEDCRPEK 1290

Query: 466  YVPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYY 525
              P +G + F++ S  Y   + + +   LN  I+    + +VG +G GKST++  L +  
Sbjct: 1291 NWPAQGHVVFKDYSARY-RENLDPVLKKLNVEINPQEKIGIVGRTGAGKSTLSLALFRIL 1349

Query: 526  NPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSV 585
             P  G I IDG DI+KI    LR HL ++ Q+     GS+R N+     Y+   DEI   
Sbjct: 1350 EPCGGTIVIDGVDITKIGLADLRSHLSIIPQDAQAFEGSVRSNLDPFEQYSD--DEIWRA 1407

Query: 586  SKKCFCHNFITKFSDG---------YETVIGPKGALLSGGQKQRIAIARALIKKPNILIL 636
             +       I K ++           ET I   G+ LS GQ+Q + ++RAL+ +  IL+L
Sbjct: 1408 LELSHLKPHILKMANEEGPEKTKNLLETKISENGSNLSVGQRQLLCLSRALLNRSRILVL 1467

Query: 637  DEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGK 696
            DEAT+A+D E++  I  T+    K R  TI++IAHR+ T+  S+ ++VL D G V E   
Sbjct: 1468 DEATAAVDSETDRLIQETIRAEFKDR--TILTIAHRIDTVMDSDKIMVL-DQGEVKEFDS 1524

Query: 697  FKELYASKESKLYKLLNE 714
               L A K +  Y L ++
Sbjct: 1525 PSNLLADKNTIFYNLCSQ 1542

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 113/457 (24%), Positives = 209/457 (45%), Gaps = 47/457 (10%)

Query: 317 RKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDV---GKR 373
           RKI+ + +   +      K   E L+ VKTV+ +  E+  +KR +H +R   ++    K 
Sbjct: 459 RKIKVLIKKQMEYKDARIKTVTEILNSVKTVKLYAWEEPMLKRLDH-VRNELELESFKKI 517

Query: 374 EALTNATFFSSTSV--LGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGL 431
             + N T F+   V  L   S  ++ A    + L   +    L+ F +  +   +    +
Sbjct: 518 AVMNNLTLFAWNCVPILVASSTFLIYALVMDVPLTPQIVFPSLSLFDILNDCIYTIPRTI 577

Query: 432 SNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKFENVSF--SYPTRSANQ 489
            NF  E     G         +   S    + +P  P    I+  N +F  + PT++ ++
Sbjct: 578 INFI-ETGVSMGRLKDFLLAKELDKSFIEFESLPDDPNVPVIEVHNATFLRNLPTKATSE 636

Query: 490 --------------IFNNLN-FTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITI 534
                            N++ F    G  VCVVG  G GKST    LL       G++  
Sbjct: 637 ENYDEEAMIESSRVALKNIDGFQALKGQLVCVVGRVGAGKSTFLHALL-------GQLPC 689

Query: 535 DGQDISKISAKSLRR--HLGVVQQEPILMSGSIRDNITYGVPYTPTIDE--IRSVSKKCF 590
                 + + K   R   + +  Q+  +++ S++ N+ +G  Y    DE   ++  + C 
Sbjct: 690 ISSSHDQATPKMHFRCDSVALCSQQAWILNASVKYNVLFGHKY----DEASYKATIEACQ 745

Query: 591 CHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEG 649
               +   +DG ET++G KG  LSGGQK RI++ARA+  + ++ +LD+  SA+D E  + 
Sbjct: 746 LLPDLGILADGDETLVGEKGISLSGGQKARISLARAVYSRSDVYLLDDILSAVDAEVCKR 805

Query: 650 AINYTLGQ---LMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYA-SKE 705
            I++ L +   L+K++  T+I   + +S ++ S+++  L ++G +VE G F E+ +   E
Sbjct: 806 IIDHVLSRKTGLLKNK--TVILTTNSISVLKHSQSIYAL-ENGEIVERGSFDEIMSKDAE 862

Query: 706 SKLYKLLNEKAKDTTSKMNAETVEKNDPSPKTEKLND 742
           SKL  L+ E   D+++  + E + +  P    +++ D
Sbjct: 863 SKLKTLIAEFGSDSSAVKDDEPIPEQKPPVDLQEVED 899

>TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1514

 Score =  139 bits (349), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 90/248 (36%), Positives = 136/248 (54%), Gaps = 7/248 (2%)

Query: 468  PGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNP 527
            P KG+IKFE+ S  Y   + N +  ++N  +     + +VG +G GKS++   L +    
Sbjct: 1269 PSKGDIKFEHYSTRY-RENMNLVLKDINLHVKPQEKIGIVGRTGAGKSSLTLALFRIIEA 1327

Query: 528  TSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSK 587
              GRI IDG  I++I    LR  L ++ Q+  +  G++R+NI     Y+   +EI  V +
Sbjct: 1328 AEGRIVIDGVPINEIGLHDLRHKLSIIPQDSQVFEGTVRENIDPTNQYSD--EEIWRVLE 1385

Query: 588  KCFCHNFITKFS-DGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVE 646
                 N +   S DG  T +   GA LS GQ+Q + +ARAL+    ILILDEAT+A+DVE
Sbjct: 1386 LSHLKNHVLSMSKDGLMTRLTEGGANLSVGQRQLMCLARALLIPSRILILDEATAAVDVE 1445

Query: 647  SEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKES 706
            ++  I  T+    K R  TI++IAHRL+TI  S+ ++VL D G V E    + L   + S
Sbjct: 1446 TDQVIQETIRTAFKDR--TILTIAHRLNTIMDSDRILVL-DAGEVREFDTPENLLKQQGS 1502

Query: 707  KLYKLLNE 714
              Y L ++
Sbjct: 1503 IFYSLCSD 1510

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 84/338 (24%), Positives = 151/338 (44%), Gaps = 57/338 (16%)

Query: 416 AFMLYTE---------YSGSAVFGLSNF--------YSELMKGAGAASRLFE-LTDHQPS 457
           A  +YTE         +   A+F L +F         +  ++ + + +RL+  LT+ +  
Sbjct: 554 AVFVYTEKKPLTTDLVFPALALFNLLSFPLNVVPMVLTAFIEASVSVNRLYSFLTNEELQ 613

Query: 458 IYATKGVPYVPGKGEIKF---ENVSFSYPTRSANQI-FNNLNFTIDSGSNVCVVGPSGRG 513
             A   +P     G++     ++ +F +  +   Q+   N+N  +  G   CVVG  G G
Sbjct: 614 KDAVHHLPKAQKAGDVAIKISDDANFLWKRKPQYQVALKNINLEVKKGELACVVGKVGSG 673

Query: 514 KSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGV 573
           KS +   LL       G   + G                 V Q P +M+G+++DNI +G 
Sbjct: 674 KSALVQSLLGDLYRVKGYAAVHGST-------------AYVSQVPWIMNGTVKDNILFGH 720

Query: 574 PYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNI 633
            Y P   ++    K C     +    DG +T++G KG  LSGGQK R+++ARA   + + 
Sbjct: 721 KYDPVFYDL--TIKACALTIDLGILPDGDQTMVGEKGISLSGGQKARLSLARATYARADT 778

Query: 634 LILDEATSALDVE-SEGAINYTLG---------QLMKSRDITIISIAHRLSTIRRSENVI 683
            +LD+  +A+D   ++  I + LG         +L+ +  IT++SIA  +S +       
Sbjct: 779 YLLDDPLAAVDEHVAQHLIEHVLGPRGLLKSKTKLLATNKITVLSIASSISLV------- 831

Query: 684 VLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKDTTS 721
              + G +++ G ++++    +S L  L+ E  K  TS
Sbjct: 832 ---EGGEIIQHGSYEDISKDLDSPLSNLVKEFGKKKTS 866

>SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar to
            uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1439

 Score =  138 bits (347), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 146/564 (25%), Positives = 248/564 (43%), Gaps = 63/564 (11%)

Query: 192  LGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKV 251
            +GLY F  VF     +S      +  +L  +G      L    +K+ +H    F D   +
Sbjct: 896  IGLYIFF-VFVNYFFMSL-----QFTILCYIGLAASKWLNLKAVKRLLHTPMSFMDTTPL 949

Query: 252  GDLISRLSSDAYVVSRSMTQNISDG-FKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXV 310
            G +++R + D   +   +T+++    ++     GV I  + ++                V
Sbjct: 950  GRVLNRFTKDTDTLDNELTESVRLFVYQTANIAGVIIMCIIYLPWFAIAVPFLGLIFIIV 1009

Query: 311  GATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDV 370
             A  Y    R I R        +     E LSG+ T++++ +E + + + +  I ++ + 
Sbjct: 1010 -ADHYQSSGREIKRLEAVQRSFVYNNFNEVLSGMDTIKAYKSENRFLMKSDFLINRMSEA 1068

Query: 371  GKRE-ALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLY--------- 420
            G    A+      S   +   F+ +I L   +      + S+G L  ++L          
Sbjct: 1069 GYLVVAVQRWVSISLDMIAVAFALIITLLCVTRQFDISAASVGVLLTYVLQLPGLLNGLL 1128

Query: 421  -----TEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKF 475
                  E   ++V  + N+ +EL + A  A R  E+T  +P           P  GE+ F
Sbjct: 1129 RAMTQAENDMNSVERIVNYATELPQEA--AYRKPEMTPQEPW----------PSNGEVVF 1176

Query: 476  ENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITID 535
            +NVS SY       +   ++  I  G  + + G +G GKSTI S L +      GR+ ID
Sbjct: 1177 DNVSLSYRP-GLPLVLKGVSLNIKGGEKIGICGRTGAGKSTIMSALYRLCELNEGRVLID 1235

Query: 536  GQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDE------IRS----- 584
            G D SK+    LRR L ++ Q+P+L  GSIR N+    P+    DE      +RS     
Sbjct: 1236 GVDTSKLGLYDLRRKLSIIPQDPVLFKGSIRKNLD---PFGEREDEELWSALVRSGTIEA 1292

Query: 585  --VSKKCFCHNFITKFSDGYETV-----IGPKGALLSGGQKQRIAIARALIKKPNILILD 637
              V K    H   +  S G         +   G   S G++Q +A+ RAL+++  ILILD
Sbjct: 1293 EEVEKVKNQHRDESGSSTGLHKFHLDQEVEDDGTNFSLGERQLLALTRALVRQSKILILD 1352

Query: 638  EATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKF 697
            EATS++D E++  I   + Q  +    TI+ IAHRL TI   + ++VL D+G+V E    
Sbjct: 1353 EATSSVDHETDAKIQSLIAQ--EFNRCTILCIAHRLKTILNYDRLVVL-DNGTVKEFDTP 1409

Query: 698  KELYASKESKLYKLLNE---KAKD 718
            + L+  K++   ++ ++   KA+D
Sbjct: 1410 RSLFRIKDTIFREMCDKSGIKAED 1433

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 77/256 (30%), Positives = 124/256 (48%), Gaps = 26/256 (10%)

Query: 479 SFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQD 538
           +F+   +++   F NLNF I  G  V + G  G GKS++ + L  +   T G I  +G  
Sbjct: 559 AFASSEKASFSGFKNLNFQIQKGELVIITGSIGTGKSSLLNALAGFMKKTEGDIFKNG-- 616

Query: 539 ISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIR--SVSKKCFCHNFIT 596
                  SL     ++   P + + ++RDNI +G  +    D++R   V + C     + 
Sbjct: 617 -------SL-----LLCGYPWIQNTTVRDNILFGSSF----DDVRYKEVIRVCALQADLD 660

Query: 597 KFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTL 655
               G  T IG +G  LSGGQK RI +AR++ K  +I + D+  SA+D    +  ++  L
Sbjct: 661 ILPAGDFTEIGERGITLSGGQKARINLARSVYKSMDIYLFDDVLSAVDARVGKHIMDECL 720

Query: 656 GQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEK 715
             ++  +  T I   H+LS I R+  VI LG  GS  ++G  +EL   + S   KL+ E 
Sbjct: 721 MGMLDGK--TRILATHQLSLIERASRVIFLGAGGS-FDIGTVEEL-KERNSGFVKLM-EF 775

Query: 716 AKDTTSKMNAETVEKN 731
           +  T S    E V+ +
Sbjct: 776 STQTKSANQREEVDDH 791

>KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1442

 Score =  137 bits (346), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 142/555 (25%), Positives = 252/555 (45%), Gaps = 72/555 (12%)

Query: 192  LGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKV 251
            +G+Y F  VF   L    F N  +  LL  LG +    L    +++ +H    + D   +
Sbjct: 901  MGMYSFF-VFGAYL----FMNL-QFTLLCTLGLRASKWLNLKAVERILHTPMSYLDTTPL 954

Query: 252  GDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVG--IGMMFHISSXXXXXXXXXXXXXX 309
            G +++R + D   +   +T++I      ++   VG  IG++                   
Sbjct: 955  GRILNRFTKDTDSLDNELTESIR-----LMLSQVGNLIGVIVMCIVYLPWFAIAVPFLLI 1009

Query: 310  VGATIY------GRKIR---SISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRY 360
            +   I       GR+I+   ++ R    +  N      E L G+ T++++ ++++ + + 
Sbjct: 1010 IFVLICDHYQSTGREIKRLEAVQRSFVYNNFN------EVLGGMDTIKAYGSQERFLAKT 1063

Query: 361  NHAIRKVFDVGKREALTN---ATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAF 417
            ++ I K+ + G          A    S +V+  F+ +I L   +      + S+G L  +
Sbjct: 1064 DYLINKMNEAGYLIVAVQRWVAILLDSVAVV--FALIITLLCVTRAFPISAGSVGVLLTY 1121

Query: 418  MLYTEYSGSAVFGLSNF----YSELMKGAGAASRLFELTDHQPSIYATKGVPYV------ 467
            +L        + GL N      ++      +A RL       P + A    P V      
Sbjct: 1122 VL-------QLPGLLNTILRALTQTENDMNSAERLVTYATELP-LEAAYRKPEVSPPESW 1173

Query: 468  PGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNP 527
            P KG+I F +V+F+Y       +  N+N  I++G  + + G +G GKSTI S L +    
Sbjct: 1174 PEKGDIDFIDVNFAYRP-GLPVVLKNMNLKINNGEKIGICGRTGAGKSTIMSALYRLNEL 1232

Query: 528  TSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDN----------------ITY 571
            + G+I IDG DI KI    LR+ L ++ Q+P+L  G+IR N                I  
Sbjct: 1233 SDGKIVIDGVDIRKIGLYDLRKKLTIIPQDPVLFRGTIRKNLDPFKECSDDLLWDALIRT 1292

Query: 572  GVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKP 631
            GV     +++I+ + K    +++        + ++  +G+  S G++Q +A+ RAL++  
Sbjct: 1293 GVVERENLNDIK-LEKPDENNSYSNMHKFHLDELVEEEGSNFSLGERQMLALTRALVRNS 1351

Query: 632  NILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSV 691
             ILILDEATS++D E++G I   +  + +  D TI+ IAHRL TI   + ++VL + G +
Sbjct: 1352 KILILDEATSSVDYETDGKIQSRI--VSEFGDCTILCIAHRLKTILSYDKILVL-EKGVI 1408

Query: 692  VEMGKFKELYASKES 706
             E  K  EL+  K S
Sbjct: 1409 AEYEKPWELFNDKNS 1423

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 66/213 (30%), Positives = 110/213 (51%), Gaps = 24/213 (11%)

Query: 491 FNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRH 550
           F +LN  I  G  + V GP G GK+++ + +  +   TSGR+ ++G+ +           
Sbjct: 581 FTDLNLEIFKGEFIIVTGPIGTGKTSLLNAMAGFMKQTSGRVEVNGELL----------- 629

Query: 551 LGVVQQEPILMSGSIRDNITYGVPYTPTIDEIR--SVSKKCFCHNFITKFSDGYETVIGP 608
              +   P +++ ++RDNI +G PY    +E R   + + C     +     G  T IG 
Sbjct: 630 ---LCGYPWILNATVRDNILFGSPY----EEARYNEIVEVCSLDADLKILPAGDRTEIGE 682

Query: 609 KGALLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTLGQLMKSRDITII 667
           +G  LSGGQK RI +ARA+ K  +I + D+  SA+D    +  ++  L  ++K +  T I
Sbjct: 683 RGITLSGGQKARINLARAVYKNKDIFLFDDVLSAVDSRVGKHIMDDCLLGILKGK--TRI 740

Query: 668 SIAHRLSTIRRSENVIVLGDDGSVVEMGKFKEL 700
              H+LS I R++ +IV+G +GS  + G   EL
Sbjct: 741 LATHQLSVIERADRIIVVGPNGS-FDFGTLDEL 772

>TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4.6
            YHL035C
          Length = 1642

 Score =  137 bits (345), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 131/501 (26%), Positives = 219/501 (43%), Gaps = 68/501 (13%)

Query: 234  VIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAII-CGGVGIGMMFH 292
            ++ K +H    FFD   +G +++R S D     + +T  I   F +++ C    + + F 
Sbjct: 1128 LLSKVMHAKLRFFDSTPIGRIMNRFSKDMEAADQELTPFIEGAFYSLVQCVSTVVLITFI 1187

Query: 293  ISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVA 352
                             VG   Y    R + R    S   + +   E L GV T+++F  
Sbjct: 1188 TPQFLFVAILVAVLYYFVGY-FYLTGSRELKRLESISRSPIYQHFSETLVGVTTIRAFGD 1246

Query: 353  EQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSF-------LIVLAYGSHLVL 405
            E + ++     I +           N  FF         SF       L++   G  ++L
Sbjct: 1247 ESRFMRENLQKIDE----------NNRPFFYLWVANRWLSFRIDMIGALVIFGAGIFVLL 1296

Query: 406  Q------GSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIY 459
                   G   I  LT  + +TE        L   YS +     +  RL E  D +   Y
Sbjct: 1297 NIDHIDSGKAGIS-LTYAITFTE----GALWLVRLYSNVEMNMNSVERLKEYMDVEQEPY 1351

Query: 460  ----ATKGVPYVPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKS 515
                 T  V + P +G I+  ++S  Y   +  ++  N++FT+D  S V +VG +G GKS
Sbjct: 1352 DQSILTPPVEW-PQQGRIEVNDLSLRYAP-NLPKVIKNVSFTVDPRSKVGIVGRTGAGKS 1409

Query: 516  TIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPY 575
            TI + L ++ +P +G I ID  DI+ I  + LRR + ++ Q+P L +G+I+ N+    PY
Sbjct: 1410 TIITALFRFLDPETGNIKIDNVDITSIDLQRLRRSITIIPQDPTLFTGTIKSNLD---PY 1466

Query: 576  TPTID-EIRSVSKKCFCHNFIT---------------------KFSDGYETVIGPKGALL 613
                D +I    K+    N +T                     KF D   + I   G  +
Sbjct: 1467 DEYTDQQIFEALKRV---NLVTQEELDRRPTSESSSVSSENINKFLD-LSSEISEGGGNI 1522

Query: 614  SGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRL 673
            S GQ+Q + +AR+L++ P I++LDEAT+++D  S+  I  T+ +       TI++IAHRL
Sbjct: 1523 SQGQRQLVCLARSLLRSPKIILLDEATASIDYASDAKIQETIRKEFGGN--TILTIAHRL 1580

Query: 674  STIRRSENVIVLGDDGSVVEM 694
             ++   + ++V+ D G V E 
Sbjct: 1581 RSVIDYDKILVM-DAGEVKEF 1600

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 106/477 (22%), Positives = 209/477 (43%), Gaps = 34/477 (7%)

Query: 236 KKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISS 295
           ++ I+ D E      +G +I+ ++ DA+ VS  +   +    +A++   V   +++H+  
Sbjct: 462 QEQINGDEESTTSANLGAIINLMAVDAFKVSE-ICAYLHAFVEAVVMALVAFVLLYHL-- 518

Query: 296 XXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLT----KVAEEQLSGVKTVQSFV 351
                         V       K+ +    LQ+ T ++T    +   E    ++ ++ F 
Sbjct: 519 --LGFAAIVGAALIVAMMPLNFKLATWLGHLQKETLSVTDKRIQKLNEAFQAIRIIKFFS 576

Query: 352 AEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIV--LAYGSHLVLQGSL 409
            E      +   IR V +   +  +  +  ++ +S +   +  IV   A+  ++ +QG +
Sbjct: 577 WENN----FEKDIRDVRETELKFLMKRSLVWAGSSFVWYITPTIVTSCAFWFYIYIQGEV 632

Query: 410 SIGDLTAFMLYTEYSGSAVF-----GLSNFYSELMKGAGAASRLFELTDHQPSIYATKGV 464
               LT  + +T  S  ++       LS+  S +++   +  R+ E  + + +      +
Sbjct: 633 ----LTTPIAFTALSLFSLLRTPLDQLSDMLSFVIQSKVSLDRVQEFLEEKDT-EKYNQL 687

Query: 465 PYVPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKY 524
                K +I FEN + ++     +    NLN     G    ++GP+G GK+++   LL  
Sbjct: 688 STAKDKKKIGFENATITWDAERPDFKLKNLNIDFKVGKLNVIIGPTGSGKTSLLMALLGE 747

Query: 525 YNPTSGRITIDGQDISK---ISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDE 581
            +  SG+I +   D  +   I A  +   +    Q   L++ ++++NI +  PY      
Sbjct: 748 MHLVSGKIIVPSLDPRQELPIEADGMTNSMAYCSQAAWLLNDTVKNNILFNSPYNE--GR 805

Query: 582 IRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATS 641
             +V + C      +  S G  T IG +G  LSGGQKQRI++AR+L      ++LD+  S
Sbjct: 806 YEAVVEACGLKRDFSILSAGDLTEIGERGITLSGGQKQRISLARSLYSNARHVLLDDCLS 865

Query: 642 ALDVESEGAI--NYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGK 696
           A+D  +   I  N   G LM+ R  T I ++H  +   R+  ++V  ++G V   G+
Sbjct: 866 AVDSHTASWIYDNCITGPLMEGR--TCILVSHNTALTLRNAELVVTMENGQVKNQGE 920

>KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1568

 Score =  137 bits (345), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 143/549 (26%), Positives = 236/549 (42%), Gaps = 51/549 (9%)

Query: 194  LYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTI-HQDAEFFDRNKVG 252
            ++ ++AV+A   V S+     R +++ +      ++L  N +  ++      FF+   VG
Sbjct: 1030 IWKYVAVYALIGVTSSAFELARTIIMMLFCSIRASKLFHNQMAHSVVMAPMSFFETTPVG 1089

Query: 253  DLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGA 312
             +++R SSD   +       IS  F++++   + I ++                      
Sbjct: 1090 RIVNRFSSDVNSIDEDFQHIISFFFRSMLDYLITIVIITVSMPWFLLFNTILLGIYYYYQ 1149

Query: 313  TIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGK 372
            T+Y    R + R    S   +  +  E L G             I  Y HA   +F+   
Sbjct: 1150 TLYVVLSRELKRLTSISYSPVMSLLSETLGG----------HVVINAYKHA--NIFNYYN 1197

Query: 373  REAL-TNATF---FSSTS--------VLGDFSFLI--VLAYGSHLVLQGSLSIGDLTAFM 418
             E + TN  F   F ST+         +G    LI  ++A  S L     +S G +   M
Sbjct: 1198 FENIQTNINFIFNFRSTNRWLSMRLQTIGAVIVLITSLMALAS-LGTSNPISAGLIGLLM 1256

Query: 419  LYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPS----IYATKGVPYVPGKGEIK 474
             Y     S++  +      +     +  R+ E  D +P     I  ++     P +GEI 
Sbjct: 1257 SYALQVSSSLMWIIRMAVNIETTIVSVERIIEYRDLKPEGIRVIEDSRPPKNWPKRGEIT 1316

Query: 475  FENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITI 534
            FE+ +  Y   + + +  +++  I     + VVG +G GKST+   L +   P  G+ITI
Sbjct: 1317 FEHYTTKY-RENLDPVLKDIDLRIKHQEKIGVVGRTGAGKSTLTLALFRILEPFEGKITI 1375

Query: 535  DGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTID-EIRSVSKKCFCHN 593
            DG DIS +    LRR L ++ Q+     G++R N+    P+    D EI    +      
Sbjct: 1376 DGIDISTLGLYDLRRSLSIIPQDAQAFEGTVRSNLD---PFNRHTDAEIWKALELSHLKP 1432

Query: 594  FITKF-----------SDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSA 642
             I +            +D  +T I   G  LS GQ+Q + ++RAL+    ILILDEAT+A
Sbjct: 1433 HIERIVSELPDDENKPTDLLDTQISDNGNNLSMGQRQLLCLSRALLNPSKILILDEATAA 1492

Query: 643  LDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYA 702
            +D E++  I  T+    K R  TI++IAHR+ T+  S+ ++VL D G V E      L  
Sbjct: 1493 VDRETDKIIQETIRTAFKDR--TILTIAHRIDTVLDSDKIMVL-DKGEVKEFDTPDNLLK 1549

Query: 703  SKESKLYKL 711
            +KES  Y L
Sbjct: 1550 NKESLFYGL 1558

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 138/594 (23%), Positives = 251/594 (42%), Gaps = 57/594 (9%)

Query: 181 DLRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIH 240
           D RDLP +    G +  + +F  + +LST  +    + +   G K+   L S V +K++ 
Sbjct: 320 DSRDLPILN---GFFVAIGLFLLS-ILSTIISNQFFINIFEAGLKIRGSLMSLVYQKSLR 375

Query: 241 QDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXX 300
             AE  +    GD+++ +S D   + R            I   GV I +   + +     
Sbjct: 376 LSAEAREDKANGDVLNLMSVDVIRIQRFFENAQILVGSPIQLIGVLISLYVLLGNATIGG 435

Query: 301 XXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRY 360
                    + + +  R  + + +   Q      K   E L+ +K+++ +  E+  + R 
Sbjct: 436 LVSIVIMVPINSYM-TRLYKKLFKTQMQYKDKRIKTVTEILNSMKSIKLYAWEKPMLDRL 494

Query: 361 NHAIR--KVFDVGKREALTNATFFSSTSV--LGDFSFLIVLAYGSHLVLQGSLSIGDLTA 416
           NH     ++ ++ K   ++N  FF    V  L   S  ++ +Y +  VL   +    LT 
Sbjct: 495 NHVRNDLELHNMKKIAIVSNFMFFCWNIVPLLVTCSTFVLFSYLTDQVLSPQIIFPSLTL 554

Query: 417 FMLYTEYSGSAVFGLSNFYSELMKGAGAASRL------FEL----------TDHQPSIYA 460
           F +  +    A+F +    S +++   +  RL       EL          T   P++  
Sbjct: 555 FSMLND----ALFTVPTMISNIIEIGVSLKRLKGYLLAEELDTSFIEHARATASDPTVEI 610

Query: 461 TKGV-----PYVPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKS 515
           +  V     P      E   E    S P  +   I    NF+       C+VG  G GKS
Sbjct: 611 SNAVFLWKSPKSAASSEDTDEEAEISSPGVALKSI---ENFSAKKAQLTCIVGRVGSGKS 667

Query: 516 TIASLLLKYYNPTSGRITIDGQD-ISKISAKSLRR--HLGVVQQEPILMSGSIRDNITYG 572
           T    +L       G++     D  S +  K + R  +L    Q+P +M+ S++DNI +G
Sbjct: 668 TFLQAIL-------GQLPCVSSDSASGVKPKVVIRADNLAYCPQQPWIMNASLKDNILFG 720

Query: 573 VPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPN 632
             Y   +   +   K C     +    DG +T++G KG  LSGGQK R+++ARA+  + +
Sbjct: 721 YKYDEAM--YKKTIKACQLLPDLEILPDGDQTLVGEKGISLSGGQKARLSLARAVYSRAD 778

Query: 633 ILILDEATSALDVE-SEGAINYTLGQ---LMKSRDITIISIAHRLSTIRRSENVIVLGDD 688
           + +LD+  SA+D    +  I+  L +   L+K++  T+I   + ++ +  S+ +I L  +
Sbjct: 779 LYLLDDVLSAVDSHVCKSIIDDVLDRQKGLLKNK--TVILTTNAVNVLVHSD-MIYLLKN 835

Query: 689 GSVVEMGKFKELYASKESKLYK-LLNEKAKDTTSKMNAETVEKNDPSPKTEKLN 741
           G +VE   ++E+ +   +   K  L E  ++  S  + ET EK   S   +  N
Sbjct: 836 GKIVESNSYEEVMSKDRNNGEKSSLREIIEEFASNESEETAEKKSESSTIDDKN 889

>Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR103W
            (REAL)
          Length = 1595

 Score =  137 bits (345), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 122/546 (22%), Positives = 248/546 (45%), Gaps = 47/546 (8%)

Query: 197  FLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKVGDLIS 256
            FL+ +     +S+F   G+V +  + G     ++ + ++         F D   VG +++
Sbjct: 1041 FLSTYTIIGFISSFLTAGKVWVAVLFGTNATKKIFAKLLSSIFLAKLRFHDITPVGRIMN 1100

Query: 257  RLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIYG 316
            R S D  ++ + +  N    F +++     I ++ +I+               +  ++Y 
Sbjct: 1101 RFSKDMDIIDQQLIPNFEGLFYSVVVCLWVIFLIGYITPRFLLFAIPLCALYYIVGSLYL 1160

Query: 317  RKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREAL 376
            R  R + R    +   + ++  E + GV T+++   E++ I +   AI K          
Sbjct: 1161 RASRELKRIDNINVSPIHQLFTEAIKGVATIRALADERRFITQTLVAIDK---------- 1210

Query: 377  TNATFFSSTSVLGDFSF-------LIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVF 429
            +NA FF         ++       LI+ +    +VL+       L   +L   +S +   
Sbjct: 1211 SNAPFFYLNLATEWITYRVDIIGALILFSSSLMIVLKAPYLDAGLAGILLSNAFSFTETA 1270

Query: 430  -GLSNFYSELMKGAGAASRLFELTD-----HQPSIYATKGVPYVPGKGEIKFENVSFSYP 483
              +   +S +     +  R+ E  D      + + YAT    + P  G+I+FEN++  Y 
Sbjct: 1271 QWIIKVFSGVELLMSSVERIKEYVDVPLESSESNNYATPLANW-PQTGDIEFENLTLRYS 1329

Query: 484  TRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKIS 543
              S+  + + ++F + +G+ V +VG +G GKS+I + + +  +   G I ID +DI  + 
Sbjct: 1330 PHSSKAL-DGVSFKVKAGTKVGIVGRTGAGKSSIIAAIYRLSDWEDGTIIIDNKDIKYVP 1388

Query: 544  AKSLRRHLGVVQQEPILMSGSIRDNITYGVPYT-----PTIDEIRSVSK-KCFC------ 591
             + LR  +  + Q P L  G+IR N+     Y+       ++++  + + +  C      
Sbjct: 1389 LECLRNSISCIPQNPTLFEGTIRSNLDPWDQYSDVQVFEALEKVGLIEQSEGLCSLPGQK 1448

Query: 592  ------HNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDV 645
                  H    +F D   TV+   G+ +S GQ+Q + +AR+++   NI+++DEAT+++D 
Sbjct: 1449 LSYPSNHKLRNRFID-LNTVVKSGGSNISQGQRQLLCLARSMLGARNIMLIDEATASIDY 1507

Query: 646  ESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKE 705
             S+  I  T+ + M  R+ T+++IAHRL ++   + ++V+ D G V E      L + K 
Sbjct: 1508 VSDAKIQKTIRETM--RNTTVLTIAHRLRSVIDYDKILVM-DMGRVEEYDHPYNLISDKN 1564

Query: 706  SKLYKL 711
            +  ++L
Sbjct: 1565 TIFHRL 1570

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 79/242 (32%), Positives = 120/242 (49%), Gaps = 13/242 (5%)

Query: 469 GKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNV--CVVGPSGRGKSTIASLLLKYYN 526
            K ++ FEN +  +   +A   F   N +ID   N    ++GP+G GKS++   LL   N
Sbjct: 661 SKTKLGFENANMEW--EAAETSFKLKNISIDFKQNTLNAIIGPTGSGKSSLLLGLLGELN 718

Query: 527 PTSGRI---TIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIR 583
             SG+I   T+  +D  +I    +   +    Q P L+SG+I+DNI +G  +     +  
Sbjct: 719 LRSGKINVPTVHSRDDLEIGIDGMANSMAYCSQSPWLISGTIKDNIVFGEFFNQ--QKFD 776

Query: 584 SVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSAL 643
            V K C     I   + G +T +G  G  LSGGQ+QRIA+ARA+      L+ D+  SA+
Sbjct: 777 DVIKCCCLEKDIKAMTAGLKTDVGEGGFSLSGGQQQRIALARAIYSSSRYLLFDDCLSAV 836

Query: 644 DVESEGAI--NYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELY 701
           D E+   I      G +MK R  T I  +H +S I +    +V+ D+G V   GK  +L 
Sbjct: 837 DPETALHIYEECLCGPMMKGR--TCIVTSHNISLIIKQAQWLVILDNGEVKAQGKPSDLI 894

Query: 702 AS 703
            S
Sbjct: 895 ES 896

>Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  137 bits (344), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 134/542 (24%), Positives = 242/542 (44%), Gaps = 48/542 (8%)

Query: 197  FLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTI-HQDAEFFDRNKVGDLI 255
            +LA++    + S  A   + ++L +      ++   N++  ++      FF+   +G ++
Sbjct: 992  YLAIYFALGIGSALATLIQTIVLWVFCTIHASKYLHNLMANSVLRAPMAFFETTPIGRIL 1051

Query: 256  SRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATI- 314
            +R S+D Y V   + +  S  F         + ++F I+               +G    
Sbjct: 1052 NRFSNDIYKVDALLGRTFSQFFVN------AVKVIFTITVICATTWQFIFIIIPLGVCYI 1105

Query: 315  -----YGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFD 369
                 Y R  R + R    +   +    +E L G+ TV+ +  +    KR++H  +   D
Sbjct: 1106 YYQQYYLRTSRELRRLDSITRSPIYSHFQETLGGLATVRGYSQQ----KRFSHINQCRID 1161

Query: 370  VGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVL-----------QGSLSIGDLTAFM 418
                     + F+ S +     ++ + L  GS ++L           QG+L+ G     +
Sbjct: 1162 NNM------SAFYPSINANRWLAYRLELI-GSIIILGAATLSVFRLKQGTLTAGMAGISL 1214

Query: 419  LYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQP----SIYATKGVPYVPGKGEIK 474
             Y       +  +     E+     +  R+ E  D +     +I         P +G+IK
Sbjct: 1215 SYALQITQTLNWIVRMTVEVETNIVSVERIKEYADLKSEAPLTIEGHMPPKEWPSQGDIK 1274

Query: 475  FENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITI 534
            F N S  Y     + +  ++N  I     + +VG +G GKS++   L +    ++G I I
Sbjct: 1275 FNNYSTRYRPE-LDLVLKHINIHIKPNEKIGIVGRTGAGKSSLTLALFRMIEASAGNIVI 1333

Query: 535  DGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDE--IRSVSKKCFCH 592
            DG  I++I    LR  L ++ Q+  +  GS+R+NI     YT   DE   R++       
Sbjct: 1334 DGIAINEIGLYDLRHRLSIIPQDSQVFEGSLRENIDPTNQYT---DEAIWRALELSHLKE 1390

Query: 593  NFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAIN 652
            + ++  +DG +  +   G  LS GQ+Q + +ARA++    ILILDEAT+A+DVE++  + 
Sbjct: 1391 HVLSMSNDGLDAQLTEGGGNLSVGQRQLLCLARAMLVPSKILILDEATAAVDVETDKVVQ 1450

Query: 653  YTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLL 712
             T+    K R  TI++IAHRL+TI  S+ +IVL D+G+V E     +L ++ ES  + L 
Sbjct: 1451 ETIRTAFKDR--TILTIAHRLNTIMDSDRIIVL-DNGTVAEFDSPSQLLSNSESLFHSLC 1507

Query: 713  NE 714
             E
Sbjct: 1508 AE 1509

 Score =  106 bits (264), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 104/419 (24%), Positives = 193/419 (46%), Gaps = 38/419 (9%)

Query: 322 ISRDLQQSTGNL----TKVAEEQLSGVKTVQSFVAEQK-----EIKRYNHAIRKVFDVGK 372
           I + LQ+S        T+V  E L+ +K+++ +  E+      E  R N  ++ +  +G 
Sbjct: 469 IQKKLQKSQMKYKDERTRVISEILNNIKSLKLYAWEKPYREKLEDIRNNKELKNLTRLGC 528

Query: 373 REALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLS 432
             A+T+  F     ++   +F  V  Y     L   L    LT F L + +    +  + 
Sbjct: 529 YMAVTSFQFNIVPFLVSCCTF-AVFVYTEDRALTTDLVFPALTLFNLLS-FPLMIIPMVL 586

Query: 433 NFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKF---ENVSFSYPTRSANQ 489
           N + E     G     F   + QP   + + +P V   G++     ++ +F +  +   +
Sbjct: 587 NSFIEASVSIGRLFTFFTNEELQPD--SVQRLPKVENFGDVAINVGDDATFLWQRKPEYK 644

Query: 490 I-FNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLR 548
           +   N+NF    G   CVVG  G GK+ + S +L       G  T+ G            
Sbjct: 645 VALKNINFQAKKGELTCVVGKVGSGKTALLSCMLGDLFRVKGFATVHGS----------- 693

Query: 549 RHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGP 608
             +  V Q P +M+G++ +NI +G  Y   ++      K C     +    DG +T++G 
Sbjct: 694 --VAYVSQVPWIMNGTVMENILFGHKYD--VEFYEKTIKACALTIDLAILMDGDKTLVGE 749

Query: 609 KGALLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTLGQ--LMKSRDIT 665
           KG  LSGGQK R+++ARA+  + +  +LD+  +A+D   +   I + LG   L+ ++  T
Sbjct: 750 KGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTK--T 807

Query: 666 IISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKDTTSKMN 724
            +   +++S +  +++V +L D+G +++ G + E+    +S L+KLLN+  K   +K N
Sbjct: 808 RLLATNKVSALSIADSVALL-DNGEIIQKGTYDEITKDADSPLWKLLNDYGKKNNNKRN 865

>KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_5.10
            YGR281W
          Length = 1457

 Score =  136 bits (343), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 129/525 (24%), Positives = 246/525 (46%), Gaps = 53/525 (10%)

Query: 230  LRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNIS------DGFKAIICG 283
            L  N + + +H    + D   +G +++R + D   +   +T+++           A+I  
Sbjct: 947  LNLNAVHRVLHAPMSYLDTTPLGRILNRFTKDTDSLDNELTESVRLMLFQVGNIVAVIVM 1006

Query: 284  GVGIGMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSG 343
             +     F I+                  +   +++ +I R    +  N      E L G
Sbjct: 1007 CIVYLPWFAIAVPFLFFMFVLIADHYQSTSREIKRLDAIQRSFVYNNLN------EVLGG 1060

Query: 344  VKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTN---ATFFSSTSVLGDFSFLIVLAYG 400
            + T++S+  +++   + ++ I K+ + G          + F    +++  F+ +I L   
Sbjct: 1061 MDTIKSYKGQKRFQAKSDYLINKMNEAGYLLVSVQRWVSIFLDMVAII--FALIIALLSV 1118

Query: 401  SHLVLQGSLSIGDLTAFMLYTE-YSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIY 459
            + +    + S+G L  ++L       S +  L+   +++     +A RL       P   
Sbjct: 1119 TGVFSLSASSVGVLLTYVLQLPGLLNSVLRALTQTENDM----NSAERLVNYATKLPLEA 1174

Query: 460  ATKGVPYV------PGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRG 513
            A K  P +      P KGEI+F +V F+Y +     +   LN  I SG  + + G +G G
Sbjct: 1175 AYKK-PELSPPESWPSKGEIRFLDVDFAYRS-GLPVVLKGLNLDIKSGEKIGICGRTGAG 1232

Query: 514  KSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDN----- 568
            KSTI S L +    TSG+I ID  DIS +    LRR L ++ Q+P+L  G+IR N     
Sbjct: 1233 KSTIMSALYRLNELTSGKILIDDVDISTLGLYDLRRKLSIIPQDPVLFKGTIRKNLDPFS 1292

Query: 569  -----------ITYGVPYTPTIDEIRS-VSKKCFCHNFITKFSDGYETVIGPKGALLSGG 616
                       I  G     ++++++S +  +   H  + KF    + ++  +G+  S G
Sbjct: 1293 NYDDSLLWDALIRSGAIEKESVEKVKSEMVNEEGTHTDMHKFH--LDQLVEEEGSNFSLG 1350

Query: 617  QKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTI 676
            ++Q +A+ RAL+++  ILILDEATS++D E++G I   + +  +  + TI+ IAHRL TI
Sbjct: 1351 ERQVLALTRALVRQSKILILDEATSSVDYETDGKIQKRIVE--EFDNCTILCIAHRLKTI 1408

Query: 677  RRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKDTTS 721
             + + ++VL + G + E  +  +L++ K+S +++ + E++  T S
Sbjct: 1409 LQYDRILVL-EKGVIAEFDQPFKLFSDKDS-IFRSMCERSNITES 1451

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 80/253 (31%), Positives = 129/253 (50%), Gaps = 28/253 (11%)

Query: 491 FNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRH 550
           F+NL+F I  G  + + GP G GKS++ +    + N T GRI ++G D+           
Sbjct: 588 FSNLDFEIRKGEFIMITGPIGTGKSSLLNAFAGFMNKTEGRIQVNG-DL----------- 635

Query: 551 LGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKG 610
             +    P + + +++DNI +G P+    ++  +V + C     +     G +T IG +G
Sbjct: 636 --LFCGYPWIQNATVKDNILFGSPFIK--EKYENVLRVCSLDADLKVLPAGDKTEIGERG 691

Query: 611 ALLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTLGQLMKSRDITIISI 669
             LSGGQK RI +ARA+ K  +I + D+  SA+D    +  ++  L  L++ +  T I  
Sbjct: 692 INLSGGQKARINLARAVYKTKDIFLFDDVLSAVDSRVGKHIMDECLLDLLEGK--TRILA 749

Query: 670 AHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKDTTSKMNAETVE 729
            H+LS I +++ VIVLG DGS  ++G   EL   +   L  LL+     TT + N    E
Sbjct: 750 THQLSLIEKADRVIVLGTDGS-FDIGTVDEL-KQRNQTLTNLLD---YSTTEREN----E 800

Query: 730 KNDPSPKTEKLND 742
             D SP  ++ ND
Sbjct: 801 NRDESPVADEEND 813

>KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {ON}
            Anc_4.52 YLL015W
          Length = 1536

 Score =  136 bits (343), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 139/550 (25%), Positives = 247/550 (44%), Gaps = 49/550 (8%)

Query: 194  LYDFLAVFA----GALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRN 249
            ++ F+AV+A    G+   + F     ++   I G K    L  ++ K  I    +FF+  
Sbjct: 1001 VWKFVAVYALIGLGSAAFNIFRTIIMLLYCSIRGSK---TLHDSMAKAIIRSPVQFFETT 1057

Query: 250  KVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXX 309
             +G +I+R SSD   V  ++    S  F++I+   + + ++                   
Sbjct: 1058 PIGRVINRFSSDIDSVDVNLQNVFSIFFRSILDYILTVILVSVAMPWFLLFNALIMIIYF 1117

Query: 310  VGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHA-IRKVF 368
                +Y  + R + R    +   +  +  E L G          Q  I  YNH+ + K  
Sbjct: 1118 YYEKLYIVQSRELKRLTSIAYSPIISLMSETLGG----------QMVISAYNHSKMFKFM 1167

Query: 369  DVGKREALTNATF-FSSTSV-----LGDFSFLIVLAYG--SHLVLQGSLSIGD--LTAFM 418
            ++ + +   N  F F ST+      L      I+L  G  +   L+ S  IG   +   M
Sbjct: 1168 NIERVQYNLNVLFTFRSTNRWLSIRLQSIGAFIILCTGLLALTTLRTSSPIGSGLIGLLM 1227

Query: 419  LYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPS----IYATKGVPYVPGKGEIK 474
             Y     SA+  +     ++     +  R+ E     P     I + +     P +G I+
Sbjct: 1228 SYVLQVTSALTWIVRSTVQIETNIVSVERILEYCHLPPEAEDIIDSNRVERDWPQRGSIE 1287

Query: 475  FENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITI 534
            F+N + +Y   + + +  N++ TI+    V +VG +G GKST++  L +      G I I
Sbjct: 1288 FKNYTTTYRA-NLSPVLKNISVTINPSEKVGIVGRTGAGKSTLSLALFRILEAAEGTIFI 1346

Query: 535  DGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTID-EIRSVSKKCFCHN 593
            DG DIS+I    LR ++ ++ Q+     G++R N+    P+    D E+ +V +      
Sbjct: 1347 DGVDISRIGLTDLRGNMAIIPQDAQAFEGTVRSNLD---PFQKHTDVELWNVIELSHLKP 1403

Query: 594  FITKFSD---------GYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALD 644
             + + ++         G +  I   G+ LS GQ+Q + +ARAL+ +  +L+LDEAT+A+D
Sbjct: 1404 HVLRMAEDDNLSGNLSGLDAKINENGSNLSVGQRQLLCLARALLNQSKVLVLDEATAAVD 1463

Query: 645  VESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASK 704
            VE++  I  T+    K R  TI++IAHRL TI  ++ ++VL D G V E    K L + +
Sbjct: 1464 VETDKIIQETIRTQFKDR--TILTIAHRLDTIMDNDKILVL-DAGGVKEFDSPKNLLSDE 1520

Query: 705  ESKLYKLLNE 714
             +  Y+L ++
Sbjct: 1521 STLFYQLCDK 1530

 Score = 88.2 bits (217), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 111/475 (23%), Positives = 218/475 (45%), Gaps = 70/475 (14%)

Query: 316 GRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREA 375
            +K++++++   +      K   E L+ +K+++ +  E+  +++ +H +R   ++G  + 
Sbjct: 447 SKKVKTLTKTQMKYKDARIKTITEILNSMKSIKLYAWEKPMMQKLDH-VRNDLEIGNLKK 505

Query: 376 L---TNATFFSSTSV--LGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFG 430
           +   +N  +F+   V  L   S   +    S   L   L    L+ F +  E    A++ 
Sbjct: 506 IGIASNLIYFAWNCVPLLVTCSTFGIFTLISDEPLTPELVFPALSLFNILNE----AIYA 561

Query: 431 LSNFYSELMKGAGAASRL--FELTDH-QPSIYATKGVP---YVPGKGEIKFENVSFSYPT 484
           + +  + +++   + +RL  F L++    S     G P   Y+P    ++ EN +F +  
Sbjct: 562 IPSTINTMIEVTVSLNRLKKFLLSEELDRSFIEQTGKPANEYIPA---VEIENATFLW-- 616

Query: 485 RSANQIFNNLN-------------------FTIDSGSNVCVVGPSGRGKSTIASLLLKYY 525
           +S  Q+ N+ N                   FT    S  CV+G  G GK+T+   +L   
Sbjct: 617 KSQAQLINSENDDSEANIETTQVALKNIDHFTASPKSLTCVIGKVGSGKTTLLKAILGQL 676

Query: 526 NPTSGRITIDGQDIS-KISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRS 584
              SG      + IS K+S +     +    QE  +M+ +I++NI +G  +  T   +  
Sbjct: 677 PCISG----SKESISPKLSIRG--ESIAYCPQEAWIMNDTIKENILFGHKFDETYYTLTV 730

Query: 585 VSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALD 644
            + +      I    DG +T++G KG  LSGGQK R+++ARA+  + +I +LD+  SA+D
Sbjct: 731 AACELLADFDI--LPDGDQTLVGEKGISLSGGQKARVSLARAVYSRADIYLLDDILSAVD 788

Query: 645 VE-----SEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKE 699
                   E  ++   G L   R+ T+I   + +S ++ S+ +  L ++G +VE G + +
Sbjct: 789 AGVSKKIVENVLDSNSGLL---RNKTVILSTNTVSVLKHSQLIYAL-ENGIIVERGNYND 844

Query: 700 LYAS----KESKLYKLLNE----KAKDTTSKMN----AETVEKNDPSPKTEKLND 742
           +  S     ESK+  LL +     AK  +S ++    ++T    D + K++ + D
Sbjct: 845 IIESANSDDESKISALLKQFDVSLAKRESSNLSLTSKSQTAIPQDSTTKSDLIED 899

>KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa]
            {ON} similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1516

 Score =  136 bits (342), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 140/526 (26%), Positives = 230/526 (43%), Gaps = 20/526 (3%)

Query: 197  FLAVFAGALVLSTFANFGRVVLLRILGEK-LVARLRSNVIKKTIHQDAEFFDRNKVGDLI 255
            +LA+  G+ + +        V   I G K L   + S+V+K  +     FF+   +G ++
Sbjct: 998  YLALGVGSALATLIQTIVLWVFCTIHGSKYLHDAMASSVLKAPM----SFFETTPIGRIL 1053

Query: 256  SRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIY 315
            +R S+D Y V   + +  +  F  ++     I ++   +                    Y
Sbjct: 1054 NRFSNDIYKVDEILGRTFAQFFANVVKVSFTIVVICMATWQFIFIVLPLSVLYIYYQQYY 1113

Query: 316  GRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIK----RYNHAIRKVF-DV 370
             R  R + R    +   +    +E L G+ T++ +  + + +     R ++ +   +  V
Sbjct: 1114 LRTSRELRRLDSVTRSPIYAHFQETLGGLTTIRGYSQQNRFVHINQTRVDNNMSAFYPSV 1173

Query: 371  GKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFG 430
                 L     F  + ++   S L V+  G+  +  G   IG   +F L    S + +  
Sbjct: 1174 NANRWLAFRLEFIGSVIILAASMLAVIRLGNGTLTAGM--IGLSLSFALQITQSLNWIVR 1231

Query: 431  LSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPY-VPGKGEIKFENVSFSYPTRSANQ 489
            ++      +          EL    P I      P   P  GEIKF N S  Y       
Sbjct: 1232 MTVEVETNIVSVERIKEYAELKSEAPYIIKDHRPPASWPESGEIKFVNYSTRYRPE-LEL 1290

Query: 490  IFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRR 549
            I  +++  I     + +VG +G GKS++   L +     SG I IDG  I  I    LR 
Sbjct: 1291 ILKDIDLHIHPKEKIGIVGRTGAGKSSLTLALFRIIEAASGHIVIDGIPIDSIGLADLRH 1350

Query: 550  HLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKF-SDGYETVIGP 608
             L ++ Q+  +  G++R+NI     YT   +EI +        + I    S+G ET++  
Sbjct: 1351 GLSIIPQDSQIFEGTVRENIDPTNRYTD--EEIWNALALSHLKDHILGMGSNGLETMLTE 1408

Query: 609  KGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIIS 668
             G+ LS GQ+Q + +ARAL+   NILILDEAT+A+DVE++  I  T+    K R  TI++
Sbjct: 1409 GGSNLSVGQRQLMCLARALLISSNILILDEATAAVDVETDQLIQKTIRNAFKER--TILT 1466

Query: 669  IAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNE 714
            IAHR++TI  S+ +IVL D G V E    + L   K+S  Y L  E
Sbjct: 1467 IAHRINTIMDSDRIIVL-DKGRVTEFDTPQNLLQKKDSIFYSLCLE 1511

 Score =  110 bits (275), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 109/414 (26%), Positives = 190/414 (45%), Gaps = 58/414 (14%)

Query: 334 TKVAEEQLSGVKTVQSFVAEQKEIKRYNHA-----IRKVFDVGKREALTNATFFSSTSVL 388
           T+V  E L+ +K+++ +  E     + +H      ++ +  +G   AL N  F +    L
Sbjct: 482 TRVTSEILNNIKSLKVYGWEIPYKAKLDHVRNEKELKNLKKMGCTLALANFQF-NIVPFL 540

Query: 389 GDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLS---NFYSELMKGAGAA 445
              S   V  Y     L   L    LT F L +       F L+   N  S  ++ + + 
Sbjct: 541 VSCSTFAVFVYTEERPLSTDLVFPALTLFNLLS-------FPLAVVPNAISSFIEASVSI 593

Query: 446 SRLFE-LTDHQPSIYATKGVPYVPGKGE--IKFENVSFSYPTRSANQI-FNNLNFTIDSG 501
           +RLF  LT+ +    A    P V   G+  +K  + +F +  +   ++   N+NF    G
Sbjct: 594 NRLFAFLTNEELQNDAVLREPKVKNIGDEGVKVNDATFLWQRKPEYKVALKNINFVAKKG 653

Query: 502 SNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILM 561
              C+VG  G GKS +   LL       G  T+ G D++ +S            Q P +M
Sbjct: 654 ELTCIVGKVGSGKSALIQSLLGDLIRVKGFATVHG-DVANVS------------QVPWIM 700

Query: 562 SGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRI 621
           +G+++DNI +G  Y P   ++    K C     ++   DG +T++G KG  LSGGQK R+
Sbjct: 701 NGTVKDNILFGHKYDPEFYQL--TIKACALSIDLSMLPDGDQTLVGEKGISLSGGQKARL 758

Query: 622 AIARALIKKPNILILDEATSALDVE-SEGAINYTLG---------QLMKSRDITIISIAH 671
           ++ARA+  + +  +LD+  +A+D   ++  I + LG         +++ +  IT++SIA 
Sbjct: 759 SLARAVYSRADTYLLDDPLAAVDEHVAKHLIEHVLGPHGLLHSKTKVLATNKITVLSIA- 817

Query: 672 RLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNE---KAKDTTSK 722
                    + I L ++G +++ G + ++  S  S L KL+ E   K K T S+
Sbjct: 818 ---------DSITLMENGEIIQQGSYDQVNESTNSPLSKLIAEFGKKGKPTPSQ 862

>NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {ON}
            Anc_8.303
          Length = 1512

 Score =  135 bits (341), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 138/547 (25%), Positives = 241/547 (44%), Gaps = 52/547 (9%)

Query: 188  VVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFD 247
            + +GLG +  L+     ++L  +          I G K +  L +  +   +     FF+
Sbjct: 992  IYFGLGCFSALSTLIQTIILWVYCT--------IRGSKYLHNLMTVAV---LRAPMTFFE 1040

Query: 248  RNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXX 307
               +G +++R S+D Y V   + +  S  F       V +     +              
Sbjct: 1041 TTPIGRILNRFSNDVYKVDSVLGRTFSQFF----VNAVKVSFTIIVICFTTWQFIFIIIP 1096

Query: 308  XXVGATIYGRKIRSISRDLQQSTGNLTKVA-----EEQLSGVKTVQSFVAEQKEIKRYNH 362
              V    Y +     SR+L++   ++TK       +E L G+ T++ +    ++  R+ H
Sbjct: 1097 LGVFYIYYQQYFLRTSRELRR-LDSITKSPIFSHFQETLGGITTIRGY----QQQHRFTH 1151

Query: 363  AIRKVFDVGKREALTNATFFSSTSV-------LGDFSFLIVLAYGSHLVL---QGSLSIG 412
              +   D         + F+ S +        L     LI+L   +  V    QG+L+ G
Sbjct: 1152 INQCRVDNNM------SAFYPSVNANRWLAYRLETIGSLIILGAATLSVFRLRQGTLTAG 1205

Query: 413  DLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTD---HQPSIYAT-KGVPYVP 468
             +   + Y      ++  +     E+     +  R+ E +D     P++    +     P
Sbjct: 1206 MVGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSDLKSEAPAVIEDHRPAETWP 1265

Query: 469  GKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPT 528
             +G+IKFE+ S  Y     + I  ++N  I     V +VG +G GKS++   L +    +
Sbjct: 1266 DEGDIKFEHYSTRYRPE-LDLILKDINVHIKPKEKVGIVGRTGAGKSSLTLALFRIIEAS 1324

Query: 529  SGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKK 588
            SGRI ID   I++I    LR  L ++ Q+  +  G++R+NI     YT   ++I +V   
Sbjct: 1325 SGRIVIDNVPINEIGLYDLRHKLSIIPQDSQVFEGTVRENIDPTNEYTD--EQIWNVLAL 1382

Query: 589  CFCHNFITKFSD-GYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVES 647
                + I    D G    +   G  LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE+
Sbjct: 1383 SHLKDHIISMGDEGLNNQLTEGGNNLSVGQRQLLCLARALLVPSKILLLDEATAAVDVET 1442

Query: 648  EGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESK 707
            +  I  T+    K R  TI++IAHR++TI  S+ +IVL D+G++ E    ++L  +  S 
Sbjct: 1443 DKVIQETIRTAFKDR--TILTIAHRINTIMDSDRIIVL-DNGTIKEFDSPEKLLENPSSL 1499

Query: 708  LYKLLNE 714
             Y L  E
Sbjct: 1500 FYSLCQE 1506

 Score =  101 bits (251), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 103/421 (24%), Positives = 190/421 (45%), Gaps = 53/421 (12%)

Query: 334 TKVAEEQLSGVKTVQSFVAE----QK-EIKRYNHAIRKVFDVGKREALTNATFFSSTSVL 388
           T+V  E L+ +K+++ +  E    QK E  R N  ++ +  +G   AL +  F     ++
Sbjct: 481 TRVISEMLNNIKSLKLYAWEVPYRQKLENVRNNKELKNLTKLGCYMALMSFQFNVVPFLV 540

Query: 389 GDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRL 448
              +F     Y  +  L   L    LT F L        +  + N  + +++ + +  RL
Sbjct: 541 SCCTF-AAFIYTENRPLTTDLVFPALTLFNLL----HFPLMVIPNVLTMIIETSVSIGRL 595

Query: 449 FE-LTDHQPSIYATKGVPYVPGKGEIKF---ENVSFSYPTRSANQI-FNNLNFTIDSGSN 503
           F  LT+ +    A + +P V   G++     ++ +F +  +   ++   N+NF    G  
Sbjct: 596 FSFLTNEELQKDAVQRLPKVTNIGDVAINVGDDATFLWQRKPEYKVALKNINFQAKKGEL 655

Query: 504 VCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSG 563
            C+VG  G GKS +   +L       G  TI G             ++  V Q   +M+G
Sbjct: 656 TCIVGKVGSGKSAMIQSILGDLFRVKGFATIHG-------------NVAYVSQVAWIMNG 702

Query: 564 SIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAI 623
           ++++NI +G  Y    D  +   K C     +    DG +T++G KG  LSGGQK R+++
Sbjct: 703 TVKENILFGHKYDE--DFYQKTIKACALTIDLAVLMDGDQTLVGEKGISLSGGQKARLSL 760

Query: 624 ARALIKKPNILILDEATSALDVE-SEGAINYTLG---------QLMKSRDITIISIAHRL 673
           ARA+  + +  +LD+  +A+D   +   + + LG         +++ +  ++++SIA  +
Sbjct: 761 ARAVYSRADTYLLDDPLAAVDEHVARHLVEHVLGPNGLLHTKTKVLATNKVSVLSIADSV 820

Query: 674 STIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNE---KAKDTTSKMNAETVEK 730
           S          L ++G +V+ G + E+     S L KL+ E   K+ D+TS +   T   
Sbjct: 821 S----------LLENGEIVQQGTYDEIMKDDSSPLSKLITEYGKKSTDSTSNVTPSTSSS 870

Query: 731 N 731
           N
Sbjct: 871 N 871

>TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1646

 Score =  135 bits (341), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 129/526 (24%), Positives = 239/526 (45%), Gaps = 57/526 (10%)

Query: 234  VIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHI 293
            ++ K +H    FFD   +G +++R S D   + + +T  +       +     + ++ +I
Sbjct: 1136 LLSKVLHSKLRFFDSTPIGRIMNRFSKDIEAIDQELTPYVESVVYNSVQLIATVLLITYI 1195

Query: 294  SSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAE 353
            ++                   Y    R + R    +   + +   E L GV T++++   
Sbjct: 1196 TNGFIVVALLVILLYYFVGVYYLSGSRELKRFESTTKSPIYQHFSETLVGVTTIRAY--- 1252

Query: 354  QKEIKRYNHAIRKVFDVGK---REALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQ---- 406
              EI+     + K+ +  K      + N        ++G    L++   G  +++     
Sbjct: 1253 GDEIRFMKENLTKIDENNKPFFYLWVANRWLCFRIDIIGS---LVIFGAGVLVLMNINKI 1309

Query: 407  -GSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVP 465
               L+   LT  + +TE    +   L   YS +     +  R+ E  D +   Y+  G+ 
Sbjct: 1310 DSGLAGISLTYAITFTE----SALWLVRSYSNVEINMNSVERVKEYMDIEQEPYSA-GIV 1364

Query: 466  YV----PGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLL 521
             V    P +G+I+  ++S  Y   S  ++  N++FT++    V VVG +G GKSTI + L
Sbjct: 1365 NVDKSWPSEGKIEVNDLSLRYAP-SLPKVIKNVSFTVEPKMKVGVVGRTGAGKSTIITAL 1423

Query: 522  LKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTID- 580
             ++ +P +G I ID  DI+ I  K LR+ + ++ Q+P L +G+I+ N+    PY    D 
Sbjct: 1424 FRFLDPETGYIKIDNIDITTIDLKKLRKSITIIPQDPTLFTGTIKSNLD---PYNEYNDD 1480

Query: 581  -------------------EIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRI 621
                               ++ SVS +      + KF +  ++ I   G+ LS GQ+Q +
Sbjct: 1481 QIFKALRRVNLIVDGNLNSDVTSVSSEN-----VNKFLN-LQSEISEGGSNLSQGQRQLM 1534

Query: 622  AIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSEN 681
             +AR+L++ PNI++LDEAT+++D  S+  I  T+    K  D TI++IAHRL ++   + 
Sbjct: 1535 CLARSLLRAPNIMLLDEATASIDYASDAKIQGTIRNEFK--DSTILTIAHRLRSVIDYDK 1592

Query: 682  VIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAK-DTTSKMNAE 726
            ++V+ D G V E      L  +K S  Y +  +  + DT   ++ E
Sbjct: 1593 ILVM-DAGEVKEYDHPYSLLLNKNSIFYSMCEQSGELDTLIDLSKE 1637

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 68/231 (29%), Positives = 116/231 (50%), Gaps = 11/231 (4%)

Query: 471 GEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSG 530
            +I  ENV+ S+  +  +    NLN     G    V+GP+G GK+++   LL   +   G
Sbjct: 696 NKISLENVTVSWNKQKQDFKLRNLNIDFKVGKLNVVIGPTGSGKTSLLMALLGEMHLLEG 755

Query: 531 RITIDGQDIS---KISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSK 587
           +IT+   D        +  L   +    Q   L++ ++++NI +   Y    +   +V  
Sbjct: 756 KITVPSLDPRCEMTFDSDGLSNSMAYCSQAAWLLNDTVKNNILFNAEYNE--ERYLAVIS 813

Query: 588 KCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVES 647
            C         + G  T IG +G  LSGGQKQRI++ARAL      ++LD+  SA+D  +
Sbjct: 814 ACALKRDFEILAAGDLTEIGERGITLSGGQKQRISLARALYSSSKHILLDDCLSAVDSHT 873

Query: 648 EGAI--NYTLGQLMKSRDITIISIAHRLS-TIRRSENVIVLGDDGSVVEMG 695
              I  N  +G LM++R  T I ++H ++ T++ +E VI++ D+G +  +G
Sbjct: 874 AAWIYDNCIIGPLMENR--TCILVSHNVALTLKNAEQVIMI-DNGKISHIG 921

>Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  135 bits (340), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 136/548 (24%), Positives = 240/548 (43%), Gaps = 54/548 (9%)

Query: 188  VVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFD 247
            + + LG+   LA     +VL  F          I   K +  L +N +   +     FF+
Sbjct: 995  IYFALGIGSALATLIQTIVLWVFCT--------IHASKYLHNLMTNSV---LRAPMTFFE 1043

Query: 248  RNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXX 307
               +G +++R S+D Y V   + +  S  F       V +     +              
Sbjct: 1044 TTPIGRILNRFSNDIYKVDALLGRTFSQFF----VNAVKVTFTITVICVTTWQFIFIIVP 1099

Query: 308  XXVGATIYGRKIRSISRDLQQ----STGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHA 363
              V    Y +     SR+L++    +   +    +E L G+ TV+ +  +    KR++H 
Sbjct: 1100 LGVFYIYYQQYYLRTSRELRRLDSITRSPIYSHFQETLGGLATVRGYSQQ----KRFSHI 1155

Query: 364  IRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVL-----------QGSLSIG 412
             +   D         + F+ S +     ++ + L  GS ++L           QG+L+ G
Sbjct: 1156 NQCRIDNNM------SAFYPSVNANRWLAYRLELI-GSVIILGAATLSVFRLKQGTLTAG 1208

Query: 413  DLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTD---HQPSIYATKGVP-YVP 468
             +   + Y       +  +     E+     +  R+ E  D     P +      P   P
Sbjct: 1209 MVGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYADIKSEAPLVIEGHRPPKEWP 1268

Query: 469  GKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPT 528
            G+G+IKF   S  Y     + +   ++  I     + +VG +G GKS++   L +    +
Sbjct: 1269 GQGDIKFNQYSTRYRPE-LDLVLKQIDIHIKPKEKIGIVGRTGAGKSSLTLALFRIIEAS 1327

Query: 529  SGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDE--IRSVS 586
            +G I IDG  I++I    LR  L ++ Q+  +  G++R+NI    P     DE   R++ 
Sbjct: 1328 AGNIVIDGIPINEIGLYDLRHKLSIIPQDSQVFEGTVRENID---PINQYTDEAMWRALE 1384

Query: 587  KKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVE 646
                  + ++  +DG ++ +   G+ LS GQ+Q + +ARA++ +  IL+LDEAT+A+DVE
Sbjct: 1385 LSHLKEHILSMSNDGLDSQLTEGGSNLSVGQRQLLCLARAMLVQSKILVLDEATAAVDVE 1444

Query: 647  SEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKES 706
            ++  I  T+    K R  TI++IAHRL+TI  S+ +IVL D+G V E     +L  + +S
Sbjct: 1445 TDKVIQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVL-DNGKVAEFDSPAQLLTNTKS 1501

Query: 707  KLYKLLNE 714
              Y L  E
Sbjct: 1502 LFYSLCAE 1509

 Score = 97.1 bits (240), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 102/425 (24%), Positives = 179/425 (42%), Gaps = 64/425 (15%)

Query: 322 ISRDLQQSTGNL----TKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALT 377
           I + LQ+S        T+V  E L+ +K+++ +  E    K Y     K+ DV   + L 
Sbjct: 469 IQKKLQKSQMKYKDERTRVISEILNNIKSLKLYAWE----KPYR---EKLEDVRNNKELN 521

Query: 378 NATFFSSTSVLGDFSFLIV-----------LAYGSHLVLQGSLSIGDLTAFMLYTEYSGS 426
           N T       +  F F IV             Y     L   L    LT F L + +   
Sbjct: 522 NLTKLGCYMAVTSFQFNIVPFLVSCCTFAVFVYTEDRALTTDLVFPALTLFNLLS-FPLM 580

Query: 427 AVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKF---ENVSFSYP 483
            +  + N + E     G     F   + QP   + + +P V   G+I     ++ +F + 
Sbjct: 581 IIPMVLNSFIEASVSIGRLFSFFTNEELQPD--SVQRLPKVENVGDIAINIGDDATFLWQ 638

Query: 484 TRSANQI-FNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKI 542
            +   ++   N+NF    G   CVVG  G GK+ + S  L       G  ++ G      
Sbjct: 639 RKPEYKVALKNINFQAKKGELTCVVGKVGSGKTALLSSTLGDLFRVKGFASVHGS----- 693

Query: 543 SAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGY 602
                   +  V Q P +M+G++++NI +G  Y     E     K C     +    DG 
Sbjct: 694 --------VAYVSQVPWIMNGTVKENILFGHKYDAEFYE--KTIKACALTIDLAILMDGD 743

Query: 603 ETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALD----------VESEGAIN 652
           +T++G KG  LSGGQK R+++ARA+  + +  +LD+  +A+D          V     + 
Sbjct: 744 QTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLVEHVLGSNGLL 803

Query: 653 YTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLL 712
           +T  +L+ +  ++ +S+A          + I L D+G +++ G + ++    +S L+KL+
Sbjct: 804 HTKTKLLATNKVSALSVA----------DSIALLDNGEIIQQGTYDDITKDADSPLWKLI 853

Query: 713 NEKAK 717
            +  K
Sbjct: 854 KDYGK 858

>Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] {ON}
            YDR135C (YCF1) - metal resistance protein, similar to
            multidrug resistance proteins and cystic fibrosis protein
            CFTR [contig 171] FULL
          Length = 1494

 Score =  135 bits (340), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 87/248 (35%), Positives = 131/248 (52%), Gaps = 7/248 (2%)

Query: 468  PGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNP 527
            P  G IKFEN S  Y     +    N+N  I     + +VG +G GKS++   L +    
Sbjct: 1247 PTHGAIKFENYSARYRPE-LDLSLRNINIDIKPQERIGIVGRTGAGKSSLTLALFRIIEA 1305

Query: 528  TSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSK 587
              GRI IDG     I  + LR HL ++ Q+  +  G++R+NI     YT   +EI    +
Sbjct: 1306 AEGRIIIDGVPTDSIGLRDLRHHLSIIPQDSQVFEGTVRENIDPTNEYTD--EEIWHALE 1363

Query: 588  KCFCHNFITKF-SDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVE 646
                 + I     D  E+++   G  LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE
Sbjct: 1364 LAHLKDHIKSLGKDELESMLTEGGGNLSVGQRQLMCLARALLIPTRILVLDEATAAVDVE 1423

Query: 647  SEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKES 706
            ++  I  T+    K+R  TI++IAHR++TI  S+ ++VL D G + E    + L  ++ES
Sbjct: 1424 TDQVIQETIRTAFKNR--TILTIAHRINTILDSDRILVL-DSGKIAEFDSPEALLKNRES 1480

Query: 707  KLYKLLNE 714
              Y L  E
Sbjct: 1481 LFYSLCQE 1488

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 75/299 (25%), Positives = 138/299 (46%), Gaps = 46/299 (15%)

Query: 465 PYVPGKGEIKFE---NVSFSYPTRSANQI-FNNLNFTIDSGSNVCVVGPSGRGKSTIASL 520
           P V   GE+      + +F +  +   ++   N+NF    G   C+VG  G GKS +   
Sbjct: 601 PKVTKTGEVAINVGADATFLWQRKPEYKVALKNINFQAKKGELTCIVGKVGSGKSALIQG 660

Query: 521 LLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTID 580
           +L       G  ++ G              +  V Q P +M+G++++NI +G  Y    D
Sbjct: 661 ILGDLFRVKGFASVHGS-------------IAYVSQVPWIMNGTVKENILFGHKYDA--D 705

Query: 581 EIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEAT 640
              +  + C     ++    G ET++G KG  LSGGQK RI++ARA+  + +  +LD+  
Sbjct: 706 FYDTTLRACALAVDLSILPKGDETLVGEKGISLSGGQKARISLARAVYARADTYLLDDPL 765

Query: 641 SALDVE-SEGAINYTLG---------QLMKSRDITIISIAHRLSTIRRSENVIVLGDDGS 690
           +A+D   ++  I + LG         +++ +  I+++SIA  +S          L ++G 
Sbjct: 766 AAVDEHVAKHLIEHVLGSQGLLSSKVKVLATNKISVLSIADHIS----------LLENGE 815

Query: 691 VVEMGKFKELYASKESKLYKLLNEKAKDTTSKMNAETVEKNDPSPKT-------EKLND 742
           +++ G ++E+ + K S L K++    K  T     E+ E + P  +        +KL+D
Sbjct: 816 IIQQGSYEEVTSDKSSALSKIIANYGKKQTKGKGDESPESSTPDSEVAEASIDLQKLDD 874

>Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {ON}
            complement(69924..74519) [4596 nt, 1532 aa]
          Length = 1531

 Score =  135 bits (339), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 148/551 (26%), Positives = 240/551 (43%), Gaps = 58/551 (10%)

Query: 197  FLAVFAGALVLSTFANFGRVVLLRIL----GEKLVARLRSNVIKKTIHQDAEFFDRNKVG 252
            +L ++ G  V S FA   + V+L +     G K    L S+++   +     FF+   +G
Sbjct: 999  YLLIYFGFGVTSAFATLCQTVVLWVFCTIHGSKY---LHSSMVSSILRAPMTFFETTPIG 1055

Query: 253  DLISRLSSDAY----VVSRSMTQNISDGFKA-----IICGGVGIGMMFHISSXXXXXXXX 303
             +++R S+D Y    V+ RS +Q   +  K      +IC      ++  I          
Sbjct: 1056 RILNRFSNDVYKIDEVLGRSFSQFFVNAVKVSFTILVICWNTWQFILLVIP--------- 1106

Query: 304  XXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHA 363
                       Y R  R + R    +   +    +E L G+ T++ +  EQ+  KR+ H 
Sbjct: 1107 MGVLYLYYQQYYLRTSRELRRLDSITKSPIYAHFQESLGGLATIRGY--EQQ--KRFIHI 1162

Query: 364  IRKVFDVGKREAL----TNATFFSSTSVLGDFSFLIVLAYGSHLVLQ---GSLSIGDLTA 416
             +   D           +N         LG    LI+    S  +L+   G+L+ G +  
Sbjct: 1163 NQARVDNNMSAYYPSINSNRWLAYRLEFLGS---LIIFGAASLSILKLRDGTLTAGMIGL 1219

Query: 417  FMLYTEYSGSAVFGLSNFYSELMKGAGAASRL---FELTDHQPSIYATK-GVPYVPGKGE 472
             + Y      ++  +     E+     +  R+    EL    P I   K      P +G 
Sbjct: 1220 SLSYALQVTQSLNWIVRMTVEVETNIVSVERIKEYAELKSEAPLIIEEKRPSENWPERGA 1279

Query: 473  IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
            IKFEN S  Y     + +  N++  I     V +VG +G GKS++   L +      G I
Sbjct: 1280 IKFENYSTRYRP-DLDLVLKNISLDIKPQEKVGIVGRTGAGKSSLTLALFRIIEAAEGSI 1338

Query: 533  TIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCH 592
             +DG +IS+I    LR  L ++ Q+  +  G+IR+NI     YT   ++I +  +     
Sbjct: 1339 IVDGLNISEIGLYDLRHKLSIIPQDSQVFEGTIRENIDPTNIYTD--EQIWNALELSHLK 1396

Query: 593  NFITKFSD----GYE-----TVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSAL 643
              I + ++    G E     T +   G  LS GQ+Q + +ARAL+    ILILDEAT+A+
Sbjct: 1397 QHILRMNEESVNGSENNALYTRVTEGGNNLSVGQRQLMCLARALLVPSKILILDEATAAV 1456

Query: 644  DVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYAS 703
            DVE++  I  T+    K R  TI++IAHRL+TI  S+ ++VL D G V E    + L  +
Sbjct: 1457 DVETDSLIQETIRTAFKDR--TILTIAHRLNTIMDSDKIVVL-DKGEVAEFDTPQNLLKN 1513

Query: 704  KESKLYKLLNE 714
             ES  Y L  +
Sbjct: 1514 TESLFYSLCEQ 1524

 Score =  118 bits (296), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 107/421 (25%), Positives = 194/421 (46%), Gaps = 36/421 (8%)

Query: 334 TKVAEEQLSGVKTVQSFVAEQKEIKRYNHA-----IRKVFDVGKREALTNATFFSSTSVL 388
           T+V  E L+ +K+++ +  EQ   ++  H      ++ +  +G   A+TN  F +    L
Sbjct: 485 TRVINEILNNIKSLKLYAWEQPYKEKLEHVRNEKELKNLTRIGVFNAMTNFQF-NLVPFL 543

Query: 389 GDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRL 448
              S   V  Y     L   L    LT F L T      +  L    +  ++ + + SRL
Sbjct: 544 VSCSTFAVFVYIEDKPLTTDLVFPALTLFNLLT----FPLAALPIVITAFIEASVSMSRL 599

Query: 449 FE-LTDHQPSIYATKGVPYVPGKGEIKF---ENVSFSYPTRSANQI-FNNLNFTIDSGSN 503
           F  +T+ +    A + +P V  +G+I     +N +F +  +   ++   N+ F    G  
Sbjct: 600 FSFMTNEELQTDAIQRLPPVKKQGDIAVNIGDNATFLWKRKPEYKVALKNIEFQAKKGEL 659

Query: 504 VCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSG 563
            C+VG  G GKS     +L       G  TI G             ++  V Q P +M+G
Sbjct: 660 ACIVGKVGSGKSAFIQSILGDLFRVKGFATIHG-------------NVAYVSQLPWIMNG 706

Query: 564 SIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAI 623
           +++DNI +G  Y     E     + C     ++   DG +T++G KG  LSGGQK R+++
Sbjct: 707 TVKDNILFGHKYNQEFYE--KTLRACALTIDLSILPDGDQTLVGEKGISLSGGQKARLSL 764

Query: 624 ARALIKKPNILILDEATSALDVE-SEGAINYTLGQ--LMKSRDITIISIAHRLSTIRRSE 680
           ARA+  + ++ +LD+  +A+D   S+  I + +G   L+ ++  T +   +++S +  ++
Sbjct: 765 ARAVYARADVYLLDDPLAAVDEHVSKHLIQHVIGPNGLLHTK--TRVLATNKISVLSIAD 822

Query: 681 NVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKDTTSKMNAETVEKNDPSPKTEKL 740
           N+ +L DDG +V+ G + E+  +  S L KL++E         + +T     P   +  L
Sbjct: 823 NITLL-DDGEIVQQGTYNEVTDNINSPLCKLISEYGNKNNVNSSTDTESTMTPKESSTSL 881

Query: 741 N 741
           N
Sbjct: 882 N 882

>YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON}
            YCF1Vacuolar glutathione S-conjugate transporter; member
            of the ATP-binding cassette family; has a role in
            detoxifying metals such as cadmium, mercury, and
            arsenite; also transports unconjugated bilirubin,
            selenodigluthatione, and oxidized glutathione; similar to
            human cystic fibrosis protein CFTR
          Length = 1515

 Score =  134 bits (337), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 132/540 (24%), Positives = 237/540 (43%), Gaps = 44/540 (8%)

Query: 197  FLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTI-HQDAEFFDRNKVGDLI 255
            +LA++    + S  A   + ++L +      ++   N++  ++      FF+   +G ++
Sbjct: 991  YLAIYFALGIGSALATLIQTIVLWVFCTIHASKYLHNLMTNSVLRAPMTFFETTPIGRIL 1050

Query: 256  SRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIY 315
            +R S+D Y V   + +  S  F       V +     +                V    Y
Sbjct: 1051 NRFSNDIYKVDALLGRTFSQFF----VNAVKVTFTITVICATTWQFIFIIIPLSVFYIYY 1106

Query: 316  GRKIRSISRDLQQ----STGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVG 371
             +     SR+L++    +   +    +E L G+ TV+ +  +    KR++H  +   D  
Sbjct: 1107 QQYYLRTSRELRRLDSITRSPIYSHFQETLGGLATVRGYSQQ----KRFSHINQCRIDNN 1162

Query: 372  KREALTNATFFSSTSVLGDFSFLIVLAYGSHLVL-----------QGSLSIGDLTAFMLY 420
                   + F+ S +     ++ + L  GS ++L           QG+L+ G +   + Y
Sbjct: 1163 M------SAFYPSINANRWLAYRLELI-GSIIILGAATLSVFRLKQGTLTAGMVGLSLSY 1215

Query: 421  TEYSGSAVFGLSNFYSELMKGAGAASRLFELTD---HQPSIYATKGVP-YVPGKGEIKFE 476
                   +  +     E+     +  R+ E  D     P I      P   P +G+IKF 
Sbjct: 1216 ALQITQTLNWIVRMTVEVETNIVSVERIKEYADLKSEAPLIVEGHRPPKEWPSQGDIKFN 1275

Query: 477  NVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDG 536
            N S  Y     + +  ++N  I     V +VG +G GKS++   L +    + G I ID 
Sbjct: 1276 NYSTRYRPE-LDLVLKHINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEASEGNIVIDN 1334

Query: 537  QDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDE--IRSVSKKCFCHNF 594
              I++I    LR  L ++ Q+  +  G++R+NI    P     DE   R++       + 
Sbjct: 1335 IAINEIGLYDLRHKLSIIPQDSQVFEGTVRENID---PINQYTDEAIWRALELSHLKEHV 1391

Query: 595  ITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYT 654
            ++  +DG +  +   G  LS GQ+Q + +ARA++    IL+LDEAT+A+DVE++  +  T
Sbjct: 1392 LSMSNDGLDAQLTEGGGNLSVGQRQLLCLARAMLVPSKILVLDEATAAVDVETDKVVQET 1451

Query: 655  LGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNE 714
            +    K R  TI++IAHRL+TI  S+ +IVL D+G V E     +L +  +S  Y L  E
Sbjct: 1452 IRTAFKDR--TILTIAHRLNTIMDSDRIIVL-DNGKVAEFDSPGQLLSDNKSLFYSLCME 1508

 Score =  105 bits (261), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 103/419 (24%), Positives = 191/419 (45%), Gaps = 38/419 (9%)

Query: 322 ISRDLQQSTGNL----TKVAEEQLSGVKTVQSFVAEQK-----EIKRYNHAIRKVFDVGK 372
           I + LQ+S        T+V  E L+ +K+++ +  E+      E  R N  ++ +  +G 
Sbjct: 468 IQKKLQKSQMKYKDERTRVISEILNNIKSLKLYAWEKPYREKLEEVRNNKELKNLTKLGC 527

Query: 373 REALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLS 432
             A+T+  F     ++   +F  V  Y     L   L    LT F L + +    +  + 
Sbjct: 528 YMAVTSFQFNIVPFLVSCCTF-AVFVYTEDRALTTDLVFPALTLFNLLS-FPLMIIPMVL 585

Query: 433 NFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKF---ENVSFSYPTRSANQ 489
           N + E     G     F   + QP   + + +P V   G++     ++ +F +  +   +
Sbjct: 586 NSFIEASVSIGRLFTFFTNEELQPD--SVQRLPKVKNIGDVAINIGDDATFLWQRKPEYK 643

Query: 490 I-FNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLR 548
           +   N+NF    G+  C+VG  G GK+ + S +L       G  T+ G            
Sbjct: 644 VALKNINFQAKKGNLTCIVGKVGSGKTALLSCMLGDLFRVKGFATVHGS----------- 692

Query: 549 RHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGP 608
             +  V Q P +M+G++++NI +G  Y     E     K C     +    DG +T++G 
Sbjct: 693 --VAYVSQVPWIMNGTVKENILFGHRYDAEFYE--KTIKACALTIDLAILMDGDKTLVGE 748

Query: 609 KGALLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTLGQ--LMKSRDIT 665
           KG  LSGGQK R+++ARA+  + +  +LD+  +A+D   +   I + LG   L+ ++  T
Sbjct: 749 KGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTK--T 806

Query: 666 IISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKDTTSKMN 724
            +   +++S +  ++++ +L D+G + + G + E+    +S L+KLLN   K    K N
Sbjct: 807 KVLATNKVSALSIADSIALL-DNGEITQQGTYDEITKDADSPLWKLLNNYGKKNNGKSN 864

>NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON}
            Anc_4.6
          Length = 1682

 Score =  134 bits (338), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 130/530 (24%), Positives = 227/530 (42%), Gaps = 66/530 (12%)

Query: 229  RLRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAII-CGGVGI 287
            ++  +++   +H    FFD   +G +++R S D   V + +T  +   F  ++ C    +
Sbjct: 1159 KIFKSLLHTVLHSKLRFFDATPIGRIMNRFSKDIEAVDQELTPYLEAAFYCLVECVSTML 1218

Query: 288  GMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTV 347
             + F                  VG   Y    R + R    +   + +   E L G+ T+
Sbjct: 1219 LIAFITPQFLILAIFIGFLYYLVGY-FYMAASRELKRFESVTKSPIYQHFSETLVGIVTI 1277

Query: 348  QSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSF-------LIVLAYG 400
            +++  E++ +    H I +           N  FF   +     SF       L+V   G
Sbjct: 1278 RAYGDEKRFMLENLHKIDE----------NNKPFFYLWAFNRWLSFRIDMIGSLVVFGAG 1327

Query: 401  SHLVLQ-----GSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQ 455
              ++L        L+   LT  + +TE    A   L  FY+++     +  RL E  +  
Sbjct: 1328 VFIILNIDNLDSGLAGISLTYAISFTE----AALWLVRFYADVEMNMNSVERLKEYMEID 1383

Query: 456  PSIYATK-------GVPYVPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVG 508
               Y           V   P  G+I+  N+S  Y   +  ++  N+ F ++    V VVG
Sbjct: 1384 QEPYEEHLERSEVLAVDNWPRNGKIEVNNLSLRYAP-NLPKVIKNVTFVVEPNCKVGVVG 1442

Query: 509  PSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDN 568
             +G GKSTI + L ++ +  +G I ID  DI+ ++   LRR + ++ Q+P L SG+IR N
Sbjct: 1443 RTGAGKSTIITALFRFLDAETGYIKIDDIDITTVNLTKLRRSITIIPQDPTLFSGTIRSN 1502

Query: 569  ITYGVPYTPTIDEIRSVSKKCFCHNFI---------------------TKFSDGYETVIG 607
            +    PY    D+  ++ K     N I                      KF +  +  I 
Sbjct: 1503 LD---PYNEFSDD--AIFKALRRVNLINENESTGPASSETSPSSTENVNKFLN-LKNEIT 1556

Query: 608  PKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITII 667
              G  LS GQ+Q + +AR+L++ P I++LDEAT+++D  S+  I  T+ +  K    TI+
Sbjct: 1557 EGGNNLSHGQRQLVCLARSLLRCPKIILLDEATASIDNASDAKIQETIRKEFKES--TIL 1614

Query: 668  SIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAK 717
            +IAHRL ++   + ++V+ D G V E      L  +K S  Y +  +  +
Sbjct: 1615 TIAHRLRSVCDYDKILVM-DAGEVKEYDHPYSLLLNKNSIFYSMCEQSGE 1663

 Score = 98.2 bits (243), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 67/228 (29%), Positives = 114/228 (50%), Gaps = 9/228 (3%)

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           I F+N + ++  +++     +LN     G    V+GP+G GKS++   LL   +  +G I
Sbjct: 731 IAFQNATVAWDKKNSEFKLRDLNIDFKPGKLNVVIGPTGSGKSSLLLALLGEMHLENGNI 790

Query: 533 ---TIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKC 589
              ++D +D   I    +   +    Q   L++ ++R+NI +  PY        +V + C
Sbjct: 791 IVPSLDPRDELVIDHDGMTNSIAYCSQGAWLLNDTVRNNILFNSPYNEA--RYNAVVEAC 848

Query: 590 FCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEG 649
                      G  T IG KG  LSGGQKQR+++ARAL      ++LD+  SA+D  +  
Sbjct: 849 CLKRDFEILKAGDMTEIGEKGITLSGGQKQRVSLARALYSNSRHVLLDDCLSAVDSHTAL 908

Query: 650 AI--NYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMG 695
            I  N   G LM++R  T I ++H ++   R+  ++V+ +DG V + G
Sbjct: 909 WIYDNCITGPLMENR--TCILVSHNIALTLRNAELVVILEDGRVKDQG 954

>Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  134 bits (336), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 145/560 (25%), Positives = 245/560 (43%), Gaps = 61/560 (10%)

Query: 189  VWG-LGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFD 247
            VW  +G+Y  + V + A     F N   +V+L     +   +L  N+ K  I     FF+
Sbjct: 1017 VWMFVGVYSLIGVGSAA-----FNNLRSIVMLLYCSIRGSKKLHENMAKSVIRSPMVFFE 1071

Query: 248  RNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXX 307
               VG +I+R SSD   V  S+    S  FK+I+   V + ++ +               
Sbjct: 1072 TTPVGRIINRFSSDMDAVDSSLQYIFSFFFKSILTYLVTVILVGYNMPWFFVFNMFLLVI 1131

Query: 308  XXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEI----KRYNHA 363
                 T Y    R + R +  S   +  +  E L+G   + ++   ++ I    ++  + 
Sbjct: 1132 YIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYN 1191

Query: 364  IRKVFD-------VGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLV---LQGSLSI-G 412
            I  VF+       +  R     AT   +T++L   +        S +V   +  SL + G
Sbjct: 1192 IDFVFNFRSTNRWLSVRLQTIGATIVLATAMLALTTMNTKKQLSSGMVGLLMSYSLEVTG 1251

Query: 413  DLTAFMLYTEYSGSAVFGLSNF--YSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGK 470
             LT  +  T    + +  +     Y EL   A + +      +++P           P K
Sbjct: 1252 SLTWIVRTTVMIETNIVSVERIVEYCELPSEARSIN-----PENRPD-------ESWPSK 1299

Query: 471  GEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSG 530
            G I+F+N S  Y   + + +  ++N  I     + +VG +G GKST++  L +   PT G
Sbjct: 1300 GSIEFKNYSTKY-RENLDPVLKDINVRIKPCEKIGIVGRTGAGKSTLSLALFRILEPTEG 1358

Query: 531  RITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYT-------------- 576
             I ID  +IS +    LR HL ++ Q+     G++R N+     Y+              
Sbjct: 1359 SIVIDDINISDLGLFDLRSHLAIIPQDAQAFEGTVRTNLDPFNRYSEGELKKAVDLAHLG 1418

Query: 577  PTID-----EIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKP 631
            P ++     EIR        +  +   SD     I   G  LS GQ+Q + +ARAL+ + 
Sbjct: 1419 PHLEKMLDNEIRGADGAAEENGNV---SDVLNVKINENGTNLSVGQRQLLCLARALLNRS 1475

Query: 632  NILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSV 691
             IL+LDEAT+++D+E++  I  T+ +  K R  TI++IAHR+ T+  S+ +IVL D+G+V
Sbjct: 1476 KILVLDEATASVDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DEGTV 1532

Query: 692  VEMGKFKELYASKESKLYKL 711
             E     +L + K S  Y L
Sbjct: 1533 KEFDSPSKLLSDKASIFYSL 1552

 Score = 98.6 bits (244), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 114/460 (24%), Positives = 211/460 (45%), Gaps = 64/460 (13%)

Query: 317 RKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVG---KR 373
           RK++ +S+   +      K   E L+ +K+++ +  E+  ++R NH +R   ++    K 
Sbjct: 455 RKVKKLSKTQMKYKDLRIKTITEILNAIKSIKLYAWEEPMMERLNH-VRNDMELQNFRKI 513

Query: 374 EALTNATFFS--------STSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSG 425
             ++N  +F+        + S  G FS        S   L  ++    L+ F +      
Sbjct: 514 GIVSNLIYFAWNCVPLMVTCSTFGLFSLF------SDTPLSPAIVFPSLSLFNIL----N 563

Query: 426 SAVFGLSNFYSELMKGAGAASRL--FELTDHQPSIYATKGVPYVPGKG--EIKFENVSFS 481
           SA++ + +  + +++ + +  RL  F L+D     +  +  P +  +    I+  N++F 
Sbjct: 564 SAIYSVPSMINTIIETSVSMERLKSFLLSDEIDDSFIERIDPSMSERTLPVIEMNNITFL 623

Query: 482 YPTRSA---NQIFNNLN-------------------FTIDSGSNVCVVGPSGRGKSTIAS 519
           + ++ A    Q   N N                   F    G  VCVVG  G GKST   
Sbjct: 624 WKSKEALASGQFEGNSNADEESIIGSSQIALKNIDHFEAKRGDLVCVVGRVGAGKSTFLK 683

Query: 520 LLLKYYNPTSG-RITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPT 578
            +L      SG + +I  + I + S+      L    QE  +M+ S+R+NI +G  +   
Sbjct: 684 GILGQLPCMSGSKGSIPPKLIIRASS------LAYCSQESWIMNSSVRENILFGHKFDKA 737

Query: 579 IDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDE 638
             ++    K C     +    DG ET++G KG  LSGGQK R+++ARA+  + +I +LD+
Sbjct: 738 YYDL--TIKACQLLPDLKILPDGDETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDD 795

Query: 639 ATSALDVE-SEGAINYTL-GQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGK 696
             SA+D E S+  + Y L G+    ++ TII   + +  ++ S+ +  L ++G ++E G 
Sbjct: 796 VLSAVDAEVSKNIVEYVLIGKAALLKNKTIILATNTVPILKHSQMIYAL-ENGEIIEQGN 854

Query: 697 FKELY--ASKESKLYKLLNE--KAKDTTSKMNAETVEKND 732
           ++ +    +  SKL KLL E     D  SK + +T  +++
Sbjct: 855 YEGVMNRENTNSKLKKLLEEFDSPIDNGSKSDIQTEHRSE 894

>AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YDR135C (YCF1)
          Length = 1492

 Score =  134 bits (336), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 96/274 (35%), Positives = 142/274 (51%), Gaps = 10/274 (3%)

Query: 450  ELTDHQPSIYATKGVPY--VPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVV 507
            EL    P   A   VP    P  GEIKFEN S  Y     + I   +N  I     V +V
Sbjct: 1226 ELEPEAPQFIA-NSVPSGDWPKDGEIKFENYSTRYRP-GLDLILRGINLHIKPHERVGIV 1283

Query: 508  GPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRD 567
            G +G GKS++A  L +      G I+IDG  I  I    LR+ L ++ Q+  +  G++RD
Sbjct: 1284 GRTGAGKSSLALSLFRIIEAAEGHISIDGVPIDTIGLTDLRKKLSIIPQDSQVFEGTVRD 1343

Query: 568  NITYGVPYTPTIDEIRSVSKKCFCHNFITKF-SDGYETVIGPKGALLSGGQKQRIAIARA 626
            NI     YT   ++I    +     + +    SDG +T +   G  LS GQ+Q + +ARA
Sbjct: 1344 NIDPTKQYTD--EQIWKALELSHLADHVKGMGSDGLDTPLTEGGKNLSVGQRQLMCLARA 1401

Query: 627  LIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLG 686
            L+    IL+LDEAT+A+DVE++  I  T+      R  TI++IAHR++TI  S+ ++VL 
Sbjct: 1402 LLIPFRILVLDEATAAIDVETDKVIQDTIRSSFNDR--TILTIAHRINTIMDSDKIVVL- 1458

Query: 687  DDGSVVEMGKFKELYASKESKLYKLLNEKAKDTT 720
            D G+V E    + L   KE  ++  L ++A  T+
Sbjct: 1459 DKGTVAEFDTPENLLKKKEESIFYTLCKEAGLTS 1492

 Score = 90.5 bits (223), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 114/548 (20%), Positives = 234/548 (42%), Gaps = 116/548 (21%)

Query: 223 GEKLVARLRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQ--NI--SDGFK 278
           G  L + + S + KK +H   E    +  GD+++ +S DA  + R +TQ  N+  S  F+
Sbjct: 355 GTDLRSGITSLIYKKALHLSNEASGTSATGDIVNLMSVDAQRL-RDLTQWGNVIWSGPFQ 413

Query: 279 AIIC---------GGVGIGMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQS 329
             +C           + +G++  + +                 +   R ++ + ++  ++
Sbjct: 414 LCLCLYSLHRLLGPCIWVGVVLLLFTLPLN-------------SYISRVLKRLQKEQMKN 460

Query: 330 TGNLTKVAEEQLSGVKTVQSFVAE------------QKEIK--------------RYN-- 361
               T++  E L+ +K+++ +  E            QKE+K              +YN  
Sbjct: 461 KDERTRLISEILNNIKSLKLYAWEIPYKEKLDYVRNQKELKTLRKMGLTTAFANFQYNII 520

Query: 362 -----HAIRKVFDVGKR-EALTNATFFSSTSVLGDFSF-LIVLAYGSHLVLQGSLSIGDL 414
                 +   VF + ++   LT    F + ++    SF L VL       ++ S++IG L
Sbjct: 521 PFLVSCSTFAVFVLTQKGRPLTTDLVFPALTLFNLLSFPLAVLPIAITSFIEASVAIGRL 580

Query: 415 TAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIK 474
           T F+   E    A+                          +P++ A  GV          
Sbjct: 581 TNFLTAEELQRDAI------------------------TREPAVKAPGGVAVALA----- 611

Query: 475 FENVSFSYPTRSANQI-FNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRIT 533
            +N +F +  +   ++   N+NF        C++G  G GKS +   +L           
Sbjct: 612 -DNATFLWQRKPEYKVALKNINFRAKKSELTCIIGKVGSGKSALIQAMLG---------- 660

Query: 534 IDGQDISKISAKSLRR-HLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCH 592
               D+ +++  ++ R ++  V Q   +M+G++RDNI +G  Y       +   K C   
Sbjct: 661 ----DLFRVNGSAVVRGNVAYVSQVAWIMNGTVRDNILFGHKYDAKF--YQQTIKACALT 714

Query: 593 NFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAI 651
             ++   DG  T +G KG  LSGGQK R+++ARA+  + +  +LD+  +A+D   ++  +
Sbjct: 715 VDLSILPDGDNTFVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVAKHLL 774

Query: 652 NYTLGQ--LMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLY 709
               G   L+KS+   + +  ++++ +  ++++++L ++G +V+ G F E+ + ++S + 
Sbjct: 775 QNVFGPNGLLKSKARVLTT--NKITALEIADHIVLL-ENGEIVQQGTFSEVISDEDSAIS 831

Query: 710 KLLNEKAK 717
           KL+    K
Sbjct: 832 KLVLHHGK 839

>Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  134 bits (336), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 130/535 (24%), Positives = 237/535 (44%), Gaps = 44/535 (8%)

Query: 197  FLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTI-HQDAEFFDRNKVGDLI 255
            +LA++    + S  A   + ++L +      ++   N++  ++      FF+   +G ++
Sbjct: 992  YLAIYFALGIGSALATLIQTIILWVFCTIHASKYLHNLMTNSVLRAPMTFFETTPIGRIL 1051

Query: 256  SRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIY 315
            +R S+D Y V   + +  S  F       V +     +                V    Y
Sbjct: 1052 NRFSNDIYKVDALLGRTFSQFF----VNAVKVTFTITVICATTWQFIFIIIPLGVFYIYY 1107

Query: 316  GRKIRSISRDLQQ----STGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVG 371
             +     SR+L++    +   +    +E L G+ TV+ +  +    KR++H  +   D  
Sbjct: 1108 QQYYLRTSRELRRLDSITRSPIYSHFQETLGGLATVRGYSQQ----KRFSHINQCRIDNN 1163

Query: 372  KREALTNATFFSSTSVLGDFSFLIVLAYGSHLVL-----------QGSLSIGDLTAFMLY 420
                   + F+ S +     ++ + L  GS ++L           QG+L+ G +   + Y
Sbjct: 1164 M------SAFYPSINANRWLAYRLELI-GSIIILGAATLSVFRLKQGTLTSGMVGLSLSY 1216

Query: 421  TEYSGSAVFGLSNFYSELMKGAGAASRLFELTD---HQPSIYATKGVP-YVPGKGEIKFE 476
                   +  +     E+     +  R+ E  D     P I      P   P +G+I+F 
Sbjct: 1217 ALQITQTLNWIVRMTVEVETNIVSVERIKEYADLKSEAPLIIEGHRPPKQWPAQGDIRFN 1276

Query: 477  NVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDG 536
            N S  Y     + +   +N  I     V +VG +G GKS++   L +    + G I IDG
Sbjct: 1277 NYSTRYRPE-LDLVLKQINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEASEGNIVIDG 1335

Query: 537  QDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDE--IRSVSKKCFCHNF 594
              I++I    LR  L ++ Q+  +  G++R+NI    P     DE   R++       + 
Sbjct: 1336 VSINEIGLYDLRHKLSIIPQDSQVFEGTVRENID---PINQYSDEAIWRALELSHLKEHV 1392

Query: 595  ITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYT 654
            ++  +DG +  +   G+ LS GQ+Q + +ARA++    IL+LDEAT+A+DVE++  +  T
Sbjct: 1393 LSMSNDGLDAQLSEGGSNLSVGQRQLLCLARAMLVPSKILVLDEATAAVDVETDKVVQET 1452

Query: 655  LGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLY 709
            +    K R  TI++IAHRL+TI  S+ +IVL D+G V E     +L ++ +S  Y
Sbjct: 1453 IRTAFKDR--TILTIAHRLNTIMDSDRIIVL-DNGKVAEFDTPGQLLSNSKSLFY 1504

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 103/421 (24%), Positives = 195/421 (46%), Gaps = 38/421 (9%)

Query: 322 ISRDLQQSTGNL----TKVAEEQLSGVKTVQSFVAEQK-----EIKRYNHAIRKVFDVGK 372
           I + LQ+S        T+V  E L+ +K+++ +  E+      E  R N  ++ +  +G 
Sbjct: 469 IQKKLQKSQMKYKDERTRVISEILNNIKSLKLYAWEKPYREKLEEVRNNKELKNLTKLGC 528

Query: 373 REALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLS 432
             A+T+  F     ++   +F  V  Y     L   L    LT F L + +    +  + 
Sbjct: 529 YMAVTSFQFNIVPFLVSCCTF-AVFVYTEDRALTTDLVFPALTLFNLLS-FPLMIIPMVL 586

Query: 433 NFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKF---ENVSFSYPTRSANQ 489
           N + E     G     F   + QP   + + +P V   G+I     ++ +F +  +   +
Sbjct: 587 NSFIEASVSIGRLFSFFTNEELQPD--SVQRLPNVENIGDIAINIGDDATFLWQRKPEYK 644

Query: 490 I-FNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLR 548
           +   N++F    G+  C+VG  G GK+ + S +L       G  T+ G            
Sbjct: 645 VALKNIDFQATKGNLTCIVGKVGSGKTALLSCMLGDLFRVKGFATVHG------------ 692

Query: 549 RHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGP 608
             +  V Q P +M+G++++NI +G  Y     E     K C     +    DG +T++G 
Sbjct: 693 -CIAYVSQVPWIMNGTVKENILFGHKYDAEFYE--KTIKACALTIDLAILMDGDKTLVGE 749

Query: 609 KGALLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTLGQ--LMKSRDIT 665
           KG  LSGGQK R+++ARA+  + +  +LD+  +A+D   +   I + LG   L+ ++  T
Sbjct: 750 KGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTK--T 807

Query: 666 IISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKDTTSKMNA 725
            I   +++S +  ++++ +L D+G +++ G + ++    +S L+KLLN+  K   +K + 
Sbjct: 808 RILATNKVSALSIADSIALL-DNGEIIQQGAYSDITKDADSPLWKLLNDYGKKNNNKQSE 866

Query: 726 E 726
           E
Sbjct: 867 E 867

>SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} similar
            to uniprot|P39109 Saccharomyces cerevisiae YDR135C
          Length = 1499

 Score =  133 bits (335), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 126/478 (26%), Positives = 218/478 (45%), Gaps = 17/478 (3%)

Query: 245  FFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXX 304
            FF+   +G +++R S+D Y V   + +  S  F  ++     I ++   +          
Sbjct: 1025 FFETTPIGRILNRFSNDIYKVDELLGRTFSQFFVNVVKVTFTIVVICTSTWQFILVVLPL 1084

Query: 305  XXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAI 364
                      Y R  R + R    +   +    +E L GV T++ +  +QK     N A 
Sbjct: 1085 SVLYIYYQQYYLRTSRELRRLDSVTRSPIYAHFQETLGGVSTIRGY-GQQKRFAHINQA- 1142

Query: 365  RKVFDVGKREALTNATFFSS--TSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTE 422
            R   ++       NA  + +     LG    L         + QG+L+ G +   + Y  
Sbjct: 1143 RIDNNMSAFYPAVNANRWLAFRLEFLGSIIILGAATLSVFRLKQGTLTAGMIGLSLSYAL 1202

Query: 423  YSGSAVFGLSNFYSELMKGAGAASRL---FELTDHQPSIYATKGVPY-VPGKGEIKFENV 478
                ++  +     E+     +  R+    EL    P+I  +   P   P +G+I+FE+ 
Sbjct: 1203 QITQSLNWIVRMTVEVETNIVSVERIKEYAELKPEAPAIIESSRPPKGWPSQGDIRFEHY 1262

Query: 479  SFSYPTRSANQ-IFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQ 537
            S  Y  R   Q I  ++N  I +   V +VG +G GKS++   L +      G I IDG 
Sbjct: 1263 STRY--RPELQLILRDVNLHIKAREKVGIVGRTGAGKSSLTLALFRIIEAAEGHIFIDGL 1320

Query: 538  DISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEI-RSVSKKCFCHNFIT 596
                I    LR  L ++ Q+  + +G++R+N+     +T   +EI  ++       + ++
Sbjct: 1321 STDTIGLADLRHKLSIIPQDSQVFAGTLRENVDPTEEFTD--EEIWHALELSHLKEHVMS 1378

Query: 597  KFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLG 656
              +DG +T++   G+ LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE++  I  T+ 
Sbjct: 1379 MGNDGLQTMLTECGSNLSVGQRQLLCLARALLIPSKILVLDEATAAVDVETDRVIQETIR 1438

Query: 657  QLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNE 714
               K+R  TI++IAHR++TI  S+ +IVL ++G V E    + L    +S  Y L  E
Sbjct: 1439 TAFKNR--TILTIAHRINTIMDSDKIIVL-NEGQVAEFDTPENLLQRPDSLFYSLCKE 1493

 Score =  100 bits (250), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 101/411 (24%), Positives = 184/411 (44%), Gaps = 63/411 (15%)

Query: 334 TKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSF 393
           T+V  E L+ +K+++ +  E    K+ ++       V   + L N T    T  L  F F
Sbjct: 475 TRVISEILNNIKSLKLYAWEVPYKKKLDY-------VRNEKELKNLTKMGCTLALASFQF 527

Query: 394 LIVLAYGSHLVLQGSLSIGDLT----AFMLYTEYSGSAVFGLSNF--------YSELMKG 441
            IV      LV   + ++  +T    A      +    +F L +F         +  ++ 
Sbjct: 528 NIV----PFLVSCSTFAVFVMTQKGRALTTDLVFPALTLFNLLSFPLAVVPNAITSFIEA 583

Query: 442 AGAASRLFE-LTDHQPSIYATKGVPYVPGKGEIKFE---NVSFSYPTRSANQI-FNNLNF 496
           + + +RL   LT+ +    +    P V  KG+I  +   + +F +  +   ++   N+NF
Sbjct: 584 SVSVNRLHSFLTNEELQKDSVSREPSVTSKGDIAVKVGGDATFLWQRKPEYKVALKNINF 643

Query: 497 TIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQ 556
               G   C+VG  G GKS +   +L       G  TI G              +  V Q
Sbjct: 644 QAKKGELTCIVGRVGSGKSALIQSILGDLFRVKGFATIHGS-------------VAYVSQ 690

Query: 557 EPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGG 616
            P +M+G++++NI +G  Y P+  E     K C  +  ++    G +T++G KG  LSGG
Sbjct: 691 IPWIMNGTVKENILFGHKYDPSFYE--KTVKACALNVDLSILPQGDQTLVGEKGISLSGG 748

Query: 617 QKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTLG---------QLMKSRDITI 666
           QK R+++ARA+  + +  +LD+  +A+D   ++  ++  LG         +++ +  IT+
Sbjct: 749 QKARLSLARAVYSRADTYLLDDPLAAVDEHVAKHLVDNVLGVTGLLHSKTKVLATNKITV 808

Query: 667 ISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAK 717
           +SIA          + I L ++G +V+ G + E+     S L KL++E  K
Sbjct: 809 LSIA----------DSIALLENGEIVQQGSYDEVVRDDGSALSKLIHEYGK 849

>Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  133 bits (334), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 136/558 (24%), Positives = 241/558 (43%), Gaps = 57/558 (10%)

Query: 189  VWG-LGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFD 247
            VW  +G+Y  L V + A     F N   +++L     +   +L  N+ K  I     FF+
Sbjct: 1017 VWMFVGVYSLLGVGSAA-----FNNLRSIIMLLYCSIRGSKKLHENMAKSVIRSPMVFFE 1071

Query: 248  RNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXX 307
               VG +I+R SSD   V  S+    S  FK+I+   V I ++ +               
Sbjct: 1072 TTPVGRIINRFSSDMDAVDSSLQYVFSFFFKSILTYLVTIVLVGYNMPWFLVFNMFLLVI 1131

Query: 308  XXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKV 367
                 T Y    R + R +  S   +  +  E L+G   + +          YNH  R +
Sbjct: 1132 YIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDA----------YNHYERFI 1181

Query: 368  FDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVL------------QGSLSIGDLT 415
            + +   +  +N     +   +  +  + +   G+ +VL            +  LS G + 
Sbjct: 1182 Y-LNYDKIQSNIDLVFNFRSINRWLSVRLQTIGATIVLATALLALATINTKNQLSSGMVG 1240

Query: 416  AFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYAT----KGVPYVPGKG 471
              M Y+    S++  +      +     +  R+ E  +  P   +     +     P +G
Sbjct: 1241 LLMAYSFEVTSSLTWIVRTTVMIETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSEG 1300

Query: 472  EIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGR 531
             I+F+N S  Y   + + +  ++N +I     + +VG +G GKST++  L +   P+ G 
Sbjct: 1301 RIEFKNYSTKY-RENLDPVLKDINVSIQPCEKIGIVGRTGAGKSTLSLALFRILEPSEGE 1359

Query: 532  ITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFC 591
            I ID  +IS++    LR +L ++ Q+     G++R N+     Y+   DE++   +    
Sbjct: 1360 IIIDDVNISELGLFDLRSNLAIIPQDAQAFEGTVRTNLDPFNRYSE--DELKRAIELAHL 1417

Query: 592  HNFITKF------------------SDGYETVIGPKGALLSGGQKQRIAIARALIKKPNI 633
             + + K                    D  +  I   G+ LS GQ+Q + +ARAL+    I
Sbjct: 1418 KSHLEKMLGNEAENNDINVEERGNAKDILDVKINENGSNLSVGQRQLLCLARALLSHSKI 1477

Query: 634  LILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVE 693
            L+LDEAT+++D+E++  I  T+ +  K R  TI++IAHR+ T+  S+ +IVL D G+V E
Sbjct: 1478 LVLDEATASVDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DKGNVKE 1534

Query: 694  MGKFKELYASKESKLYKL 711
                 +L + K S  Y L
Sbjct: 1535 FDSPSKLLSDKGSIFYSL 1552

 Score = 98.2 bits (243), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 112/448 (25%), Positives = 204/448 (45%), Gaps = 66/448 (14%)

Query: 335 KVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVG---KREALTNATFFS-------- 383
           K   E L+ +K+++ +  E+  +K+ NH +R   ++    K   ++N  +F+        
Sbjct: 473 KTITELLNAIKSIKLYAWEEPMMKKLNH-VRNDMELKNFRKIGIVSNLIYFAWNCVPLMV 531

Query: 384 STSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAG 443
           + S  G FS        +   L  S+    L+ F +      SA++ + +  + +++ + 
Sbjct: 532 TCSTFGLFSLF------NDTPLSPSIVFPSLSLFNIL----NSAIYSVPSMINSIIETSV 581

Query: 444 AASRL--FELTDH--QPSIYATKGVPYVPGKGEIKFENVSFSYPTRSA---NQIFNN--- 493
           +  RL  F L+D      I  T           ++  N++F + ++ A   +Q+ NN   
Sbjct: 582 SMERLKSFLLSDEVDDSFIERTNSPSSDSALPVLEMNNITFLWKSKEALASSQLENNSRT 641

Query: 494 ----------------LNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQ 537
                            +F    G  +CVVG  G GKST    +L       G++     
Sbjct: 642 DEESIMGSSQIALKNIEHFEAKRGDLICVVGRVGAGKSTFLKAIL-------GQLPCMSG 694

Query: 538 DISKISAKSLRR--HLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFI 595
               ++ K + R   L    QE  +M+ S+R+NI +G  +     ++    K C     +
Sbjct: 695 SKESLAPKLIIRASSLAYCSQESWIMNASVRENILFGHKFDKAYYDL--TIKACQLLPDL 752

Query: 596 TKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYT 654
               DG ET++G KG  LSGGQK R+++ARA+  + +I +LD+  SA+D E S+  I + 
Sbjct: 753 KILPDGDETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEHV 812

Query: 655 L-GQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKE--SKLYKL 711
           L G+    ++ TII   + +S ++ S+ +  L ++G +VE G ++ +   +   SKL KL
Sbjct: 813 LIGKTALLKNKTIILTTNTVSILKHSQMIYAL-ENGEIVEQGNYESVMKRENDSSKLKKL 871

Query: 712 LNEKAKDTTSKMNAETVEKNDPSPKTEK 739
           L E   DT      E+  + D SP+ ++
Sbjct: 872 LEE--FDTPIDNMNESDRRTDQSPERDE 897

>Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W
           (REAL)
          Length = 990

 Score =  132 bits (331), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 136/558 (24%), Positives = 241/558 (43%), Gaps = 57/558 (10%)

Query: 189 VWG-LGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFD 247
           VW  +G+Y  L V + A     F N   +++L     +   +L  N+ K  I     FF+
Sbjct: 446 VWMFVGVYSLLGVGSAA-----FNNLRSIIMLLYCSIRGSKKLHENMAKSVIRSPMVFFE 500

Query: 248 RNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXX 307
              VG +I+R SSD   V  S+    S  FK+I+   V I ++ +               
Sbjct: 501 TTPVGRIINRFSSDMDAVDSSLQYVFSFFFKSILTYLVTIVLVGYNMPWFLVFNMFLLVI 560

Query: 308 XXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKV 367
                T Y    R + R +  S   +  +  E L+G   + +          YNH  R +
Sbjct: 561 YIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDA----------YNHYERFI 610

Query: 368 FDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVL------------QGSLSIGDLT 415
           + +   +  +N     +   +  +  + +   G+ +VL            +  LS G + 
Sbjct: 611 Y-LNYDKIQSNIDLVFNFRSINRWLSVRLQTIGATIVLATALLALATINTKNQLSSGMVG 669

Query: 416 AFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYAT----KGVPYVPGKG 471
             M Y+    S++  +      +     +  R+ E  +  P   +     +     P +G
Sbjct: 670 LLMAYSFEVTSSLTWIVRTTVMIETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSEG 729

Query: 472 EIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGR 531
            I+F+N S  Y   + + +  ++N +I     + +VG +G GKST++  L +   P+ G 
Sbjct: 730 RIEFKNYSTKY-RENLDPVLKDINVSIQPCEKIGIVGRTGAGKSTLSLALFRILEPSEGE 788

Query: 532 ITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFC 591
           I ID  +IS++    LR +L ++ Q+     G++R N+     Y+   DE++   +    
Sbjct: 789 IIIDDVNISELGLFDLRSNLAIIPQDAQAFEGTVRTNLDPFNRYSE--DELKRAIELAHL 846

Query: 592 HNFITKF------------------SDGYETVIGPKGALLSGGQKQRIAIARALIKKPNI 633
            + + K                    D  +  I   G+ LS GQ+Q + +ARAL+    I
Sbjct: 847 KSHLEKMLGNEAENNDINVEERGNAKDILDVKINENGSNLSVGQRQLLCLARALLSHSKI 906

Query: 634 LILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVE 693
           L+LDEAT+++D+E++  I  T+ +  K R  TI++IAHR+ T+  S+ +IVL D G+V E
Sbjct: 907 LVLDEATASVDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DKGNVKE 963

Query: 694 MGKFKELYASKESKLYKL 711
                +L + K S  Y L
Sbjct: 964 FDSPSKLLSDKGSIFYSL 981

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 130/250 (52%), Gaps = 16/250 (6%)

Query: 495 NFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSG-RITIDGQDISKISAKSLRRHLGV 553
           +F    G  +CVVG  G GKST    +L      SG + ++  + I + S+      L  
Sbjct: 88  HFEAKRGDLICVVGRVGAGKSTFLKAILGQLPCMSGSKESLAPKLIIRASS------LAY 141

Query: 554 VQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALL 613
             QE  +M+ S+R+NI +G  +     ++    K C     +    DG ET++G KG  L
Sbjct: 142 CSQESWIMNASVRENILFGHKFDKAYYDL--TIKACQLLPDLKILPDGDETLVGEKGISL 199

Query: 614 SGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTL-GQLMKSRDITIISIAH 671
           SGGQK R+++ARA+  + +I +LD+  SA+D E S+  I + L G+    ++ TII   +
Sbjct: 200 SGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEHVLIGKTALLKNKTIILTTN 259

Query: 672 RLSTIRRSENVIVLGDDGSVVEMGKFKELYASKE--SKLYKLLNEKAKDTTSKMNAETVE 729
            +S ++ S+ +  L ++G +VE G ++ +   +   SKL KLL E   DT      E+  
Sbjct: 260 TVSILKHSQMIYAL-ENGEIVEQGNYESVMKRENDSSKLKKLLEE--FDTPIDNMNESDR 316

Query: 730 KNDPSPKTEK 739
           + D SP+ ++
Sbjct: 317 RTDQSPERDE 326

>KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1500

 Score =  132 bits (331), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 91/251 (36%), Positives = 134/251 (53%), Gaps = 13/251 (5%)

Query: 468  PGKGEIKFENVSFSYPTRSANQI-FNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYN 526
            P +G IKFEN S  Y  R   ++   ++N  I     + +VG +G GKS++   L +   
Sbjct: 1253 PSQGSIKFENYSARY--RPELELSLKDINLDIKPQERIGIVGRTGAGKSSLTLALFRIIE 1310

Query: 527  PTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVS 586
              SGRI IDG  I  I  + LR HL ++ Q+  L  G+IR+NI     YT   ++I    
Sbjct: 1311 AASGRIYIDGLPIDSIGLRDLRHHLSIIPQDSQLFEGTIRENIDPTNEYTD--EQIWRAL 1368

Query: 587  KKCFCHNFITKFSDGYETVIGP---KGALLSGGQKQRIAIARALIKKPNILILDEATSAL 643
            +     + +     G E +  P    G+ LS GQ+Q + +ARAL+    IL+LDEAT+A+
Sbjct: 1369 ELSHLKDHVKGL--GKEELDAPLTEGGSNLSVGQRQLMCLARALLIPSKILVLDEATAAV 1426

Query: 644  DVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYAS 703
            DVE++  I  T+    K+R  TI++IAHR++TI  S+ ++VL D G V E      L  +
Sbjct: 1427 DVETDQVIQETIRTAFKNR--TILTIAHRINTILDSDRILVL-DSGKVAEFDTPDNLLKN 1483

Query: 704  KESKLYKLLNE 714
             ES  Y L  E
Sbjct: 1484 PESLFYSLCYE 1494

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 97/425 (22%), Positives = 185/425 (43%), Gaps = 60/425 (14%)

Query: 334 TKVAEEQLSGVKTVQSFVAEQKEIKRYNHAI-RKVFDVGKREALTNAT---------FFS 383
           T++  E L+ +K+++ +  E+   K+ ++    K     +R  +TNA          F  
Sbjct: 474 TRLISEILNNIKSLKLYAWEEPYRKKLDYVRNEKELKNLRRMGITNACASFQFNVIPFLV 533

Query: 384 STSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAG 443
           S S  G F +       + LV   +L++ +L AF L    +    F         ++ + 
Sbjct: 534 SCSTFGVFIWTQDAPLTTDLVFP-ALTLFNLLAFPLAVIPTAITAF---------VEASV 583

Query: 444 AASRLFE-LTDHQPSIYATKGVPYVPGKGEIKFE---NVSFSYPTRSANQI-FNNLNFTI 498
           + +RL   LT+ +    + +    V  KGE+      + +F +  +   ++   N+NF  
Sbjct: 584 SITRLQSFLTNEELQRDSVQRKSKVTKKGEVAVNVGADATFLWQRKPEYKVALKNINFAA 643

Query: 499 DSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEP 558
             G   CVVG  G GKS +   +L       G  ++ G              +  V Q P
Sbjct: 644 KKGKLTCVVGKVGSGKSALIQAILGDLFRVKGFASVHGS-------------IAYVSQVP 690

Query: 559 ILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQK 618
            +M+G+++DNI +G  Y  +   +    K C     +     G +T++G KG  LSGGQK
Sbjct: 691 WIMNGTVKDNILFGHKYDESFYTM--TLKACALIVDLAVLPKGDQTLVGEKGISLSGGQK 748

Query: 619 QRIAIARALIKKPNILILDEATSALDVE-SEGAINYTLG---------QLMKSRDITIIS 668
            R+++ARA+  + +  +LD+  +A+D   ++  + + LG         +++ +  IT++S
Sbjct: 749 ARLSLARAVYARADTYLLDDPLAAVDEHVTKHLVEHVLGPNGLLASKTKVLATNKITVLS 808

Query: 669 IAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKDTTSKMNAETV 728
           IA            I L ++G +++ G + ++ ++K S L K+++   K        E  
Sbjct: 809 IADH----------IALLENGEIIQQGSYDDVTSAKSSALSKIISTFGKKPEKSKTGENT 858

Query: 729 EKNDP 733
               P
Sbjct: 859 VATTP 863

>Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (REAL)
          Length = 1580

 Score =  132 bits (331), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 136/540 (25%), Positives = 245/540 (45%), Gaps = 68/540 (12%)

Query: 197  FLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKVGDLIS 256
            FL  +A   ++S+F   G+V +  + G     ++ S ++         F D   VG +++
Sbjct: 1028 FLLFYAIIGLISSFLTAGKVWVAMLSGTNATKKIFSKLLSSIFEAKLRFHDITPVGRIMN 1087

Query: 257  RLSSDAYVVSRSMTQNISDGF-KAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIY 315
            R S D  ++ + +  N    F   ++C  + I + +                  VGA +Y
Sbjct: 1088 RFSKDMDIIDQQLIPNFEGLFYSVVVCLWIVILIGYVTPRFLIFAIPLCGLYYFVGA-LY 1146

Query: 316  GRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREA 375
             R  R + R    +   + ++  E + GV T+++   E++ I     AI           
Sbjct: 1147 LRASRELKRIDNINVSPIHQLFTEAIKGVVTIRALADERRFITHTLEAIDG--------- 1197

Query: 376  LTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSI--------GDLTAFMLYTEYSGSA 427
             +NA FF   SV  ++    V   G+ ++   SL I          L   +L   +S + 
Sbjct: 1198 -SNAPFFY-LSVATEWITYRVDIIGALVLFSSSLMIIARAPYLDAGLAGILLSNAFSFTE 1255

Query: 428  -------VF-GLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKFENVS 479
                   VF G+    S + +         E +    S  AT  V + P  GEI+F+N+S
Sbjct: 1256 TAQWIIKVFSGVELLMSSVERIKEYIEVPLEFSKSNDS--ATSPVDW-PQTGEIEFKNLS 1312

Query: 480  FSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDI 539
              Y   S+  + +N++F + +G+ V +VG +G GKS+I + + +  +  SG I ID +DI
Sbjct: 1313 LRYSPHSSKAL-DNVSFKVRTGTKVGIVGRTGAGKSSIIAAIYRLSDWESGTIIIDNKDI 1371

Query: 540  SKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDE--IRSVSK-------KCF 590
              +S + LR  +  + Q P L  G+IR N+    PY    D+    +++K       +  
Sbjct: 1372 KCVSLECLRNSISCIPQNPTLFDGTIRSNLD---PYNQYSDKQVFDALAKVGLIERNEVL 1428

Query: 591  CHNFIT-----------KFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEA 639
            C   +T           KFSD   +V+   G+ LS GQ+Q + +AR+++    I+++DEA
Sbjct: 1429 C--LVTDRQQSSSFSPNKFSD-LNSVVRSGGSNLSQGQRQLLCLARSMLGSRKIMLIDEA 1485

Query: 640  TSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKE 699
            T+++D  S+  I  T+ + M+  + TI++IAHRL ++     ++V+       +MG+ KE
Sbjct: 1486 TASIDYISDAKIQKTIRETME--NTTILTIAHRLRSVIDYNKILVM-------DMGRVKE 1536

 Score = 78.2 bits (191), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 83/283 (29%), Positives = 134/283 (47%), Gaps = 14/283 (4%)

Query: 469 GKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPT 528
            K ++ F++ +  +     +    N++      S   ++GP+G GKS++   LL   N  
Sbjct: 660 SKSKVGFKDANMEWDADETSFKLKNISIEFKLNSLNAIIGPTGSGKSSLLLGLLGELNLC 719

Query: 529 SGRI---TIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSV 585
           SG+I   ++D +D  ++    +   +    Q P L+SG+I DNI +G    P      +V
Sbjct: 720 SGQIYVPSVDSRDDLEVGIDGMTNSMAYCSQSPWLISGTIEDNIVFG--ERPNQRRFNAV 777

Query: 586 SKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDV 645
            K C     +   S G +T +G  G  LSGGQ+QR+A+ARA+      L+LD+  SA+D 
Sbjct: 778 IKACCLEKDVKAMSAGLKTSVGGGGFSLSGGQQQRVALARAIYSSSRFLLLDDCLSAVDP 837

Query: 646 ESEGAI--NYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYAS 703
           E+   I      G +MK R  T I  +H +S I +    +V+ D+G V   GK  +L  S
Sbjct: 838 ETALNIYEKCLCGPIMKGR--TCIITSHNISLITKKAEWLVILDNGEVKGQGKPSDLAES 895

Query: 704 ----KESKLYKLLNEKAKDTTSK-MNAETVEKNDPSPKTEKLN 741
               KES    L +E       K   A T+   D +   E+++
Sbjct: 896 NNFLKESMNNGLADESGNQAKPKSKTAATLHDTDNADVQEEIS 938

>TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_5.10
            YGR281W
          Length = 1477

 Score =  132 bits (331), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 141/560 (25%), Positives = 239/560 (42%), Gaps = 72/560 (12%)

Query: 192  LGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKV 251
            +GLY F    A   + S F       +L  +G      L    +K+ IH    F D   +
Sbjct: 936  MGLYSFFVFGAYIFMTSQFT------ILCYIGIGASKNLNIQALKRIIHTPMSFMDTTPI 989

Query: 252  GDLISRLSSDAYVVSRSMTQNIS---DGFKAIICGGVGIGMM-------FHISSXXXXXX 301
            G +++R + D   +   + +N+      F  I    VG+ +M       F I+       
Sbjct: 990  GRILNRFTKDTDSLDNELIENVRLTVSQFANI----VGVCVMCIVYLPWFAIAVPFLVFI 1045

Query: 302  XXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYN 361
                      A    +++ +I R    +  N      E L G+ T++ + +E++ I + +
Sbjct: 1046 FVFIQNHYQSAGREIKRLEAIQRSFVYNNFN------EILGGMDTIKFYKSEERYIAKSD 1099

Query: 362  HAIRKVFDVGKREALTNATFFSSTSVLGD-----FSFLIVLAYGSHLVLQGSLSIGDLTA 416
            + I K+ + G              ++L D     F+ +I L   +      + S+G L  
Sbjct: 1100 YLIDKMNEAGYLTVCVQ----RWVAILVDMIAVAFALIITLLCVTRQFHISASSVGVLLT 1155

Query: 417  FMLYTEYSG------SAVFGLSNFYSELMKGAGAASRL-FELTDHQPSIYATKGVPYVPG 469
            ++L  +  G       AV  + N  +   +    A+ L  E   H+P    T      P 
Sbjct: 1156 YVL--QLPGLFNTLLRAVSQVENDMNSTERLVSYATDLPLEAQYHKPE---TAPPESWPE 1210

Query: 470  KGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTS 529
            +G IKFENV F+Y       +  N+N  I+    + + G +G GKSTI + L +    TS
Sbjct: 1211 EGTIKFENVDFAYRP-GLPIVLKNINLQINGTEKIGICGRTGAGKSTIMTALYRLNELTS 1269

Query: 530  GRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDE------IR 583
            G I ID  DI+K+    LR+ L ++ Q+P+L  G IR N+    P+    DE      +R
Sbjct: 1270 GSILIDDVDINKLGLHELRKKLAIIPQDPVLFRGDIRKNLD---PFHERTDEELWDVLVR 1326

Query: 584  --SVSKKCFCHNFITKFS-DG---------YETVIGPKGALLSGGQKQRIAIARALIKKP 631
              +++ +          + DG          + V+   GA  S G++Q +A+ RAL++  
Sbjct: 1327 GGAIAPEDLAETKAQHITEDGTSADLHKFHLDKVVEEDGANFSLGERQILALTRALVRNT 1386

Query: 632  NILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSV 691
             ILILDEATS++D E++  I   +         TI+ IAHRL TI   + ++VL + G V
Sbjct: 1387 KILILDEATSSVDYETDRKIQERIATAFSH--CTILCIAHRLKTILNYDRILVL-EHGEV 1443

Query: 692  VEMGKFKELYASKESKLYKL 711
             E      L+  + +  + +
Sbjct: 1444 AEFDTPMNLFKDETTIFHNM 1463

 Score =  107 bits (266), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 75/225 (33%), Positives = 122/225 (54%), Gaps = 22/225 (9%)

Query: 491 FNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRH 550
           F NLNF I  G  V + GP G GK+++ +    +   TSG I I+G D+           
Sbjct: 612 FTNLNFEIKKGEFVMITGPIGTGKTSLLNSFAGFMEKTSGTIQING-DL----------- 659

Query: 551 LGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKG 610
             ++   P + + ++RDNI +G PY    D+ + V + C   + +     G +T IG +G
Sbjct: 660 --LMGGYPWIQNATVRDNIIFGSPYEE--DKYKEVLRACSLESDLDILPAGDKTEIGERG 715

Query: 611 ALLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTLGQLMKSRDITIISI 669
             LSGGQK RI +AR + K+ +I +LD+  SA+D    +  ++  L +L+ ++  T +  
Sbjct: 716 ITLSGGQKARINLARCVYKEKDIYLLDDVLSAVDSRVGKHIMDECLTKLIGNK--TRLLA 773

Query: 670 AHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNE 714
            H+LS I ++  +IVLG+DGS VE+G  +  Y  + +K  K+L E
Sbjct: 774 THQLSLIDKASRIIVLGNDGS-VEIGDVQ--YMKETNKTLKVLLE 815

>KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1653

 Score =  131 bits (329), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 130/517 (25%), Positives = 225/517 (43%), Gaps = 61/517 (11%)

Query: 234  VIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHI 293
            ++ K +H    FFD   +G +++R S D   + + +       F + I     I ++  I
Sbjct: 1134 LLDKVLHAKLRFFDSTPIGRIMNRFSKDMEGIDQDLAPYFQGAFYSFIECITTIILITFI 1193

Query: 294  SSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAE 353
            +               +    Y    R + R    +   + +   E L GV T+++F  E
Sbjct: 1194 TPQFLSVAIIVGMLYYMIGYFYLTGSRELKRLDSITKSPIYQHFSETLVGVTTIRAFGDE 1253

Query: 354  QKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLI-----VLAYGSHLVLQGS 408
             + ++     I +           N  FF         SF I     ++ +GS + +  +
Sbjct: 1254 SRFLRENLLKIDE----------NNRPFFYLWVANRWLSFRIDVIGALVVFGSGIFILTN 1303

Query: 409  LSIGD-------LTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIY-- 459
            ++  D       LT  + +TE        L  FYSE+     +  R+ E    +   Y  
Sbjct: 1304 INTIDSGMAGISLTYAISFTE----GALWLVRFYSEVEMNMNSVERVHEYMTIEQEPYDE 1359

Query: 460  ---ATKGVPY-VPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKS 515
               +   VP   P +G I+  ++S  Y      ++  N+ F +D  + V VVG +G GKS
Sbjct: 1360 VQVSDSKVPADWPEEGRIEVSDLSLRYAAHLP-KVIKNVTFNVDPRAKVGVVGRTGAGKS 1418

Query: 516  TIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPY 575
            TI + L ++    +G I IDG DI+ ++   LRR + ++ Q+P L SG+I+ N+    PY
Sbjct: 1419 TIITALFRFLEAETGYIKIDGLDITSVNLTRLRRSITIIPQDPTLFSGTIKSNLD---PY 1475

Query: 576  TPTIDE-----IRSVS----------------KKCFCHNFITKFSDGYETVIGPKGALLS 614
                DE     +R V+                +       I +F D  E+ I   G   S
Sbjct: 1476 DEYKDEEVFEALRRVNLVTEEELSSRTENNNDEASVSSKNINRFLD-LESEIAEGGTNFS 1534

Query: 615  GGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLS 674
             GQ+Q I +AR+L++ P IL+LDEAT+++D +S+  +  T+    +  + TI++IAHRL 
Sbjct: 1535 QGQRQLICLARSLLRSPKILLLDEATASIDYDSDAKVQETIRT--EFSESTILTIAHRLR 1592

Query: 675  TIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKL 711
            ++   + ++V+G  G V E      L  +K S  Y +
Sbjct: 1593 SVIDYDKILVMG-AGEVKEYDHPYSLLLNKNSIFYSM 1628

 Score = 99.4 bits (246), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 112/232 (48%), Gaps = 9/232 (3%)

Query: 469 GKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPT 528
            K +I F+N + ++     +    NLN     G    ++GP+G GK+++   LL   N  
Sbjct: 697 NKNQIAFKNTTVAWDNSRDSFKLRNLNIDFKVGKLNVIIGPTGSGKTSLLMALLGEMNLL 756

Query: 529 SGRITIDGQDISK---ISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSV 585
            G+I +   +      + +      +    Q   L++ ++R+NI +  PY  T     +V
Sbjct: 757 EGQIVVPALNARHDLIVESDGTTNSIAYCSQAAWLLNDTVRNNILFNSPYNET--RYHNV 814

Query: 586 SKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDV 645
            + C           G  T IG KG  LSGGQKQRI++ARAL      ++LD+  SA+D 
Sbjct: 815 VEACGLRRDFEILKAGDMTEIGEKGIALSGGQKQRISLARALYSNSRHVLLDDCLSAVDA 874

Query: 646 ESEGAI--NYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMG 695
            +   +  N   G LM+ R  T I ++H ++   R+ +++V+ +DG V + G
Sbjct: 875 HTALWVYDNCITGPLMEGR--TCILVSHNIALTLRNADLVVMLEDGQVKDQG 924

>Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 992

 Score =  130 bits (327), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 162/635 (25%), Positives = 269/635 (42%), Gaps = 92/635 (14%)

Query: 128 FRLF----RLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAITSDEKPKDLR 183
           FR++    + A   W+ +++   LLTI   +G A  ++   V         S       +
Sbjct: 393 FRVYSEYLKAAAGKWRFVVIPCYLLTI---MGSAFCQLFASVW-------LSFWTENKFK 442

Query: 184 DLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDA 243
           +  P  + +GLY F  VF   +    F N    VL   LG      L    +K  +H   
Sbjct: 443 NRSPSFY-MGLYSFF-VFGQYM----FMNIQFTVLC-FLGVTASKFLNLKAVKGILHTPL 495

Query: 244 EFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXX 303
            F D   +G +++R + D   +   +T++I               MMF + +        
Sbjct: 496 SFMDTTPLGRILNRFTKDTDSMDNELTEDIR-------------LMMFQLGNIIGVIVMC 542

Query: 304 XXXXXXVGATIYGRKIRSIS-RDLQQSTGNLTKVAE------------EQLSGVKTVQSF 350
                     +    I  +   D  QS+G   K  E            E L G+ T++++
Sbjct: 543 IVYLPWFAIAVPFLLIMFVMIADHYQSSGREVKRLEAVQRSFVYNNLNEVLGGLDTIRAY 602

Query: 351 VAEQKEIKRYNHAIRKVFDVGKREALTN---ATFFSSTSVLGDFSFLIVLAYGSHLVLQG 407
            ++ + + + +  I K+ + G   A      A F    +V+  F+ +I L   +      
Sbjct: 603 RSQDRFLVKSDFLINKMNEAGYMVAALQRWVAIFLDMLAVI--FALIITLLCVTRQFKIS 660

Query: 408 SLSIGDLTAFMLYTEYSGSAVFGLSNF----YSELMKGAGAASRL--FELTDHQPSIYAT 461
             S G L  ++L        + GL N      ++   G  +A RL  + L   Q + Y  
Sbjct: 661 PSSTGVLLTYVL-------QLPGLLNTVLRALTQAENGMNSAERLVTYALDLPQEAEYRR 713

Query: 462 KGV---PYVPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIA 518
             +      P +GEIKFE VSF+Y   S   +  N +  I SG  + + G +G GKSTI 
Sbjct: 714 PEMSPPENWPDRGEIKFEGVSFAYRP-SLPPVLKNFSLNIGSGEKIGICGRTGAGKSTIM 772

Query: 519 SLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDN---------- 568
           S L +      G+I ID  +I+ +    LR  L ++ Q+P+L  G+I+ N          
Sbjct: 773 SALYRINEVIDGKIFIDNINIADLGLFELRSKLAIIPQDPVLFRGTIKKNLDPFGEKTDQ 832

Query: 569 -----ITYGVPYTPT-IDEIRSVSKKCF-CHNFITKFSDGYETVIGPKGALLSGGQKQRI 621
                +  G    P  I+E ++        H+ + KF    E  +  +G   S G+KQ +
Sbjct: 833 ELWESLVRGGAIAPEDIEETKAQQPDASGSHSKMHKFH--LEQKVEEEGGNFSLGEKQLL 890

Query: 622 AIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSEN 681
           A+ RAL++   ILILDEATS++D E++  I   + +     D TI+ IAHRL+TI   + 
Sbjct: 891 ALTRALVRNSRILILDEATSSVDYETDDKIQSRIVEAFG--DCTILCIAHRLNTILNYDR 948

Query: 682 VIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKA 716
           ++VL + G V E      L+ +KE  ++K + E+A
Sbjct: 949 ILVL-EQGEVAEFDTPWNLF-TKEDGIFKSMCERA 981

 Score =  106 bits (265), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 83/269 (30%), Positives = 133/269 (49%), Gaps = 24/269 (8%)

Query: 476 ENVSFSYPT---RSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           EN S   P    +++ + F NLNF I  G  + V GP G GK+++ S +  +   + G +
Sbjct: 88  ENSSSDEPVALEKTSFKGFQNLNFDIKKGEFIIVTGPIGTGKTSLLSAMAGFMARSGGSV 147

Query: 533 TIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCH 592
            ++G+ +S           G     P + + ++RDNI +G PY     + R V K C   
Sbjct: 148 EVNGRLLS----------CGY----PWIQNATVRDNIIFGSPYEKA--KYRKVIKACSLD 191

Query: 593 NFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAI 651
           + +     G  T IG +G  LSGGQK RI +AR + K  +I + D+  SA+D    +  +
Sbjct: 192 SDLEILPAGDMTEIGERGINLSGGQKARINLARCVYKDKDIYLFDDVLSAVDARVGKHIM 251

Query: 652 NYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKL 711
           +  L  L+  +  T I   H+L+ I ++  +IVLG+DGS   +G ++EL  S  S+L KL
Sbjct: 252 DECLLGLLGQK--TRILATHQLALIEKATRLIVLGNDGSFT-IGTYEELQKSN-SQLKKL 307

Query: 712 LNEKAKDTTSKMNAETVEKNDPSPKTEKL 740
           L   +  +    N +   +ND     E L
Sbjct: 308 LQFTSDKSEEDDNDQKQNENDKEVHAEDL 336

>TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1465

 Score =  130 bits (326), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 143/557 (25%), Positives = 249/557 (44%), Gaps = 78/557 (14%)

Query: 192  LGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKV 251
            +GLY F  VF G L ++     G+  L+  +G      L    +++ +H    + D   +
Sbjct: 926  MGLYSFF-VFGGYLFMN-----GQYTLICYMGVTASKVLNLKAVERVLHTPMAYMDTTPI 979

Query: 252  GDLISRLSSDAYVVSRSMTQNIS---DGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXX 308
            G +++R + D   +   +T+++      F  II  GV +  + ++               
Sbjct: 980  GRILNRFTKDTDSLDNELTESLRLFMTQFANII--GVCVMCIIYLPWFAIAIPFLVLIFV 1037

Query: 309  XVGATIY---GRKIRSISRDLQQS--TGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHA 363
             + A  Y   GR+++ +   +Q+S    NL +V    L G+ T++++ ++++ + + +  
Sbjct: 1038 LI-ADHYQASGREVKRLDA-IQRSFVYNNLNEV----LGGMDTIKAYGSQERFLVKTDFL 1091

Query: 364  IRKVFDVGKREALTN---ATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLY 420
            I K+ + G          A F    +V   F+ +I L   +        S+G L  ++L 
Sbjct: 1092 INKMNEAGYLLVALQRWVAIFLDMIAVA--FALIISLLCVTRQFHISPASVGVLLTYVL- 1148

Query: 421  TEYSGSAVFGLSNF----YSELMKGAGAASRLFELTDHQPSIYATKGVPYV------PGK 470
                   + GL N      ++      +A RL    +  P + A    P +      P K
Sbjct: 1149 ------QLPGLLNTILRALTQTENDMNSAERLVYCANELP-LEADYKRPELAPPESWPSK 1201

Query: 471  GEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSG 530
            GEI FE+VSF+Y       +   ++  I S   + + G +G GKSTI S L +    + G
Sbjct: 1202 GEIVFEDVSFAYRP-GLPVVLKGISLDIKSQEKIGICGRTGAGKSTIMSALYRLNELSDG 1260

Query: 531  RITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCF 590
            +I ID  DI +I    LR+ L ++ Q+P+L  G+IR N+    P+    DE+  + K   
Sbjct: 1261 KIFIDSVDIGQIGLYDLRKKLSIIPQDPVLFRGTIRKNLD---PFQEHPDEL--LWKSLV 1315

Query: 591  CHNFITKFSDGYETVIGPK----------------------GALLSGGQKQRIAIARALI 628
                I+  ++  E V G K                      GA  S G++Q +A+ RAL+
Sbjct: 1316 SGGAIS--AEEVEVVKGQKPDSIGSLSSMHKFHLDQKVEEEGANFSLGERQLLALTRALV 1373

Query: 629  KKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDD 688
            ++  ILILDEATS++D E++  I   +       D TI+ IAHRL TI   + ++VL + 
Sbjct: 1374 RQSKILILDEATSSVDYETDNKIQSRIAAAFG--DCTILCIAHRLKTILTYDRILVL-EQ 1430

Query: 689  GSVVEMGKFKELYASKE 705
            G + E    + LY  K+
Sbjct: 1431 GEIEEFDTPRSLYEKKD 1447

 Score =  107 bits (266), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 84/243 (34%), Positives = 125/243 (51%), Gaps = 24/243 (9%)

Query: 491 FNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRH 550
           F NLN  I  G  V + GP G GKS++ S +  +   TSG + +DG D+           
Sbjct: 596 FKNLNIDIKKGDFVMITGPIGTGKSSLLSAMAGFMRKTSGTVEVDG-DL----------- 643

Query: 551 LGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKG 610
             ++   P + + ++RDNI +G PY    +    V + C     I     G  T IG +G
Sbjct: 644 --LMCGYPWIQNATVRDNIIFGSPYDK--ERFDEVVRVCSLKADIDILPGGELTEIGERG 699

Query: 611 ALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI--NYTLGQLMKSRDITIIS 668
             LSGGQK RI +AR++ K  +I + D+  SA+D      I     LG+L   +  T I 
Sbjct: 700 ITLSGGQKARINLARSVYKDKDIFLFDDVLSAVDSRVGKHIMDECLLGRL---KGKTRIL 756

Query: 669 IAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKDTTSKMNAETV 728
             H+LS I ++  VIVLG DGS  E GK ++L  S ++ L  LL+  ++ ++SK  A+T 
Sbjct: 757 ATHQLSLIEKASVVIVLGVDGS-FEAGKLEDLKRSNKT-LINLLHFSSQKSSSK-EADTS 813

Query: 729 EKN 731
           EK+
Sbjct: 814 EKD 816

>KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} similar
            to uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1454

 Score =  128 bits (322), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 136/554 (24%), Positives = 236/554 (42%), Gaps = 70/554 (12%)

Query: 192  LGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKV 251
            +GLY    + + A + + F + G      +LG      L    +++ +H    F D   +
Sbjct: 912  MGLYILFVLGSLAFMFTQFISIG------LLGTYASKHLNIKALQRLLHAPMSFMDVTPI 965

Query: 252  GDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVG 311
            G +++R + D   +   +T+++               ++F I++                
Sbjct: 966  GRVMNRFTKDTDTLDNEITESVR-------------LLIFQIANLTGIIILCIIYIPWFA 1012

Query: 312  -ATIYGRKIRSISRDLQQSTGNLTKVAE------------EQLSGVKTVQSFVAEQKEIK 358
             A  +   +     D  Q++G   K  +            E L G+ T++++ +EQ+ + 
Sbjct: 1013 IAMPFLVFLYVFVADHYQASGREIKRMDAVQRSFVYNNFNEVLGGMDTIKAYRSEQRFLM 1072

Query: 359  RYNHAIRKVFDVGKREALTNATFFSSTSVLG-DFSFLIVLAYGSHLVLQGSLSIGDLTAF 417
            + +  I K+ + G            S  +L   F+ +I L   +    Q  +S G +   
Sbjct: 1073 KSDFLINKMNEAGYLVTSIQRWVAISLDMLAVIFALIIALLCVTR---QFHVSAGSVGVM 1129

Query: 418  MLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQP-----SIYATKGVPYVPGKGE 472
            + Y       +  L    ++      +A RL       P      I  T+     P +G 
Sbjct: 1130 VTYVLQLPGLLNALLRSQTQTENDLNSAERLVNYAYDLPIEAKYRILETQPPEQWPSEGR 1189

Query: 473  IKFENVSFSYPTRSANQIFNNLNFTIDSGSN--VCVVGPSGRGKSTIASLLLKYYNPTSG 530
            IKFENVS +Y       +    N +ID GSN  + + G +G GKSTI S L +     +G
Sbjct: 1190 IKFENVSLAYRPELPVAL---KNVSIDIGSNEKIGICGRTGAGKSTIMSALYRLVELKTG 1246

Query: 531  RITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDE--------- 581
            +ITID  DIS +    LR  L ++ Q+P+L  G IR N+    P+    DE         
Sbjct: 1247 KITIDDIDISTLGLYELRSKLAIIPQDPVLFKGDIRRNLD---PFQECTDEQLWDALVRG 1303

Query: 582  -------IRSVSKKCFCHNFIT--KFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPN 632
                   + S+  +    N ++   F    + ++   G+  S G++Q +A+ RAL++   
Sbjct: 1304 GAIDRKDVDSIRAQHKDANGLSGDMFKFHLDQMVEDDGSNFSLGERQLLALTRALVRGSK 1363

Query: 633  ILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVV 692
            ILILDEATS++D  ++  I   + +  +  + TI+ IAHRL TI     ++VL D G VV
Sbjct: 1364 ILILDEATSSVDYATDAKIQSRIVE--EFSNCTILCIAHRLKTILAYNRILVL-DQGQVV 1420

Query: 693  EMGKFKELYASKES 706
            E    K+LY  ++S
Sbjct: 1421 EFDTPKKLYNDRDS 1434

 Score = 87.4 bits (215), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 64/211 (30%), Positives = 107/211 (50%), Gaps = 20/211 (9%)

Query: 491 FNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRH 550
           F+ LNF +     + + GP G GKS++ + L  +   +SG +TI G D+           
Sbjct: 592 FHGLNFDVKENEFIIITGPIGTGKSSLLNALAGFMRRSSGSMTIKG-DL----------- 639

Query: 551 LGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKG 610
             ++   P + + +++DNI +G P+     + + V + C     +     G  T IG +G
Sbjct: 640 --LLCGYPWVQNATVKDNILFGSPFDKP--KYQKVIEICSLQADLDILPAGDRTEIGERG 695

Query: 611 ALLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTLGQLMKSRDITIISI 669
             LSGGQK RIA+AR++ K  +I + D+  SA+D    +  ++  +   +K +  T I  
Sbjct: 696 ITLSGGQKARIALARSVYKDMDIYLFDDVLSAVDSRVCKHIVDECMMGYLKQK--TRILA 753

Query: 670 AHRLSTIRRSENVIVLGDDGSVVEMGKFKEL 700
            H+LS I ++  VI LG DGS  ++G   EL
Sbjct: 754 THQLSLIDKASRVIFLGLDGS-FDIGTVPEL 783

>TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.52
            YLL015W
          Length = 1570

 Score =  129 bits (323), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 131/558 (23%), Positives = 235/558 (42%), Gaps = 52/558 (9%)

Query: 197  FLAVFAGALVLST-FANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKVGDLI 255
            F+ ++A   +LS  F N   V++L     +   +L   +    +     FF+   +G ++
Sbjct: 1023 FVTIYAIIGLLSAAFNNIRTVIMLLYCSIRGSKKLHDGMALSVMRSPMSFFETTPIGRIV 1082

Query: 256  SRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIY 315
            +R SSD   +   +    S  F++++   V + ++ +                      Y
Sbjct: 1083 NRFSSDLEAIDSGLQYIFSFFFRSVLIYVVSLILVGYNLPWFIALNAVLIMIYFYYQAYY 1142

Query: 316  GRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYN----HAIRKVFDVG 371
                R + R    S   +  +  E L G   + +F        R+N      ++   D  
Sbjct: 1143 IMLSRELKRLTTISYSPIMSLISETLGGFSVINAF----DHTSRFNFFNFETVQYNIDCV 1198

Query: 372  KREALTNATFFSSTSVLGDFSFLIVLAYG----SHLVLQGSLSIGDLTAFMLYTEYSGSA 427
             +   TN         +G+   LI+LA G    + L  +  LS G +   M Y+    S+
Sbjct: 1199 FQFRSTNRWLSVRLQTIGN---LIILATGLLSFATLGTKKQLSSGMVGLLMSYSLQVTSS 1255

Query: 428  VFGLSNFYSELMKGAGAASRLFELTDHQPS----IYATKGVPYVPGKGEIKFENVSFSYP 483
            +  +     ++     +  R  E  + +P     I  ++     P +G I+F N +  Y 
Sbjct: 1256 LMWIVRMTVQIETRIVSVERTLEYCELKPEALEIIENSRPPEGWPREGAIEFNNYTTKY- 1314

Query: 484  TRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKIS 543
              + + +  ++N +I     + +VG +G GKST+   L +    T G I+IDG DISKI 
Sbjct: 1315 RENLDPVLKDINVSIKPKEKIGIVGRTGAGKSTLTLALFRLIEATGGSISIDGIDISKIG 1374

Query: 544  AKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDE--IRSVSKKCFCHNFITKFSDG 601
             + LR +L ++ Q+     G+IR N+    P+    DE   R+V       + +    + 
Sbjct: 1375 LEDLRSNLAIIPQDAQAFEGTIRSNLD---PFDQHSDEELWRAVELSHLKQHILRMNEEA 1431

Query: 602  YE-----------------------TVIGPKGALLSGGQKQRIAIARALIKKPNILILDE 638
             +                       T I   G+ +S GQ+Q + ++RAL+    +LILDE
Sbjct: 1432 NDRESDSSRTDITTPDSHNIKELLATPISKNGSNVSVGQRQLLCLSRALLNPSKVLILDE 1491

Query: 639  ATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFK 698
            AT+A+D+E++  +  T+    K R  TI++IAHR+ T+   + ++VL D G V E     
Sbjct: 1492 ATAAIDMETDKIVQDTIKNEFKER--TILTIAHRIDTVMNYDKILVL-DKGEVAEFDTVS 1548

Query: 699  ELYASKESKLYKLLNEKA 716
             L + K +  YKL  + A
Sbjct: 1549 NLLSDKNTMFYKLCEQGA 1566

 Score = 90.9 bits (224), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 126/560 (22%), Positives = 247/560 (44%), Gaps = 50/560 (8%)

Query: 199 AVFAGALVLSTFAN--FGRVVLLRILGEKLVAR--LRSNVIKKTIHQDAEFFDRNKVGDL 254
           A+   AL LS F +   G    ++I    L  R  L + V KK++   ++   ++  GD+
Sbjct: 331 AIIVVALFLSKFISTLLGNQFYIKIFEVGLGIRGSLMALVYKKSLRISSDARQKHSSGDI 390

Query: 255 ISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATI 314
           I+ +S+D   + R    + S     I    V I +   +                + A +
Sbjct: 391 INLMSTDVLNLQRFFENSQSIIGAPIQIVIVLISLYLLLDKAVFAGMISMVIMIPINAYL 450

Query: 315 YGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDV---G 371
             RK+ S+ +   +   +   +  E L+ +K+++ +  E+  +K+  H +R   ++    
Sbjct: 451 -SRKVGSLYKTQMKYKDSRLTILTEILNSIKSIKLYSWEKPMLKKLLH-VRNDLELENFK 508

Query: 372 KREALTNATFFSSTSV--LGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVF 429
           K    +N  FF+   V  +   S  ++ +  S + L   +    LT F +  +    A++
Sbjct: 509 KIGIFSNLIFFAWNCVPLMVTCSTFLIFSMISDVPLSPDIIFPSLTLFNILND----AIY 564

Query: 430 GLSNFYSELMKGAGAASRL--FELTDH-QPSIYATKGVPYVPGKGEIKFENVSFSYPTR- 485
            + +  +++++   +  RL  F L +    S    K          I+  N +F + ++ 
Sbjct: 565 VVPSTINDVIQANISMKRLRDFLLAEELDDSFIEYKSPSETDDAPVIEINNATFLWQSKK 624

Query: 486 ----------------SANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTS 529
                           S   + N  NFT+  GS  C+VG  G GKSTI   +L      S
Sbjct: 625 IINENSSTDEESNIETSKAALKNIDNFTVKKGSLTCIVGKVGSGKSTILHAILGQLPCIS 684

Query: 530 GRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKC 589
               +D     K++ ++    +    QE  +M+ S+++NI +G  +      +  V + C
Sbjct: 685 A---LDQTRAPKVTIRA--TSIAYCPQEAWIMNSSVKENIVFGHKHDENYYNL--VIQAC 737

Query: 590 FCHNFITKFSDGYETVIGPKGALLSGG-QKQRIAIARALIKKPNILILDEATSALDVE-S 647
              + ++   DG ET++G KG  L GG QK RI++ARA+  + ++ +LD+  SA+D   S
Sbjct: 738 QLASDLSILPDGDETIVGEKGISLVGGVQKARISLARAVYARADVYLLDDILSAVDAHVS 797

Query: 648 EGAINYTLGQ---LMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASK 704
           +  I Y L +   L++++  TII   + ++ ++ S+ +  + + G +VE   ++ +  S 
Sbjct: 798 KNIIKYVLSKETGLLRNK--TIILSTNNVNVLKNSQKIYAI-EKGEIVEESDYENVMNSS 854

Query: 705 ESKLYKLLNEKAKDTTSKMN 724
           ++   K L E+   +TS  N
Sbjct: 855 DASRIKKLIEEFGTSTSNSN 874

>YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC type
            transmembrane transporter of MRP/CFTR family, found in
            vacuolar membrane, involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates, along with Ycf1p
          Length = 1559

 Score =  128 bits (321), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 146/552 (26%), Positives = 245/552 (44%), Gaps = 46/552 (8%)

Query: 189  VWG-LGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFD 247
            VW  +G+Y  + V + A     F N   +++L     +   +L  ++ K  I     FF+
Sbjct: 1017 VWMFVGVYSLIGVASAA-----FNNLRSIMMLLYCSIRGSKKLHESMAKSVIRSPMTFFE 1071

Query: 248  RNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXX 307
               VG +I+R SSD   V  ++    S  FK+I+   V + ++ +               
Sbjct: 1072 TTPVGRIINRFSSDMDAVDSNLQYIFSFFFKSILTYLVTVILVGYNMPWFLVFNMFLVVI 1131

Query: 308  XXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTV------QSFVAEQKEIKRYN 361
                 T Y    R + R +  S   +  +  E L+G   +      + F+    E  +YN
Sbjct: 1132 YIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYN 1191

Query: 362  HAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYT 421
                  F    R          +T VL       +LA  + +  +  LS G +   M Y+
Sbjct: 1192 VDFVFNFRSTNRWLSVRLQTIGATIVLAT----AILALAT-MNTKRQLSSGMVGLLMSYS 1246

Query: 422  -EYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYAT----KGVPYVPGKGEIKFE 476
             E +GS  + +    + +     +  R+ E  +  P   +     +     P KG I+F+
Sbjct: 1247 LEVTGSLTWIVRTTVT-IETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSKGGIEFK 1305

Query: 477  NVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDG 536
            N S  Y   + + + NN+N  I+    V +VG +G GKST++  L +   PT G+I IDG
Sbjct: 1306 NYSTKY-RENLDPVLNNINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIIIDG 1364

Query: 537  QDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFIT 596
             DIS I    LR HL ++ Q+     G+++ N+     Y+   DE++   ++      + 
Sbjct: 1365 IDISDIGLFDLRSHLAIIPQDAQAFEGTVKTNLDPFNRYSE--DELKRAVEQAHLKPHLE 1422

Query: 597  KF-----------------SDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEA 639
            K                  +D  +  I   G+ LS GQ+Q + +ARAL+ +  IL+LDEA
Sbjct: 1423 KMLHSKPRGDDSNEEDGNVNDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDEA 1482

Query: 640  TSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKE 699
            T+++D+E++  I  T+ +  K R  TI++IAHR+ T+  S+ +IVL D GSV E     +
Sbjct: 1483 TASVDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DQGSVREFDSPSK 1539

Query: 700  LYASKESKLYKL 711
            L + K S  Y L
Sbjct: 1540 LLSDKTSIFYSL 1551

 Score =  106 bits (264), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 121/479 (25%), Positives = 217/479 (45%), Gaps = 80/479 (16%)

Query: 278 KAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVA 337
           KA+I G V + +M  I++                     RK++ +S+   +      K  
Sbjct: 434 KAVIGGLVTMAIMMPINA------------------FLSRKVKKLSKTQMKYKDMRIKTI 475

Query: 338 EEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVG---KREALTNATFFS--------STS 386
            E L+ +K+++ +  E+  + R NH +R   ++    K   ++N  +F+        + S
Sbjct: 476 TELLNAIKSIKLYAWEEPMMARLNH-VRNDMELKNFRKIGIVSNLIYFAWNCVPLMVTCS 534

Query: 387 VLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAAS 446
             G FS        S   L  ++    L+ F +      SA++ + +  + +++ + +  
Sbjct: 535 TFGLFSLF------SDSPLSPAIVFPSLSLFNIL----NSAIYSVPSMINTIIETSVSME 584

Query: 447 RL--FELTDHQPSIYATKGVPYVPGKG--EIKFENVSFSYPTR---SANQIFNNL----- 494
           RL  F L+D     +  +  P    +    I+  N++F + ++   +++Q  +NL     
Sbjct: 585 RLKSFLLSDEIDDSFIERIDPSADERALPAIEMNNITFLWKSKEVLTSSQSGDNLRTDEE 644

Query: 495 --------------NFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSG-RITIDGQDI 539
                         +F    G  VCVVG  G GKST    +L      SG R +I  + I
Sbjct: 645 SIIGSSQIALKNIDHFEAKRGDLVCVVGRVGAGKSTFLKAILGQLPCMSGSRDSIPPKLI 704

Query: 540 SKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFS 599
            + S+      +    QE  +M+ S+R+NI +G  +    D      K C     +    
Sbjct: 705 IRSSS------VAYCSQESWIMNASVRENILFGHKFDQ--DYYDLTIKACQLLPDLKILP 756

Query: 600 DGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTL-GQ 657
           DG ET++G KG  LSGGQK R+++ARA+  + +I +LD+  SA+D E S+  I Y L G+
Sbjct: 757 DGDETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGK 816

Query: 658 LMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKE--SKLYKLLNE 714
               ++ TII   + +S ++ S+ +  L ++G +VE G ++++   K   SKL KLL E
Sbjct: 817 TALLKNKTIILTTNTVSILKHSQMIYAL-ENGEIVEQGNYEDVMNRKNNTSKLKKLLEE 874

>YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative
           transporter of the multidrug resistance-associated
           protein (MRP) subfamily; contains a stop codon in S288C;
           adjacent ORFs YKR103W and YKR104W are merged in
           different strain backgrounds
          Length = 306

 Score =  120 bits (301), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 79/276 (28%), Positives = 144/276 (52%), Gaps = 39/276 (14%)

Query: 468 PGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNP 527
           P  G+++ +N+S  Y   S+ +  +N++F + +G+ V +VG +G GKS+I + + +  + 
Sbjct: 28  PQTGDVELKNLSLRYSPHSS-KALDNVSFKVKAGTKVGIVGRTGAGKSSIIAAIYRLSDW 86

Query: 528 TSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNI----------TYGVPYTP 577
            +G ITID +DI  I  + LR  +  + Q+P L  G++R N+           YGV    
Sbjct: 87  ENGTITIDNKDIKHIPLERLRNSISCIPQDPTLFDGTVRSNLDPFDRYSDVQIYGV--LS 144

Query: 578 TIDEIRSVSKKCF----------CHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARAL 627
            +  I    + C            H    +F D   TV+   G+ LS GQ+Q + +AR++
Sbjct: 145 KVGLIEECDELCLIFEQEQPNFSSHKLRNRFID-LNTVVKSGGSNLSQGQRQLLCLARSM 203

Query: 628 IKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGD 687
           +   NI+++DEAT+++D  S+  I  T+ + MK  + TI++IAHRL ++   + ++V+  
Sbjct: 204 LGARNIMLIDEATASIDYISDAKIQKTIRETMK--NTTILTIAHRLRSVIDYDKILVM-- 259

Query: 688 DGSVVEMGKFKE------LYASKESKLYKLLNEKAK 717
                EMG+ KE      L + + +  Y+L  +  +
Sbjct: 260 -----EMGRVKEYDHPYTLISDRNTIFYRLCRQSGE 290

>Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa] {ON}
            YGR281W (YOR1) - ABC transporter [contig 363] FULL
          Length = 1471

 Score =  127 bits (320), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 131/542 (24%), Positives = 227/542 (41%), Gaps = 56/542 (10%)

Query: 192  LGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKV 251
            +GLY F   F      + FA   +  +L  +G      L    +K+ +H    F D   +
Sbjct: 929  MGLYTFFVFF------NYFATTSQFSVLCYMGLSAAKWLNLKAVKRLLHTPMSFLDTTPI 982

Query: 252  GDLISRLSSDAYVVSRSMTQNISDG-FKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXV 310
            G +++R + D   +   +T+++    F+A    GV I  + ++                V
Sbjct: 983  GRVLNRFTKDTDTLDTELTESVRLFLFQASNIVGVVIMCIIYLPWFAIAVPFLLLIFAAV 1042

Query: 311  GATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDV 370
             A  Y    R I R       ++     E LSG+ T++++  E + + + +  I K+ + 
Sbjct: 1043 -ADHYQSSSREIKRLEAVQRSHVFNNFNEVLSGMDTIRAYRGEARFLTKSDFLINKMNEA 1101

Query: 371  GKRE-ALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVF 429
            G    A+      +   +   F+ +I L   +    Q S+S   +   + Y       V 
Sbjct: 1102 GYVVVAIQRWVSIALDMIAMAFALIITLLCVTR---QFSISAASVGVLLTY-------VL 1151

Query: 430  GLSNFYSELMKGA-------GAASRLFELTDHQPSIYA-----TKGVPYVPGKGEIKFEN 477
             L    + LM+          +A RL       P   A     T      P +G I F++
Sbjct: 1152 QLPGLLNTLMRAMTQGENDMNSAERLISYATDLPLEAAYRRPETSPPESWPSEGAIDFDH 1211

Query: 478  VSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQ 537
            VS +Y       + ++++  +  G  + + G +G GKSTI S L +      G ITIDG 
Sbjct: 1212 VSLAYRP-GLPLVLHDVSLHVRGGEKIGICGRTGAGKSTIMSALYRMIELHDGSITIDGI 1270

Query: 538  DISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPY-----------------TPTID 580
            DI+++    LR  L ++ Q+P+L  G +R N+    P+                   T D
Sbjct: 1271 DIAQLGLYELRSKLAIIPQDPVLFKGDVRKNLD---PFHERSDNELWDALVRAGAIATED 1327

Query: 581  EIRSVSKKCFCHNFITKFSDGY-ETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEA 639
            E  + +        +T     + E  +   G+  S G++Q +A+ RAL++   ILILDEA
Sbjct: 1328 EAAARAVTRATAGALTNLHKFHLEQEVEEDGSNFSLGERQLLALTRALVRSSRILILDEA 1387

Query: 640  TSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKE 699
            TS++D E++  I   +       + T++ IAHRL+TI   + ++VL D G V E      
Sbjct: 1388 TSSVDYETDAKIQARIADAFS--ECTVLCIAHRLNTILDYDRILVL-DQGRVCEFDTPHA 1444

Query: 700  LY 701
            L+
Sbjct: 1445 LF 1446

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 79/254 (31%), Positives = 119/254 (46%), Gaps = 33/254 (12%)

Query: 491 FNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRH 550
           F NLN  I  G  V V G  G GKS++ + +  +    SG I  +G         SL   
Sbjct: 594 FKNLNIEIAKGELVIVTGSVGTGKSSLLAAMSGFMKKKSGDIYKNG---------SL--- 641

Query: 551 LGVVQQEPILMSGSIRDNITYGVPYTPTIDEIR--SVSKKCFCHNFITKFSDGYETVIGP 608
             ++   P + + +++DNI +G P+    DE R     + C     +     G +T IG 
Sbjct: 642 --LLCGYPWIQNTTVKDNILFGSPF----DEARYKETIRVCSLQADLDLLPAGDKTEIGE 695

Query: 609 KGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI--NYTLGQL-MKSRDIT 665
           +G  LSGGQK RI +AR++ KK +I + D+  SA+D      I     +G L  K+R   
Sbjct: 696 RGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDARVGKHIMDECMMGALDGKTR--- 752

Query: 666 IISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLL---NEKAKDTTSK 722
            +   H+LS I R+  VI +  DG+ V+ G   EL  S+ +   KL+   N  + D    
Sbjct: 753 -VLATHQLSLIARASKVIFIDLDGT-VDSGTLDEL-KSRHAGFVKLMEYSNHTSTDEEEG 809

Query: 723 MNAETV-EKNDPSP 735
            + E   E+N P P
Sbjct: 810 QDGEVEHEENRPGP 823

>KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8.303
            YDR135C
          Length = 1535

 Score =  127 bits (319), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 137/554 (24%), Positives = 237/554 (42%), Gaps = 70/554 (12%)

Query: 217  VLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAY----VVSRSMTQN 272
            V   I G K +  + +N + +       FF+   +G +++R S+D Y    ++ R+ +Q 
Sbjct: 1020 VFCTIHGSKYLHTVMTNAVFRA---PMSFFETTPIGRILNRFSNDIYKVDSLLGRTFSQF 1076

Query: 273  ISDG----FKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQ 328
            + +     F  I+        +F I                    +  R++ SI+R    
Sbjct: 1077 LVNAVKVVFTMIVICWTTWQFIFIIGPLGVLYIYYQQYYLRTSREL--RRLDSITRSPIY 1134

Query: 329  STGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVL 388
            S        +E L G+ T++ +  +Q+     NH          R     + F+ S +  
Sbjct: 1135 SH------FQETLGGMSTIRGY-NQQRRFDHINHC---------RIDNNMSAFYPSINAN 1178

Query: 389  GDFSFLIVLAYGSHLVL-----------QGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSE 437
               +F +  + GS ++L           QG+L+ G +   + Y       +  +     E
Sbjct: 1179 RWLAFRLE-SIGSVIILGAATLSIYRLGQGTLTAGMVGLSLSYALQITQTLNWIVRMTVE 1237

Query: 438  LMKGAGAASRL---FELTDHQPSIYATK-GVPYVPGKGEIKFENVSFSYPTRSANQIFNN 493
            +     +  R+    EL    P +   K    + P  G+I+F++ S  Y     + +  +
Sbjct: 1238 VETNIVSVERIKEYSELKSEAPLVIEEKRPAAHWPDSGDIRFDHYSTRYRP-ELDLVLRD 1296

Query: 494  LNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGV 553
            +N  I     + +VG +G GKS++   L +    +SG I IDG  I +I    LR +L +
Sbjct: 1297 VNLHIKPREKIGIVGRTGAGKSSLTLALFRIVEASSGGIVIDGVRIDEIGLHDLRHNLSI 1356

Query: 554  VQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGAL- 612
            + Q+  +  G+IR+N+     YT   DEI  V +    +  +          +GP+G L 
Sbjct: 1357 IPQDSQVFQGTIRENVDPTETYTD--DEIWRVLELSHLNRHVES--------MGPRGLLN 1406

Query: 613  --------LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDI 664
                    LS GQ+Q + +ARAL+    ILILDEAT+A+DVE++  I  T+      RD 
Sbjct: 1407 EVNEGGSNLSVGQRQLMCLARALLVPSKILILDEATAAVDVETDQVIQETIRSAF--RDR 1464

Query: 665  TIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKDTTSKMN 724
            TI++IAHR++TI  S+ ++VL D G V E      L  ++ S+ + L  E      ++  
Sbjct: 1465 TILTIAHRINTIMDSDRIVVL-DGGRVTEFDTPTNLLRNEGSQFHSLCQEAG--LLTRAQ 1521

Query: 725  AETVEKNDPSPKTE 738
                E  DP    E
Sbjct: 1522 EAGAEGRDPKANKE 1535

 Score =  106 bits (265), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 103/420 (24%), Positives = 189/420 (45%), Gaps = 54/420 (12%)

Query: 322 ISRDLQQSTGNL----TKVAEEQLSGVKTVQSFVAEQKEIKRYNHA-----IRKVFDVGK 372
           I + LQ+S        T V  E L+ +K+++ +  E+   K+  H      ++ +  +G 
Sbjct: 467 IQKRLQKSQMGFKDERTSVISEILNNIKSLKLYAWEEPYKKKLEHVRNDKELKNLTKLGC 526

Query: 373 REALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLS 432
             A+T+  F     ++   +F  V  Y     L   L    LT F L +      +F + 
Sbjct: 527 FMAITSFQFNVVPFLVSCCTF-AVFVYTEDRALTVDLVFPALTLFNLLS----FPLFVIP 581

Query: 433 NFYSELMKGAGAASRLFE-LTDHQPSIYATKGVPYVPGKGEIKF---ENVSFSYPTRSAN 488
           N  +  ++ + + +RLF  LT+ +    + + +P V   G++     ++ +F +  +   
Sbjct: 582 NVMTSFIEASVSVTRLFNFLTNEELQKDSVQRLPKVTNVGDVAVKVGDDATFLWRRKPEY 641

Query: 489 QI-FNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSL 547
           ++   N+NF    G   CVVG  G GKS +   L        G  T+ G           
Sbjct: 642 KVALKNINFEAKKGQLTCVVGRVGSGKSALIQSLSGDLFRVKGFATVHGS---------- 691

Query: 548 RRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIG 607
              +  V Q   +M+G++++NI +G  Y P   +     K C     +    DG ET++G
Sbjct: 692 ---VAYVSQVAWIMNGTVKENILFGHRYDPEFYD--KTIKACALTIDLAVLVDGDETLVG 746

Query: 608 PKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTLG---------Q 657
            KG  LSGGQK R+++ARA+  + +  +LD+  +A+D    +  + + LG         +
Sbjct: 747 EKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVGKHLLEHVLGPTGLLRTKTK 806

Query: 658 LMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAK 717
           ++ +  I+++SIA R          I L ++G +VE G + E+ A  +S L KL+ +  +
Sbjct: 807 ILATNKISVLSIADR----------IALLENGEIVEQGSYDEVTADGDSALSKLIRDYGR 856

>KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] {ON}
            similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281W YOR1 Plasma membrane transporter of the ATP-
            binding cassette (ABC) family mediates export of many
            different organic anions including oligomycin
          Length = 1486

 Score =  127 bits (319), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 130/541 (24%), Positives = 230/541 (42%), Gaps = 52/541 (9%)

Query: 192  LGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKV 251
            +G+Y F   F   +  S F+      L+  +G     RL    +++ +H    F D   +
Sbjct: 944  MGMYTFFVFFNYFVTTSQFS------LICYIGLSAAKRLNLKAVQRLLHTPMSFLDTTPI 997

Query: 252  GDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVG 311
            G +++R + D   V   +T+++   F   +   VG+ +M  I                VG
Sbjct: 998  GRVLNRFTKDTDTVDTELTESVR-LFVFQLSNIVGVIVMCIIYLPWFAIAVPFLMLVFVG 1056

Query: 312  -ATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDV 370
             A  Y    R I R       ++     E L G+ T++++  E++ + + +    K+ + 
Sbjct: 1057 VADHYQSSSREIKRLEAVQRSHVFNNFNEVLGGMDTIRAYRGERRFLTKSDFLTNKMNEA 1116

Query: 371  GKRE-ALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVF 429
            G    A+      +   +   F+ ++ L   +      + S+G L  ++L        + 
Sbjct: 1117 GYLVVAIQRWVAIALDMIAMAFALIVTLLCVTRQFHISAASVGVLLTYVL-------QLP 1169

Query: 430  GLSNFYSELM----KGAGAASRLFELTDHQPSIYATKGVPYV------PGKGEIKFENVS 479
            GL N     M        +  RL       P + A    P +      P  G I+F++VS
Sbjct: 1170 GLLNMLLRAMTQGENDMNSTERLISYATELP-LEAAYRRPEMSPPAEWPTDGRIEFDHVS 1228

Query: 480  FSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDI 539
             +Y       +  ++   + +G  + + G +G GKSTI S L +      G ITIDG DI
Sbjct: 1229 LAYRP-GLPLVLKDVTLHVAAGEKIGICGRTGAGKSTIMSALYRMCELHDGSITIDGVDI 1287

Query: 540  SKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDE------IRS--------V 585
            S +    LR  L ++ Q+P++  G +R N+    P+    D+      +R          
Sbjct: 1288 STLGLYDLRSKLSIIPQDPVMFKGDVRKNLD---PFHERTDDELWHALVRGGAIPAESLA 1344

Query: 586  SKKCFCHNFITKFSDGY----ETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATS 641
            + +   H      S+ +    +  +   G   S G++Q +A+ RAL+++  ILILDEATS
Sbjct: 1345 TVRAQTHENAGSLSNMHKFHLQQEVEEDGTNFSLGERQLLALTRALVRQSKILILDEATS 1404

Query: 642  ALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELY 701
            ++D E++  I   + +     + TI+ IAHRL+TI   + ++VL D G V E      LY
Sbjct: 1405 SVDYETDAKIQTRIVEAFS--NCTILCIAHRLNTILDYDRILVL-DQGRVCEFDTPAALY 1461

Query: 702  A 702
            A
Sbjct: 1462 A 1462

 Score = 90.9 bits (224), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 73/218 (33%), Positives = 104/218 (47%), Gaps = 26/218 (11%)

Query: 491 FNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRH 550
           F+NLN  I  G  V V G  G GKS++   L  +   T G I  DG  +           
Sbjct: 603 FDNLNIQITKGELVIVTGSVGTGKSSLLYALSGFMKKTGGDIYKDGTML----------- 651

Query: 551 LGVVQQEPILMSGSIRDNITYGVPYTPTIDEIR--SVSKKCFCHNFITKFSDGYETVIGP 608
              +   P + + ++RDNI +G PY    +E R   + + C     +     G  T IG 
Sbjct: 652 ---LCGYPWIQNATVRDNILFGSPY----NEARYNEIIRVCSLQADLELLPAGDRTEIGE 704

Query: 609 KGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI--NYTLGQLMKSRDITI 666
           +G  LSGGQK RI +ARA+ KK +I + D+  SA+D      I     +G+L  S   T 
Sbjct: 705 RGITLSGGQKARINLARAVYKKKDIYLFDDVLSAVDARVGKHIMDECLMGKLEGS---TR 761

Query: 667 ISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASK 704
           +   H+LS I R+  VI +  DGS V++G  +EL   K
Sbjct: 762 VLATHQLSLIARASKVIYIDLDGS-VDVGSVEELKKRK 798

>ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLL048C
            (YBT1) and YHL035C
          Length = 1627

 Score =  127 bits (318), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 119/504 (23%), Positives = 219/504 (43%), Gaps = 41/504 (8%)

Query: 234  VIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHI 293
            V+ K +H    FFD    G +++RLS D   V + +       F A++     + ++ ++
Sbjct: 1114 VLWKILHAKMRFFDATPTGRIMNRLSKDLEAVDQELIPYFEGSFAAVVQCISTLVLIAYV 1173

Query: 294  SSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAE 353
            +               +    Y    R + R    +   + +   E L G+ +++++  E
Sbjct: 1174 TPQFLIMAIFIGFLYALIGYFYVTTSRELKRFESITRSPIYQHFSETLVGITSIRAYGDE 1233

Query: 354  QK----EIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQ-GS 408
            ++     + R +   R  F +     + N        +LG    L+    G  + L  G 
Sbjct: 1234 RRFMLENLSRIDDNNRPFFYLW----IANRWLAFRVDLLGA---LVTFFSGLFIYLNIGK 1286

Query: 409  LSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKG-VP-- 465
            L  G     + Y  +           YS +     +  RL E  + +   Y     +P  
Sbjct: 1287 LDAGLAGISLTYAIFFTEGALWFVRHYSNVEMTMNSFERLKEYMEIEQEPYNENAQLPPD 1346

Query: 466  YVPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYY 525
              P  G I   ++S  Y   +  ++  N+NF+++    V +VG +G GKSTI + + ++ 
Sbjct: 1347 NWPQHGRIDVSDLSLRYAP-NLPKVIKNVNFSVEPKLKVGIVGRTGAGKSTIITAMFRFL 1405

Query: 526  NPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTID-EIRS 584
            +P +G + ID  DI+ I    LR+ + ++ Q+P L +G+++  +    PY+   D +I  
Sbjct: 1406 DPETGFVKIDNIDITTIPLHRLRQSITIIPQDPTLFTGTLKSILD---PYSQYSDKQIYE 1462

Query: 585  VSKKC-----------------FCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARAL 627
              ++                       I KF D     +   GA LS GQ+Q + +AR+L
Sbjct: 1463 ALQRVNLLSDTDINSLSSPSTQSSGENINKFLD-LNNEVTEGGANLSQGQRQLVCLARSL 1521

Query: 628  IKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGD 687
            ++ P I++LDEAT+++D  S+  I  T+ +  + RD TI++IAHRL +I   + V+V+ D
Sbjct: 1522 LRSPKIIMLDEATASIDYTSDEKIQQTIRE--EFRDSTILTIAHRLKSIIDYDKVLVM-D 1578

Query: 688  DGSVVEMGKFKELYASKESKLYKL 711
             G V E      L  +K +  Y +
Sbjct: 1579 AGEVKEYDHPYSLLLNKNTIFYNM 1602

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 101/391 (25%), Positives = 171/391 (43%), Gaps = 32/391 (8%)

Query: 326 LQQSTGNLTKVA-----------EEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKRE 374
           L Q  GNLT V             E L  ++ ++ F A +   ++   AIR   +     
Sbjct: 518 LAQKLGNLTVVTLGFTDKRIQKLNETLQSIRIIK-FFAWETNFEKEVQAIR---EDELAT 573

Query: 375 ALTNATFFSSTSVLGDFSFLIVLA--YGSHLVLQGS-LSIG-DLTAFMLYTEYSGSAVFG 430
            L  A  +S+ S L      IV++  +  ++ +QG  L+I    TA  L+     + +  
Sbjct: 574 LLKRAIVWSAISFLWFMVSTIVVSASFACYIYIQGEVLTIPVAFTALSLFVMLR-NPLDV 632

Query: 431 LSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKFENVSFSYPTRSANQI 490
           L++  S +++   +  R+    D   +   TK          + FEN + ++    ++  
Sbjct: 633 LADMLSYVVQSKVSLDRIQAFLDEDET---TKYEQLTISGNRLAFENATIAWNDDPSSFR 689

Query: 491 FNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI---TIDGQDISKISAKSL 547
             N++     G      GP+G GKS++   LL       G+I   ++D ++   I A  L
Sbjct: 690 LRNIDIEFMIGKLNVAFGPTGTGKSSLLLGLLGEMTLQEGKIYVPSLDPREDLVIQADGL 749

Query: 548 RRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIG 607
              +    Q   L++ + R NI +  PY         V + C         S G  T IG
Sbjct: 750 TNSIAYCSQSAWLLNDTARSNILFNSPYNE--QRYNDVLEACGLKKDFEILSGGDLTQIG 807

Query: 608 PKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI--NYTLGQLMKSRDIT 665
            KG  LSGGQKQRI++ARAL      L+LD+  SA+D  +   I  N  +G LM+ R  T
Sbjct: 808 EKGMTLSGGQKQRISLARALYSSARHLLLDDCLSAVDSHTALLIYENCIIGPLMEGR--T 865

Query: 666 IISIAHRLSTIRRSENVIVLGDDGSVVEMGK 696
            + ++H ++   R+ + +V+ ++G V   G+
Sbjct: 866 CVLVSHNVALTMRNADWVVILENGRVKAQGE 896

>Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]
            {OFF} complement(118923..123713) [4791 nt, 1597 aa]
          Length = 1596

 Score =  126 bits (316), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 138/555 (24%), Positives = 233/555 (41%), Gaps = 53/555 (9%)

Query: 193  GLYDFLAVFAGALVLST-FANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKV 251
             L+ F+ V+A   ++S  F N   +V+L     +   +L  N+    ++    FF+   +
Sbjct: 1040 NLWMFVGVYALIGIISAAFNNLRSIVMLIFCSIRGSKKLHDNMALSVVYSPMSFFETTPI 1099

Query: 252  GDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVG 311
            G +I+R S D   V   +    S  F++++   V + ++ +                   
Sbjct: 1100 GRIINRFSGDLDSVDSGLQFIFSHFFRSLLGYIVTVILVGYNMPWFFVFNIFLIVIYFYY 1159

Query: 312  ATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIR-KVFDV 370
               Y    R + R    +   +  +  E L+G   + +          YNHA R   F+ 
Sbjct: 1160 QAYYIVTSRELKRLTSITYSPIMSLISETLAGYLVINA----------YNHAKRFSYFNF 1209

Query: 371  GKREALTNATF-FSSTSV-----LGDFSFLIVLAYG----SHLVLQGSLSIGDLTAFMLY 420
               +   +  F F ST+      L     LIVLA G    S +     L+ G +   M Y
Sbjct: 1210 ESVQFNIDCLFNFRSTNRWLSVRLQAIGALIVLATGLLSLSTIGTSKQLTAGMVGLLMSY 1269

Query: 421  TEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYA----TKGVPYVPGKGEIKFE 476
            +    +++  +     ++     +  R+ E  +  P        TK     P  G IKF 
Sbjct: 1270 SLQVTNSLMWIVRMSVQIETNIVSVERILEYCELPPEPPHEIEETKPEKSWPAHGSIKFI 1329

Query: 477  NVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDG 536
            + S  Y  ++ + + N +N  I+    + +VG +G GKST+   L +    T G+I IDG
Sbjct: 1330 DYSTKY-RKNLDPVLNKINLEIEPREKIGIVGRTGAGKSTLTLALFRILEATDGKIVIDG 1388

Query: 537  QDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDE-----IRSVSKKCFC 591
             DIS +    LR +L ++ Q+     G+IR N+    P+    DE     I +   K   
Sbjct: 1389 VDISTLGLSDLRSNLAIIPQDAQAFEGTIRTNLD---PFDQHSDEELWKAIEASHLKPHL 1445

Query: 592  HNFITKFSDGYETV---------------IGPKGALLSGGQKQRIAIARALIKKPNILIL 636
               I+   D  E+                I   G+ LS GQ+Q + ++RAL+    IL+L
Sbjct: 1446 ERIISNRDDNSESEETNVSAKDNNLLEIKINENGSNLSVGQRQLLCLSRALLNHSKILVL 1505

Query: 637  DEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGK 696
            DEAT+++D+E++  I  T+      R  TI++IAHR+ T+   + ++VL D G V E   
Sbjct: 1506 DEATASVDMETDKIIQETIRNEFSDR--TILTIAHRIDTVLGYDKILVL-DKGEVREFDS 1562

Query: 697  FKELYASKESKLYKL 711
               L  +K S  Y L
Sbjct: 1563 PDTLLENKNSIFYNL 1577

 Score =  105 bits (261), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 111/454 (24%), Positives = 214/454 (47%), Gaps = 49/454 (10%)

Query: 316 GRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDV---GK 372
            +K++S++++  +      +   E L+ +K+++ +  E+  +KR +H +R   ++    K
Sbjct: 478 SKKVKSLNKEQMKYKDIRIRTLTEILNSIKSIKLYSWEKPMLKRLDH-VRNDLELESFKK 536

Query: 373 REALTNATFFSSTSV--LGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFG 430
              ++N  FF+   V  +   S  I+ A  S + L   +    L  F +  +    A++ 
Sbjct: 537 IGIVSNCIFFAWNCVPIMVTCSSFIIFALTSGMALTPDIVFPALALFNILND----AIYS 592

Query: 431 LSNFYSELMKGAGAASRL--FELTDHQPSIYATKGVPYVPGKG-EIKFENVSFSY----- 482
           + +  + +++ + +  RL  F  T+     +  +  P   G    ++ +N +F +     
Sbjct: 593 VPSTITNIIEVSVSLGRLKNFLATEELDRSFIEQSDPKNDGHSCAVEIDNATFLWKGKKN 652

Query: 483 ----------PTRSANQI-FNNLN-FTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSG 530
                      T    Q+ F N+N F +  GS  C+VG  G GK+T+   +L      SG
Sbjct: 653 LVSSENGDEESTIDNTQVAFKNVNHFEVKEGSLTCIVGRVGSGKTTLLRAVLGQLPCISG 712

Query: 531 RITIDGQDISKISAKSLRR--HLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKK 588
                 Q+   I  K + R   +    Q+  +M+ S+++NI +G  Y      +    + 
Sbjct: 713 -----AQE--SIPPKLIIRGNSIAYCPQQAWIMNSSVKENILFGHKYDEHYYNL--TIEA 763

Query: 589 CFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVE-S 647
           C     +    DG ET++G KG  LSGGQK R+++ARA+  + +I +LD+  SA+D E S
Sbjct: 764 CQLTEDLKMLPDGDETIVGEKGISLSGGQKARLSLARAVYSRSDIYLLDDILSAVDAEVS 823

Query: 648 EGAINYTLGQ---LMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELY-AS 703
           +  I   L +   L+KS+  TII   + +S ++ S+ +  L ++  ++E G + ++  +S
Sbjct: 824 KNIIEKVLDEQTGLLKSK--TIILTTNAISVLKHSQKIYAL-ENCEIIEEGAYDDVMNSS 880

Query: 704 KESKLYKLLNEKAKDTTSKMNAETVEKNDPSPKT 737
           ++SKL  L+NE   D  +    E  E+   S +T
Sbjct: 881 EDSKLKALINEFDNDRDNNSKEEVSEERKTSEET 914

>Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 1568 aa]
            {ON} ANNOTATED BY YGOB -
          Length = 1568

 Score =  125 bits (315), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 138/555 (24%), Positives = 233/555 (41%), Gaps = 53/555 (9%)

Query: 193  GLYDFLAVFAGALVLST-FANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKV 251
             L+ F+ V+A   ++S  F N   +V+L     +   +L  N+    ++    FF+   +
Sbjct: 1012 NLWMFVGVYALIGIISAAFNNLRSIVMLIFCSIRGSKKLHDNMALSVVYSPMSFFETTPI 1071

Query: 252  GDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVG 311
            G +I+R S D   V   +    S  F++++   V + ++ +                   
Sbjct: 1072 GRIINRFSGDLDSVDSGLQFIFSHFFRSLLGYIVTVILVGYNMPWFFVFNIFLIVIYFYY 1131

Query: 312  ATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIR-KVFDV 370
               Y    R + R    +   +  +  E L+G   + +          YNHA R   F+ 
Sbjct: 1132 QAYYIVTSRELKRLTSITYSPIMSLISETLAGYLVINA----------YNHAKRFSYFNF 1181

Query: 371  GKREALTNATF-FSSTSV-----LGDFSFLIVLAYG----SHLVLQGSLSIGDLTAFMLY 420
               +   +  F F ST+      L     LIVLA G    S +     L+ G +   M Y
Sbjct: 1182 ESVQFNIDCLFNFRSTNRWLSVRLQAIGALIVLATGLLSLSTIGTSKQLTAGMVGLLMSY 1241

Query: 421  TEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYA----TKGVPYVPGKGEIKFE 476
            +    +++  +     ++     +  R+ E  +  P        TK     P  G IKF 
Sbjct: 1242 SLQVTNSLMWIVRMSVQIETNIVSVERILEYCELPPEPPHEIEETKPEKSWPAHGSIKFI 1301

Query: 477  NVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDG 536
            + S  Y  ++ + + N +N  I+    + +VG +G GKST+   L +    T G+I IDG
Sbjct: 1302 DYSTKY-RKNLDPVLNKINLEIEPREKIGIVGRTGAGKSTLTLALFRILEATDGKIVIDG 1360

Query: 537  QDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDE-----IRSVSKKCFC 591
             DIS +    LR +L ++ Q+     G+IR N+    P+    DE     I +   K   
Sbjct: 1361 VDISTLGLSDLRSNLAIIPQDAQAFEGTIRTNLD---PFDQHSDEELWKAIEASHLKPHL 1417

Query: 592  HNFITKFSDGYETV---------------IGPKGALLSGGQKQRIAIARALIKKPNILIL 636
               I+   D  E+                I   G+ LS GQ+Q + ++RAL+    IL+L
Sbjct: 1418 ERIISNRDDNSESEETNVSAKDNNLLEIKINENGSNLSVGQRQLLCLSRALLNHSKILVL 1477

Query: 637  DEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGK 696
            DEAT+++D+E++  I  T+      R  TI++IAHR+ T+   + ++VL D G V E   
Sbjct: 1478 DEATASVDMETDKIIQETIRNEFSDR--TILTIAHRIDTVLGYDKILVL-DKGEVREFDS 1534

Query: 697  FKELYASKESKLYKL 711
               L  +K S  Y L
Sbjct: 1535 PDTLLENKNSIFYNL 1549

 Score =  104 bits (260), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 111/454 (24%), Positives = 214/454 (47%), Gaps = 49/454 (10%)

Query: 316 GRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDV---GK 372
            +K++S++++  +      +   E L+ +K+++ +  E+  +KR +H +R   ++    K
Sbjct: 450 SKKVKSLNKEQMKYKDIRIRTLTEILNSIKSIKLYSWEKPMLKRLDH-VRNDLELESFKK 508

Query: 373 REALTNATFFSSTSV--LGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFG 430
              ++N  FF+   V  +   S  I+ A  S + L   +    L  F +  +    A++ 
Sbjct: 509 IGIVSNCIFFAWNCVPIMVTCSSFIIFALTSGMALTPDIVFPALALFNILND----AIYS 564

Query: 431 LSNFYSELMKGAGAASRL--FELTDHQPSIYATKGVPYVPGKG-EIKFENVSFSY----- 482
           + +  + +++ + +  RL  F  T+     +  +  P   G    ++ +N +F +     
Sbjct: 565 VPSTITNIIEVSVSLGRLKNFLATEELDRSFIEQSDPKNDGHSCAVEIDNATFLWKGKKN 624

Query: 483 ----------PTRSANQI-FNNLN-FTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSG 530
                      T    Q+ F N+N F +  GS  C+VG  G GK+T+   +L      SG
Sbjct: 625 LVSSENGDEESTIDNTQVAFKNVNHFEVKEGSLTCIVGRVGSGKTTLLRAVLGQLPCISG 684

Query: 531 RITIDGQDISKISAKSLRR--HLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKK 588
                 Q+   I  K + R   +    Q+  +M+ S+++NI +G  Y      +    + 
Sbjct: 685 -----AQE--SIPPKLIIRGNSIAYCPQQAWIMNSSVKENILFGHKYDEHYYNL--TIEA 735

Query: 589 CFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVE-S 647
           C     +    DG ET++G KG  LSGGQK R+++ARA+  + +I +LD+  SA+D E S
Sbjct: 736 CQLTEDLKMLPDGDETIVGEKGISLSGGQKARLSLARAVYSRSDIYLLDDILSAVDAEVS 795

Query: 648 EGAINYTLGQ---LMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELY-AS 703
           +  I   L +   L+KS+  TII   + +S ++ S+ +  L ++  ++E G + ++  +S
Sbjct: 796 KNIIEKVLDEQTGLLKSK--TIILTTNAISVLKHSQKIYAL-ENCEIIEEGAYDDVMNSS 852

Query: 704 KESKLYKLLNEKAKDTTSKMNAETVEKNDPSPKT 737
           ++SKL  L+NE   D  +    E  E+   S +T
Sbjct: 853 EDSKLKALINEFDNDRDNNSKEEVSEERKTSEET 886

>ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} similar
            to uniprot|P14772 Saccharomyces cerevisiae YLL015W BPT1
            ABC type transmembrane transporter of MRP/CFTR family
            found in vacuolar membrane involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates along with Ycf1p
          Length = 1570

 Score =  125 bits (314), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 143/582 (24%), Positives = 256/582 (43%), Gaps = 52/582 (8%)

Query: 161  VIGMVLDVAKNAI-----TSDEKPKDLRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGR 215
            ++G V +V++N        S++K    +DL   V   G+Y  L + + A     F N   
Sbjct: 996  LLGRVFEVSENFWLKYWSESNQKNGSNKDLWKFV---GIYALLGISSAA-----FDNIRA 1047

Query: 216  VVLL---RILGEKLVARLRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQN 272
            V++L    I G K+   L + +    +     FF+   +G +I+R SSD   V R++  N
Sbjct: 1048 VIILLYSSIRGSKV---LHNKMAVSVLKSPMGFFESTPIGRIINRFSSDMSTVDRNLKYN 1104

Query: 273  ISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIYGRKIRSISRDLQQSTGN 332
             +  FK ++   V I ++ +                      Y    R + R    +   
Sbjct: 1105 FAFFFKCVLDYFVTILLIGYNMPWFLVFNAGLLVVYVYYQVFYVTLSRELKRLSSTAFSP 1164

Query: 333  LTKVAEEQLSGVKTVQSFV-AEQKEIKRYNHAIRKVFDVGKREAL--TNATFFSSTSVLG 389
            +  +  E L G   + +F  +E+     +N   +  F +  +  L  TN        ++G
Sbjct: 1165 IMSLFSETLGGHMVITAFRHSERFHFLNFN---KTQFQIDAQFNLRSTNRWLSIRLQIIG 1221

Query: 390  DFSFLIV-LAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRL 448
                LI  L   + +  +  ++ G +   M Y     +++  +    + +     +  R+
Sbjct: 1222 GAMVLITALLTLATIGTKKQMTAGLVGLLMSYVLQVTNSLMWIVRMTTMIETNIISVERI 1281

Query: 449  FE---LTDHQPSIY-ATKGVPYVPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNV 504
            +E   L    P+I  +++     P  GEI F++ S  Y     + +   +N +I     +
Sbjct: 1282 YEYCQLPSEAPAIIESSRPEKSWPSMGEIIFKDYSTKYRPE-LDPVLKKINLSIKPREKI 1340

Query: 505  CVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGS 564
             VVG +G GKS+++  L +    T G I IDG DISKI    LR HL ++ Q+     G+
Sbjct: 1341 GVVGRTGAGKSSLSLALFRLLESTGGSIEIDGVDISKIGLYDLRSHLSIIPQDAQAFEGT 1400

Query: 565  IRDNITYGVPYTP-TIDEI-RSVSKKCFCHNFITKFSD-------------GYETVIGPK 609
            +R N+    P+   ++ EI ++V       + I   +D               +  I   
Sbjct: 1401 VRSNLD---PFNQYSVQEIWKAVELAHLKPHIIKMMTDEDPDKSSPEDEISALDVKISEN 1457

Query: 610  GALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISI 669
            G  +S GQ+Q + ++RAL+ K  +L+LDEAT+A+D+E++  I  T+    + +D TI++I
Sbjct: 1458 GNNMSMGQRQLLCLSRALLSKSKVLVLDEATAAVDMETDQIIQETIRN--EFQDKTILTI 1515

Query: 670  AHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKL 711
            AHR+ T+  S+ ++VL D G V E      L   ++S  Y L
Sbjct: 1516 AHRIDTVLDSDKILVL-DKGEVKEFESPDTLLKDEKSLFYGL 1556

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 78/255 (30%), Positives = 129/255 (50%), Gaps = 19/255 (7%)

Query: 495 NFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSL--RRHLG 552
           +F    G+  CVVG  G GKST+   +L       G++         IS + L   R + 
Sbjct: 661 HFEAKKGALTCVVGRVGSGKSTLLRAIL-------GQLPCRSGPKEFISPEILVRARSVA 713

Query: 553 VVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGAL 612
              Q P +M+ SI+DNI +G  Y  T   +    K C     +   S+G ET++G KG  
Sbjct: 714 YCPQAPWVMNASIKDNILFGHRYDETYYNL--TIKACQLIPDLKILSEGDETLVGEKGIS 771

Query: 613 LSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTLGQ---LMKSRDITIIS 668
           LSGGQK R+++ARA+  + ++ ++D+  SA+D E S+  I+  LG+   L+K +  TII 
Sbjct: 772 LSGGQKARLSLARAVYSRADLYLMDDILSAVDAEVSKNIIDKVLGEENGLLKHK--TIIL 829

Query: 669 IAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYA-SKESKLYKLLNEKAKDTTSKMNAET 727
             + +S ++ S N+I     G +VE G +++  +   +S L KL+ E      +  + + 
Sbjct: 830 TTNAVSVLKHS-NMIYALQGGRIVEEGTYEQAVSRGDDSVLQKLIKEFDTFAENPSDKKK 888

Query: 728 VEKNDPSPKTEKLND 742
            E+ND    +E   +
Sbjct: 889 DEENDSHSISEDFEE 903

>KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1507

 Score =  125 bits (313), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 147/555 (26%), Positives = 251/555 (45%), Gaps = 65/555 (11%)

Query: 207  LSTFANFG-------RVVLLRIL--GEKLVARLRSNVIKKTIHQDAEFFDRNKVGDLISR 257
            LST+A  G        +++L+ L  G +  +++ + ++ + +H    FFD    G +++R
Sbjct: 963  LSTYAAIGLFHASVTTLIMLKFLCIGLEASSKVFAEILNRVLHAKMTFFDFTPAGRILNR 1022

Query: 258  LSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIYGR 317
            ++ D  ++ + +   +     AI   G  + ++  I++              V  T Y  
Sbjct: 1023 ITRDFEILEQELMVLLLQLLFAITSLGAILLLISVIATKFLIFAFLLGIIYAVMITSYIP 1082

Query: 318  KIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALT 377
              R + R    +   + +   E LSG  T++ F    KE        RK+ D+  R A  
Sbjct: 1083 AFRDLKRYEGITRSPIFEQFSELLSGFVTIRGF---GKEKSCMGQLFRKL-DLNNRPAYY 1138

Query: 378  NATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTA-----------FMLYTEYSGS 426
                    SV+  +  L V   GS LVL  + ++  L A                 +S S
Sbjct: 1139 -------VSVVQLWLCLRVEVLGS-LVLGATATLSLLNAKELGAGLAGLALTYAMPFSQS 1190

Query: 427  AVFGLSNFYSELMKGAGAASRLFELT--DHQPSIYATKGVPYVPGKGEIKFENVSFSYPT 484
            A++  +   S +     +  R+ E T  D + +           G  EI F++V   Y  
Sbjct: 1191 ALWT-ATVSSNVEIKMTSVERIKEYTEIDCEDTKAGALINTQWSGGAEISFDHVYVRYAP 1249

Query: 485  RSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISA 544
               + +  N++FT+   S V +VG +G GKST+   L +    T+G I I G DI+ ++ 
Sbjct: 1250 HLPD-VLKNVSFTLLPNSKVAIVGRTGSGKSTVMMSLFRLIELTNGTIRIGGIDIASLNL 1308

Query: 545  KSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTID-EIRSVSKK--CFCHNFITKFSDG 601
            ++LRR L V+ Q+P L SG+I+ NI    P+    D E+   +++   F      +  + 
Sbjct: 1309 QTLRRELTVIPQDPSLFSGTIKSNID---PFGRYSDQELTHFARRIGLFSGTDDVRTFNS 1365

Query: 602  YETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKS 661
              +++   G  +S GQ+Q + +ARAL++K  ILILDEAT+++D E++  I   +      
Sbjct: 1366 LGSLVSEGGENMSQGQRQLLCLARALLQKSKILILDEATASIDHETDATIQQVV------ 1419

Query: 662  RDIT----IISIAHRLSTIRRSENVIVLGDDGSVVE----------MGKFKELYASKESK 707
            RD +    +I++AHR+STI   + VIVL D G V E           G F ++   KES 
Sbjct: 1420 RDFSSGGIVITVAHRMSTIIDYDQVIVL-DSGIVKENNHPYLLLKQNGAFHQM--CKESG 1476

Query: 708  LYKLLNEKAKDTTSK 722
             Y+ L + AK    K
Sbjct: 1477 EYERLEDAAKKAYQK 1491

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 71/247 (28%), Positives = 116/247 (46%), Gaps = 17/247 (6%)

Query: 472 EIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGR 531
           E+ F N S ++       +  NL    +      ++GPSG GKS++   LL   +   G 
Sbjct: 634 EMGFRNASLTWNRFDTGFMLKNLTIDFELHKLNVIIGPSGSGKSSVLLALLGELDLIEGS 693

Query: 532 ITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFC 591
           I      + +      R       Q P + + ++++NI +   +       + V   C  
Sbjct: 694 I-----RVPRGYMHDDRCSFAFCSQTPWITNATVKENIVFSSQFNT--KRYQEVLHACGL 746

Query: 592 HNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI 651
              I +  +G ETV+G KG  LSGGQ+QR+A+ARA+      L+LD+  SA+D      I
Sbjct: 747 EEDILEMQEGDETVVGDKGMTLSGGQRQRLALARAVYSGAEHLLLDDCLSAVDPGMAVWI 806

Query: 652 --NYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFK------ELYAS 703
                +G LMK +  T I   H ++ +++  ++I+L D+G V ++GK +      E   S
Sbjct: 807 FQKCIMGPLMKGK--TCILATHNIALVQKHADMIILLDNGRVSKIGKARDFNFDSEFDYS 864

Query: 704 KESKLYK 710
           K SKL K
Sbjct: 865 KPSKLEK 871

>ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1525

 Score =  124 bits (310), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 92/281 (32%), Positives = 140/281 (49%), Gaps = 19/281 (6%)

Query: 435  YSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKFENVSFSYPTRSANQIFNNL 494
            YSE+      A  L E  D +PS       P  P  G I+F++ S  Y     + I  ++
Sbjct: 1253 YSEI---PSEAPYLIE--DRRPS-------PNWPTDGAIQFQHYSTRYRP-GLDLILKDI 1299

Query: 495  NFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVV 554
            N  I     + +VG +G GKS++   L +      GRI IDG  I ++    LR  L ++
Sbjct: 1300 NLDIKPKEKIGIVGRTGAGKSSLTLALFRLIEAAEGRIVIDGVPIDQMGLYDLRHKLSII 1359

Query: 555  QQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKF-SDGYETVIGPKGALL 613
             Q+  +  GS+R+NI     Y+   +EI  V       N +    +DG  T +   G  L
Sbjct: 1360 PQDSQVFEGSVRENIDPTEQYSD--EEIWRVLDLSHLKNHVLNMGNDGLLTQLSEGGGNL 1417

Query: 614  SGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRL 673
            S GQ+Q + +ARAL+    IL+LDEAT+A+DVE++  +  T+      R  TI++IAHRL
Sbjct: 1418 SVGQRQLMCLARALLVPTKILVLDEATAAVDVETDKVLQETIRTAFADR--TILTIAHRL 1475

Query: 674  STIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNE 714
            +TI  S+ ++VL D G V E    + L  +  +  Y L  +
Sbjct: 1476 NTIMDSDRILVL-DAGRVAEFDTPENLLKNPGTMFYGLCQD 1515

 Score =  112 bits (279), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 132/523 (25%), Positives = 230/523 (43%), Gaps = 67/523 (12%)

Query: 223 GEKLVARLRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIIC 282
           G  L + L S + KK++   +E  D +  GD+++ +S D   V R   Q+++     I  
Sbjct: 378 GMNLKSALTSVIYKKSLVLSSEAADMSSTGDIVNLMSVD---VQR--LQDLAQWCHLIWS 432

Query: 283 GGVGIGMMFHISSXXXXXXXXXXXXXXVGATIY------GRKIRSISRDLQQ----STGN 332
           G       F I                VG  I          +  + ++LQ+    +   
Sbjct: 433 GP------FQIILCLTSLYKLLGKSMWVGVIILIVMMPLNSSLMRVQKNLQKGQMKNKDQ 486

Query: 333 LTKVAEEQLSGVKTVQSFVAEQK-----EIKRYNHAIRKVFDVGKREALTN-----ATFF 382
            T++  E L+ +K+++ +  E+      E  R    ++ +  +G   A+ N       FF
Sbjct: 487 RTRLINEILNNMKSLKLYAWEKPYKEKLEYVRNEKELKNLTKIGVYNAIINFQFNIVPFF 546

Query: 383 SSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGA 442
            S S         V  Y     L   L    LT F L + +  + V  + N Y E     
Sbjct: 547 VSCSTFA------VFVYTEDRPLTTDLVFPALTLFGLLS-FPLAVVPLVLNSYIEASVSI 599

Query: 443 GAASRLFE-LTDHQPSIYATKGVPYVPGKGEIKF---ENVSFSYPTRSANQI-FNNLNFT 497
           G   RL+  LT+ +    + + +P V   G++     +N +F +  +   ++   N+NF 
Sbjct: 600 G---RLYSFLTNEELQRDSVQRLPRVKNIGDVAMKLGDNATFLWKRKPEYKVALKNVNFQ 656

Query: 498 IDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQE 557
              G   CVVG  G GKS +   LL       G  T+ G             ++  V Q 
Sbjct: 657 AKKGELNCVVGRVGSGKSALIQSLLGDLFRVKGFATVHG-------------NIAYVSQV 703

Query: 558 PILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQ 617
             +M+G+++DNI +G  Y P   E     K C     +    DG +T++G KG  LSGGQ
Sbjct: 704 AWIMNGTVKDNILFGHKYDPEFYE--KTIKACALTIDLAILPDGDKTIVGEKGISLSGGQ 761

Query: 618 KQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTLGQ--LMKSRDITIISIAHRLS 674
           K R+++ARA+  + +I +LD+  +A+D   S   I++ LG   L+K++  T I   +++S
Sbjct: 762 KARLSLARAVYSRADIFLLDDPLAAVDEHVSTHLIDHVLGPNGLLKTK--TKILATNKIS 819

Query: 675 TIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAK 717
            +  +++V +L ++G +++ G F E+  + +S L KL+ E  K
Sbjct: 820 ALSIADSVTLL-ENGEIIQQGTFCEITKAADSPLSKLIKEYGK 861

>TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1377

 Score =  120 bits (301), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 135/546 (24%), Positives = 240/546 (43%), Gaps = 68/546 (12%)

Query: 192  LGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKV 251
            +G+Y F  VF G++V  T    G+  LL  +G +    L    + + IH    F +   +
Sbjct: 841  MGMYSFF-VF-GSIVFLT----GQFSLLCYIGLRASKSLNLQAVNRVIHSPMWFMESTPM 894

Query: 252  GDLISRLSSDAYVVSRSMTQNISDGFKAII---CGGVGIGMMFHIS-SXXXXXXXXXXXX 307
            G +++R + D    + S+   I D  + ++   C  VGI ++  I               
Sbjct: 895  GRIMNRFTKD----TESLDNQILDNLRFVVYQACTIVGISVLCIIYLPWFAIAIPGLGLI 950

Query: 308  XXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRK- 366
              V  + Y    R I R        +     + L GV T++++ AE++   + ++ I K 
Sbjct: 951  LFVACSHYQSSAREIKRLEAVQRSFIYNHLNDVLGGVDTIRAYGAEERFSYKLDYLIDKT 1010

Query: 367  -----VFDVGKREA-----LTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLT- 415
                 ++   +R       L   +F    S+L       +    + +VL   L I DL  
Sbjct: 1011 NEASYLYTAVQRWINIVINLVGISFTLIVSLLCVTKVFNLSGASTGVVLSYVLLIPDLLN 1070

Query: 416  ---AFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGE 472
                 +  TE   ++V  L  + +EL + A     +       PS          P  GE
Sbjct: 1071 NTLTMVTQTENDMNSVERLVTYATELPQEASHGEEV-------PS-------KTWPENGE 1116

Query: 473  IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
            IKFENV +++       + +     I +G  V + G +G GKST+   L +     SGR+
Sbjct: 1117 IKFENVRYTHRD-GLPAVLDKFTLKIAAGERVGICGRTGAGKSTVLGALYRLREVESGRV 1175

Query: 533  TIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEI-RSVSKKCFC 591
             ID  D+SK++  +LR  L ++ Q+P+L  GS+R N+    P+    D++ ++   +C  
Sbjct: 1176 MIDDVDVSKLNLTALRSRLAIIPQDPVLFQGSVRHNLD---PFGEYDDDVLKNALMRCTV 1232

Query: 592  HNFITKFSDGYETV-----------------IGPKGALLSGGQKQRIAIARALIKKPNIL 634
              F    ++  E +                 +   G   S G++Q +A+ARALI+  +IL
Sbjct: 1233 GKFNKTGNESTEGIDTDADNGLVGKFRLDQDVEENGCNFSVGERQVLALARALIRNSSIL 1292

Query: 635  ILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEM 694
            +LDEAT+A+D  ++  +   + +  K R  T++ +AHRL TI   + ++VL ++G ++ +
Sbjct: 1293 VLDEATAAVDAATDAHVQRLVAEAFKGR--TVLCVAHRLDTILNYDRILVL-ENGKIIGL 1349

Query: 695  GKFKEL 700
               K L
Sbjct: 1350 DTPKSL 1355

 Score =  111 bits (277), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 120/453 (26%), Positives = 199/453 (43%), Gaps = 70/453 (15%)

Query: 325 DLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDV-----GKREALTNA 379
           ++ Q T     +  E L+ +K V+ +  EQ     Y  +I+K+  +      + E L N 
Sbjct: 354 NINQVTDQRVSILREVLNNIKMVKLYCWEQA----YEKSIKKIRSLETSKLTRMEILKNV 409

Query: 380 TFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELM 439
            F  + S+    S +  LA      + G L      A  +++  S   +  L +FY  L 
Sbjct: 410 IFSVTFSLPNICSLMTFLAL---FKIHGGLK----NAATIFSSLSLFKILSLLSFYIPLS 462

Query: 440 KGAG-----AASRLFELTDHQPS-----IYATKGVPYVPGKGEIKFENVSFSYPTRSANQ 489
            G       +  R  E  + + S     I  T    Y      IK  + SF + T   + 
Sbjct: 463 LGTAIDIVTSLDRFQEFLEAEESKETRIIRETNSEIYGDNTVAIKASHCSFRWDTEEKDN 522

Query: 490 I-------FNNLNFTIDSGSNVCVVGPSGRGKST----IASLLLKYYNPTSGRITIDGQD 538
                   F++LNF I  G  + +VGP G GK++    I  L+ +Y N   G + +DG  
Sbjct: 523 NEEKEFSGFHDLNFEIMKGELIIIVGPIGSGKTSLLNAICGLMPQYGN--EGELEVDGSL 580

Query: 539 ISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKF 598
           +S                 P + + ++RDNI +G  Y  +  + + V + C     + K 
Sbjct: 581 VS--------------CGYPWIQNTTVRDNILFGSKYDES--KFKRVIRMCSLEEDLEKL 624

Query: 599 SDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTLGQ 657
           S    T IG +G  LSGGQK RI +AR+L K+ +I + D+  SA+D    +  +   L +
Sbjct: 625 SAYDMTEIGERGVTLSGGQKSRINLARSLYKEKDIYLFDDILSAVDSRVGQSIMKECLME 684

Query: 658 LMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKES--------KLY 709
            +K++  T +   H+LS I +++ +IVLG+DG   +MG++++L  + E+        KL 
Sbjct: 685 GLKNK--TRVLATHQLSLIGKADQLIVLGNDGK-FDMGRYEDLIKTNETLINLMQYAKLQ 741

Query: 710 KLLNEKA---KDTTSKMNAETVEKNDPSPKTEK 739
           + + EK    KD   K      E  +PS  T K
Sbjct: 742 EEIQEKEEVIKDKNEKTETTISENLEPSQLTTK 774

>SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa]
            {ON} similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1558

 Score =  116 bits (291), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 82/262 (31%), Positives = 130/262 (49%), Gaps = 24/262 (9%)

Query: 468  PGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNP 527
            P +G I F+N S  Y   + + +  ++   I     + +VG +G GKST++  L +   P
Sbjct: 1292 PSRGAITFQNYSTKY-RENLDPVLKDITVEIKPQEKIGIVGRTGAGKSTLSLALFRLLEP 1350

Query: 528  TSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSK 587
            + G I IDG DI+K+    LR +L ++ Q+     G+I+ N+     Y+   +EI    +
Sbjct: 1351 SGGSIVIDGIDIAKLGLSDLRGNLAIIPQDAQAFEGTIKSNLDPFGQYSD--EEIWRALE 1408

Query: 588  KCFCHNFITKF-----SDGYETV-------------IGPKGALLSGGQKQRIAIARALIK 629
                   I K      ++  ET              I   G  LS GQ+Q + ++RAL+ 
Sbjct: 1409 LSHLKPHILKMASEENTENSETTTEATRSHELLSARITENGGNLSIGQRQLLCLSRALLN 1468

Query: 630  KPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDG 689
               IL+LDEAT+A+D+E++  I  T+    K R  TI++IAHR+ T+  S+ ++VL D G
Sbjct: 1469 HSKILVLDEATAAVDMETDKIIQETIKTAFKDR--TILTIAHRIDTVMDSDKIMVL-DKG 1525

Query: 690  SVVEMGKFKELYASKESKLYKL 711
             V E      L A K +  Y L
Sbjct: 1526 EVKEFDTPTNLLADKSTIFYNL 1547

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 101/451 (22%), Positives = 199/451 (44%), Gaps = 50/451 (11%)

Query: 317 RKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIR--KVFDVGKRE 374
           +K++++ R   +      K   E L+ VK+++ +  E+  ++R +H     ++ +  K  
Sbjct: 452 KKVKTLYRTQMKYKDARIKTITEILNSVKSIKLYAWEKPMLERLDHCRNGLELENFKKIG 511

Query: 375 ALTNATFFS--STSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLS 432
            ++N  +F+     V    S   + +  S + L   +    L+ F +  +     ++ + 
Sbjct: 512 IVSNLIYFAWKCIPVAVTCSTFAIFSLTSDMPLSPQIVFPSLSLFNILND----CIYSIP 567

Query: 433 NFYSELMKGAGAASRL--FELTDHQPSIY-------ATKGVP----------YVPGKGEI 473
           +  + +++   +  RL  F L +     +       AT   P          +   KG  
Sbjct: 568 STINNIIETGVSIKRLKDFLLAEELDDFFIERLDANATSNSPAIEIYNATFLWKSTKGLK 627

Query: 474 KFENVSFSYPTRSANQIFNNL-NFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           + EN        S      N+ +F    G   C+VG  G GKST    +L      SG  
Sbjct: 628 EDENYDEEAAVASTKVALKNIRHFEARKGDLTCIVGRVGSGKSTFLQAILGQLPCISG-- 685

Query: 533 TIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCH 592
            +D     K+  ++  + +    Q+P +M+ S++DN+ +G  +    D  ++  +KC   
Sbjct: 686 -LDEHVPPKLIIRA--KSIAYCPQQPWIMNASLKDNVIFG--HRLNEDYYKATIRKCQLL 740

Query: 593 NFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVE-----S 647
             +    DG +T++G KG  LSGGQK R+++ARA+  + ++ +LD+  SA+D E      
Sbjct: 741 PDLDILPDGDQTLVGEKGISLSGGQKARLSLARAVYARADVYLLDDILSAVDAEVSKNIV 800

Query: 648 EGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESK 707
           E  +N   G L   ++ T+I   + +S ++ S+N+  L  DG +VE   + +  +  +S 
Sbjct: 801 EQVLNRGTGIL---KNKTVILTTNAVSVLKHSQNIYALL-DGEIVENKSYADAMSCDDSS 856

Query: 708 LYKLL------NEKAKDTTSKMNAETVEKND 732
           + K L      NE +++ T      +  K+D
Sbjct: 857 ILKTLIQEFDSNENSREDTKDGQPSSTAKDD 887

>TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1546

 Score =  115 bits (288), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 145/598 (24%), Positives = 242/598 (40%), Gaps = 90/598 (15%)

Query: 192  LGLYDFLAVFAGAL--VLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRN 249
            LG+Y F   F+ AL  +L T   +   V   I G K+   L S ++   +     FF+  
Sbjct: 976  LGIY-FALGFSSALSQLLQTVILW---VFCTIHGSKI---LHSQMLASVLRAPMSFFETT 1028

Query: 250  KVGDLISRLSSDAY----VVSRSMTQNISDGFKA-----IICGGVGIGMMFHISSXXXXX 300
             +G +++R S+D Y    ++ R+ +Q  S+  K      +IC      + F +       
Sbjct: 1029 PIGRILNRFSNDMYKVDELLGRTFSQFFSNAVKVTFTLVVICVSTWQFIFFIVPMSFLYI 1088

Query: 301  XXXXXXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRY 360
                          Y R  R + R    +        +E L G+ T++ +  E + I   
Sbjct: 1089 YYQQY---------YMRTSRELRRLDSVTRSPTISHFQETLGGISTIRGYSQENRFIHIN 1139

Query: 361  NHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLY 420
               +             N         LG    L     G + + QG+++ G +   + Y
Sbjct: 1140 QQRVDNNMSAYYPSINCNRWLAFRLEFLGSVIILGASTLGIYRLSQGNMTPGMIGLSLSY 1199

Query: 421  TEYSGSAVFGLSNFYSELMKGAGAASRL---FELTDHQPSIYATKGVPYV--PGKGEIKF 475
                  ++  +     E+     +  R+    EL    PSI   K  P V  P  G +KF
Sbjct: 1200 ALQITQSLNWIVRMTVEVETNIVSVERIKEYSELASEAPSIVEDKR-PDVNWPQDGAVKF 1258

Query: 476  ENVSFSYPTR---SANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
             +    Y TR     + +  ++   I     + +VG +G GKS++   L +    + G I
Sbjct: 1259 NH----YYTRYRADLDYVLKDITLDIKPREKIGIVGRTGAGKSSLTLALFRIIEASEGNI 1314

Query: 533  TIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCH 592
             +DG +  +I    LR  L ++ Q+  +  G++RDNI     YT   +EI    +     
Sbjct: 1315 NVDGINTDEIGLYDLRHKLSIIPQDSQVFEGTVRDNIDPTGQYTD--EEIWKALELSHLK 1372

Query: 593  NFITKF------------------------------------SDGYE--------TVIGP 608
            + I                                       S G E        T +  
Sbjct: 1373 SHIINMSKHSSSDSSSNESLSPASNNSSGNNDNSNSSSDGLTSSGLEDISHNALNTKLSE 1432

Query: 609  KGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIIS 668
             G+ LS GQ+Q + +ARAL+   NIL+LDEAT+A+DVE++  I  T+    K+R  TI++
Sbjct: 1433 GGSNLSVGQRQLMCLARALLVPSNILVLDEATAAVDVETDQLIQETIRSAFKNR--TILT 1490

Query: 669  IAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKDTTSKMNAE 726
            IAHRL+TI  S+ ++VL D G + E    + L   K+S  Y L  E+A  T ++++ +
Sbjct: 1491 IAHRLNTIMDSDRILVL-DKGEIKEFDSPQTLLGDKDSLFYSLC-EQAGLTPAQLSGK 1546

 Score =  105 bits (263), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 104/425 (24%), Positives = 197/425 (46%), Gaps = 54/425 (12%)

Query: 334 TKVAEEQLSGVKTVQSFVAE-----QKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVL 388
           T++  E L+ +K+++ +  E     + E  R    ++ +  +G   A T+  F +    L
Sbjct: 468 TRLISEILNNIKSLKLYAWEAPYKEKLEYVRNEKELKNLTKMGCYVAFTHFQF-NIVPFL 526

Query: 389 GDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRL 448
              S   V  +     L   L    LT F L +    +    +++F    ++ + + +RL
Sbjct: 527 VSCSTFAVFVWTQDRPLTTDLVFPALTLFNLLSFPMAAIPIMITSF----IEASISINRL 582

Query: 449 FE-LTDHQPSIYATKGVPYVPGKGEIKF---ENVSFSYPTRSANQI-FNNLNFTIDSGSN 503
           F  LT+ +    A + +P V   G++     ++ +F +  +   ++   N+NF    G  
Sbjct: 583 FSFLTNEELQKDAVQRLPNVKNTGDVSIKLGDDATFLWKRKPEYKVALKNINFQARKGEL 642

Query: 504 VCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSG 563
            C+VG  G GKS +   +L       G  T+ G D++ +S            Q P +M+G
Sbjct: 643 TCIVGKVGSGKSALIQSILGDLFRVKGFATVHG-DVAYVS------------QVPWIMNG 689

Query: 564 SIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAI 623
           ++++NI +G  +     E     K C     ++   DG  T++G KG  LSGGQK R+++
Sbjct: 690 TVKENILFGHKFDKKFYE--KTIKACALTIDLSILPDGDSTLVGEKGISLSGGQKARLSL 747

Query: 624 ARALIKKPNILILDEATSALDVE-SEGAINYTLG---------QLMKSRDITIISIAHRL 673
           ARA+  + +  + D+  +A+D    +  I + LG         +++ +  IT+++IA   
Sbjct: 748 ARAVYARADTYLFDDPLAAVDEHVGKHLIEHVLGPNGLLHSKTKVLATNKITVLNIA--- 804

Query: 674 STIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNE---KAKDTTSKMNAETVEK 730
                  + I L D+G +++ GK++E+ +   S L KL+NE   K + T   M + ++ K
Sbjct: 805 -------DYITLLDNGEIIQRGKYEEVTSDPGSPLCKLINEYGKKHESTPGTMVSSSMSK 857

Query: 731 NDPSP 735
            +PSP
Sbjct: 858 -EPSP 861

>TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_5.10
            YGR281W possible pseudogene; NNN added to avoid internal
            stop codon; truncated at 5' end
          Length = 1058

 Score =  113 bits (283), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 78/251 (31%), Positives = 128/251 (50%), Gaps = 19/251 (7%)

Query: 468  PGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNP 527
            P  G+I+F++ +F Y       I  N N  + SG  + + G +G GKSTI + L +    
Sbjct: 797  PENGKIQFKDANFRYK-EGLPLILKNFNMLVQSGEKIGICGRTGAGKSTIMNCLFRLDEL 855

Query: 528  TSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNI---TY---GVPYTPTI-- 579
            T G I ID  DIS +    LR++L ++ Q+PIL  G+IR N+   +Y      +   I  
Sbjct: 856  TDGAIYIDDIDISTLGLHDLRKNLSIIPQDPILFEGTIRKNLDPFSYFDDATLWEAMILS 915

Query: 580  -----DEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNIL 634
                 D     S+K   +  +TKF       +   G   S G+KQ +A  RA+I    ++
Sbjct: 916  GFIDRDTFGHFSEKPVNNKELTKFH--LTAHVEEDGTNYSLGEKQLLAFTRAIIHHSKVV 973

Query: 635  ILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEM 694
            +LDEA+S++D E++  I   + +       TI+ IAHRL+TI + + ++VL D G+++  
Sbjct: 974  VLDEASSSVDYETDAKIQTLISKQFSHN--TILCIAHRLNTILKYDRILVL-DHGNIIGF 1030

Query: 695  GKFKELYASKE 705
               + L+ + E
Sbjct: 1031 ENPRVLFENNE 1041

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 88/285 (30%), Positives = 131/285 (45%), Gaps = 49/285 (17%)

Query: 473 IKFENVSFSYPT---------RSANQI------------FNNLNFTIDSGSNVCVVGPSG 511
           IKF N SF + T          + NQI            FNNLNF+I  G  + + GP G
Sbjct: 166 IKFNNASFEWETFEDDIIKDENNINQILENKTNNCHFNGFNNLNFSI-XGEFIIITGPIG 224

Query: 512 RGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITY 571
            GK+++   +        G I IDG            +  G     P + + ++RDNI +
Sbjct: 225 TGKTSLLYAMSGLMKKLEGTIEIDGN----------LQLCGY----PWVQNTTVRDNIIF 270

Query: 572 GVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKP 631
           G  Y    ++   V + C     +  FS    T IG  G  LSGGQK RI +ARA+ K  
Sbjct: 271 GSKYEK--EKFDHVIRICALTEDLENFSGKDLTEIGELGITLSGGQKARINLARAIYKTS 328

Query: 632 NILILDEATSALDVESEGAI--NYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDG 689
           +I + D+  SA+D      I  N  LG L  S     I   H+LS I++++ ++VLG+D 
Sbjct: 329 DIYLFDDILSAVDSRVGNFIMENCLLGAL--SGKTXXILATHQLSLIKKADRIVVLGNDN 386

Query: 690 SVVEMGKFKELYASKESKLYKLLNEKAKDTTSKMNAETVEKNDPS 734
           S  E+G +KEL  S ++ +         + +S+M  E ++K   S
Sbjct: 387 S-FEIGPYKELIQSNKTFI------NLIEYSSQMELEKIKKTKGS 424

>TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON} 
          Length = 1485

 Score =  114 bits (284), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 132/546 (24%), Positives = 224/546 (41%), Gaps = 66/546 (12%)

Query: 192  LGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKV 251
            +GLY F  VF   + ++     G+  LL  +G      L    + K +H    F D N +
Sbjct: 944  MGLYSFF-VFGSYIFMN-----GQYTLLCYMGVVASKTLNLQALHKILHTPMSFMDTNPL 997

Query: 252  GDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMM-------FHISSXXXXXXXXX 304
            G +++R + D   +   +T+N+       I   +G+G M       F I+          
Sbjct: 998  GRILNRFTKDTDALDNELTENLRLAMSQ-IANIIGVGAMCIIYLPWFAIAIPFLLLIFLL 1056

Query: 305  XXXXXVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAI 364
                        +++ +I R    +  N      E L+G+ T++++ A+ +   +    I
Sbjct: 1057 IADHYQSTGREVKRLEAIQRSFVYNNLN------EMLTGMDTIKAYNAQDRFATKSEFLI 1110

Query: 365  RKVFDVGKREALTNATFFSSTSV---LGDFSFLIVLAYGSHLVL-----QGSLSIGDLTA 416
             K+          N   + S +V    G F  L+ +A+   + L     Q  +S  D   
Sbjct: 1111 DKM----------NEAAYISIAVQRWAGIFLDLVAVAFALIITLLCVTRQFHISGADTGV 1160

Query: 417  FMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQP---SIYATKGVPYV--PGKG 471
             + Y       +  +    ++      +  RL       P        +  P +  P  G
Sbjct: 1161 LLTYVLQLPGLLNTVLRALTQTENDMNSTERLVSYATQLPQEAQYRKPECSPPIDWPQNG 1220

Query: 472  EIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGR 531
             I FEN++F+Y       I  N N  I     + + G +G GKSTI + L +    T+G+
Sbjct: 1221 HIVFENINFAY-RPGLPIILKNFNLIIKPNEKIGICGRTGAGKSTIMNALYRLTELTTGK 1279

Query: 532  ITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDN----------------ITYGVPY 575
            I ID  DIS +    LR  L ++ Q+P+L  G+IR N                +  G   
Sbjct: 1280 IIIDDIDISNLGLYELRSKLAIIPQDPVLFRGNIRRNLDPFDEYQDDLLWESLVKAGAID 1339

Query: 576  TPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILI 635
            +  ++ ++S  K     N + KF       +   G   S G++Q +A+ RAL+++  ILI
Sbjct: 1340 SQELETVKSQDKNSDAKN-LHKFH--LNQSVDEDGNNFSLGERQVLALTRALVRQSKILI 1396

Query: 636  LDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMG 695
            LDEATS++D E++  I   +         TI+ IAHRL TI   + ++VL + G V E  
Sbjct: 1397 LDEATSSVDYETDAKIQNLIATAFNH--CTILCIAHRLKTILNYDRILVL-EKGEVAEFD 1453

Query: 696  KFKELY 701
                L+
Sbjct: 1454 TPWNLF 1459

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 68/214 (31%), Positives = 105/214 (49%), Gaps = 21/214 (9%)

Query: 490 IFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRR 549
           + +N+NFTI  G  V V GP G GK+++   L       SG +   G  +          
Sbjct: 624 LLSNINFTIPKGEFVVVTGPVGSGKTSLLFALAGLMEQLSGEMNHSGDLLL--------- 674

Query: 550 HLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPK 609
             G+    P + + +IRDNI +G PY PT    + V   C   + +       +T +G +
Sbjct: 675 -CGI----PWVQNATIRDNILFGSPYDPTF--YKRVLHVCALESDLENLPAHDKTEVGER 727

Query: 610 GALLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTLGQLMKSRDITIIS 668
           G  LSGGQK RI++ARA+ K  +I + D+  SA+D       ++Y +   +   D T I 
Sbjct: 728 GVTLSGGQKARISLARAVYKNKDIYLFDDVLSAVDARVGRHIMDYCMNDHLS--DKTRIL 785

Query: 669 IAHRLSTIRRSENVIVL--GDDGSVVEMGKFKEL 700
             H+LS + +++ +IVL    D    E+G FKEL
Sbjct: 786 ATHQLSLVEKADRIIVLSTSKDAPHFEIGTFKEL 819

>AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YGR281W (YOR1)
          Length = 1400

 Score =  109 bits (273), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 78/242 (32%), Positives = 125/242 (51%), Gaps = 17/242 (7%)

Query: 472  EIKFENVSFSYPTRSANQI-FNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSG 530
            EI F+ VSF+Y  R    +    ++F + +G  + + G +G GK+++ + L +     SG
Sbjct: 1144 EIVFQEVSFAY--RPGLPLALCGVSFHVRAGEKIGICGRTGAGKTSVTTALYRLSELESG 1201

Query: 531  RITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDE------IRS 584
             I IDG DI+ +    LR  L ++ Q+P+L  G++R N+    P+    D       +RS
Sbjct: 1202 SIKIDGVDIATLGLHDLRSALSIIPQDPLLFRGTVRKNLD---PFAEHTDGTLWSALVRS 1258

Query: 585  VSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALD 644
                        KF    E   G  GA  S G++Q +A+ARAL++   ILILDEATS++D
Sbjct: 1259 GVVPAGVVPTSHKFHLDQEVDEG--GANFSLGERQLLALARALVRSTRILILDEATSSVD 1316

Query: 645  VESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASK 704
              ++  +   +    + R  T++ +AHRL TI   + ++VL D G V E      L+A K
Sbjct: 1317 YATDARVQARIAA--EFRQATVLCVAHRLRTIISYDRILVL-DQGRVAEFDTPYRLFARK 1373

Query: 705  ES 706
            +S
Sbjct: 1374 DS 1375

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 72/247 (29%), Positives = 119/247 (48%), Gaps = 21/247 (8%)

Query: 491 FNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRH 550
            N+L F+I  G  + V+G  G GK+++ + +  Y   T+G + ++G  +           
Sbjct: 551 LNDLLFSIKKGEFIIVIGAIGTGKTSLLNAVAGYMKKTTGSVHVNGSLL----------F 600

Query: 551 LGVVQQEPILMSGSIRDNITYGVPYTPT-IDEIRSVSKKCFCHNFITKFSDGYETVIGPK 609
            GV    P + + +IRDNI +G  +  T  DE   V   C        F  G +T +G +
Sbjct: 601 CGV----PWIQNATIRDNIIFGSSFDQTRYDE---VVNACALEADFKIFPAGDKTEVGER 653

Query: 610 GALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISI 669
           G  LSGGQK RI++ARA+ K  +I + D+  SA+D      I      L + ++ T I  
Sbjct: 654 GITLSGGQKARISLARAIYKDRDIYLFDDIISAVDANVAAHITQKC-LLDRLQNRTRILA 712

Query: 670 AHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKDTTSKMNAETVE 729
            H+L+ ++ +  VI LG DGS  +MG   EL+  K  +   L++  ++    +   E++ 
Sbjct: 713 THQLALVQEASRVIFLGQDGS-FDMGTPAELH-EKNPQFRNLMSLSSQTNAEESEMESIR 770

Query: 730 KNDPSPK 736
               S K
Sbjct: 771 SQSKSKK 777

>Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {ON}
           similar to Ashbya gossypii AGL346W
          Length = 1536

 Score = 94.0 bits (232), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 72/257 (28%), Positives = 130/257 (50%), Gaps = 25/257 (9%)

Query: 491 FNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRH 550
           F++L+F +  G  + + G  G GK+++ + L  + + T+G I  +G+             
Sbjct: 590 FSDLSFEVKKGELLVITGAIGTGKTSLLNALAGFMHKTNGDIQYNGR------------- 636

Query: 551 LGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKG 610
             +    P + + +IRDNIT+G PY   +   R V + C     ++    G +T +G +G
Sbjct: 637 -MLFCGAPWIQNATIRDNITFGSPYDENL--YREVMRVCSLDRDMSVLPAGDKTEVGERG 693

Query: 611 ALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI--NYTLGQLMKSRDITIIS 668
             LSGGQK RI +AR + K  +I + D+  SA+D     +I  +  LG+L    D T I 
Sbjct: 694 ITLSGGQKARINLARCVYKVRDIYLFDDILSAVDARVGASIMNDCLLGKL---GDKTRIL 750

Query: 669 IAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYAS--KESKLYKLLNE-KAKDTTSKMNA 725
             H++S   ++  VI LG DGS  ++G   EL     + + L KL ++ +++     +++
Sbjct: 751 ATHQISLTEQASRVIYLGTDGS-FDIGTVDELKTRNVQFANLMKLASQTESESKDDNISS 809

Query: 726 ETVEKNDPSPKTEKLND 742
           E  ++ D   + ++L+D
Sbjct: 810 EKFDREDQLRQLQQLDD 826

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 95/399 (23%), Positives = 171/399 (42%), Gaps = 46/399 (11%)

Query: 192  LGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKV 251
            +G+Y F   F  A  LST   F    L+  LG +    +    + + +H    F D   +
Sbjct: 922  MGMYFF---FVMANYLSTNIQFS---LVSYLGLRASKNINLQSLHRLLHVPVSFIDTTPL 975

Query: 252  GDLISRLSSDAYVVSRSMTQNISD-GFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXV 310
            G +++R + D  ++   +T+++    ++  +  GV I  + ++                V
Sbjct: 976  GRILNRFTKDTDILDNELTESLRMFSYQFTVIWGVIIMSIIYLPWFAVAVPLLVVVFILV 1035

Query: 311  GATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDV 370
                Y    R I R        +     E +SGV T++++ AE + +K+ +  I ++   
Sbjct: 1036 SDH-YQCSAREIKRLEAVQRSFVLNNFNEVISGVDTIKAYHAEARFLKKSDILIDRM--- 1091

Query: 371  GKREALTNATFFSSTSV---LGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSA 427
                 +T   + S   V   +G  + L  L   S L + G  +I   +  +L T      
Sbjct: 1092 ---NEMTFPLYASQRWVSILIGMIAVLFALII-SILCVTGWFNISPASTGVLLT-----Y 1142

Query: 428  VFGLSNFYSELMKGA-------GAASRLFELTDHQPSIYATKGVPY----------VPGK 470
            V  L N ++ L++          +A R+    +  P     K  PY           P +
Sbjct: 1143 VLQLPNLFNTLLRAMTQLENDMNSAERVLSYANSLP-----KEAPYRIPEMAPPKAWPER 1197

Query: 471  GEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSG 530
            G I F+NV+ +Y       +  +++F I SG  + + G +G GKSTI + L +    ++G
Sbjct: 1198 GAITFDNVALAYRP-GLPLVLQDVSFHISSGEKIGICGRTGAGKSTITNALYRLVELSNG 1256

Query: 531  RITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNI 569
             +TIDG DI+ I   +LR  L ++ Q+P+L  G+IR N+
Sbjct: 1257 SVTIDGVDIATIGLYNLRSKLSIIPQDPLLFRGTIRKNL 1295

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 74/123 (60%), Gaps = 4/123 (3%)

Query: 603  ETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSR 662
            +  +   G+  S G++Q +A+ARAL+++  ILILDEATS++D E++  I   + Q  + +
Sbjct: 1418 DQTVEEDGSNFSVGERQFLALARALVRQTKILILDEATSSVDYETDAQIQARIVQ--EFQ 1475

Query: 663  DITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKDTTSK 722
              TI+ +AHRL TI   + ++V+ + G V E      LY +++  +++ + +++  T + 
Sbjct: 1476 HATIMCVAHRLKTILHYDRILVM-EKGRVAEFDTPLRLY-NEQGSIFRSMCDQSSITLTD 1533

Query: 723  MNA 725
             +A
Sbjct: 1534 FDA 1536

>YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}
           NFT1Putative transporter of the multidrug
           resistance-associated protein (MRP) subfamily; adjacent
           ORFs YKR103W and YKR104W are merged in different strain
           backgrounds.
          Length = 1218

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 84/269 (31%), Positives = 134/269 (49%), Gaps = 12/269 (4%)

Query: 475 FENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI-- 532
           FE+ S  +     +    N++      S   ++GP+G GKS++   LL   N  SG+I  
Sbjct: 653 FEDASMEWEAAETSFKLKNISIDFKLNSLNAIIGPTGSGKSSLLLGLLGELNLLSGKIYV 712

Query: 533 -TIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFC 591
            T++ +D  +I    +   +    Q P L+SG+I+DN+ +G  +     +   V K C  
Sbjct: 713 PTVESRDDLEIGKDGMTNSMAYCSQTPWLISGTIKDNVVFGEIFNK--QKFDDVMKSCCL 770

Query: 592 HNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI 651
              I   + G  T +G  G  LSGGQ+QRIA+ARA+      LILD+  SA+D E+   I
Sbjct: 771 DKDIKAMTAGIRTDVGDGGFSLSGGQQQRIALARAIYSSSRYLILDDCLSAVDPETALYI 830

Query: 652 --NYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLY 709
                 G +MK R  T I  +H +S + +  + +V+ D G V   GK  +L  S E  L 
Sbjct: 831 YEECLCGPMMKGR--TCIITSHNISLVTKRADWLVILDRGEVKSQGKPSDLIKSNEF-LR 887

Query: 710 KLLNEKAKDTTSKMNAETVEKNDPSPKTE 738
           + +N  +K+TT   N   ++++  S KT+
Sbjct: 888 ESINNDSKNTTH--NQIDLKRSTTSKKTK 914

 Score = 36.6 bits (83), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 33/187 (17%), Positives = 79/187 (42%), Gaps = 12/187 (6%)

Query: 197  FLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKVGDLIS 256
            FL  +    ++S+F   G+V +  I G  +  ++ + ++   ++    F +    G +++
Sbjct: 1010 FLLTYIIIGLVSSFLTSGKVWIAIISGTNVTKKIFAKLLSSILYAKLRFHNVTPTGRIMN 1069

Query: 257  RLSSDAYVVSRSMTQNISD-GFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATIY 315
            R S D  ++ + +  N     +  ++C  + I ++ +++                  T+Y
Sbjct: 1070 RFSKDMDIIDQQLIPNFEGLSYSVVVCLWI-ILLIGYVTPQFLLFAIPLCALYYTVCTLY 1128

Query: 316  GRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREA 375
             R  R + R    +   + ++  E + GV T+++   E++ I +   AI +         
Sbjct: 1129 LRASRELKRIDNINISPIHQLFAEAIKGVTTIRALADERRFITQSLVAIDR--------- 1179

Query: 376  LTNATFF 382
             +NA FF
Sbjct: 1180 -SNAPFF 1185

>Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON}
           complement(1..4131) [4131 nt, 1377 aa]
          Length = 1377

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 77/283 (27%), Positives = 131/283 (46%), Gaps = 27/283 (9%)

Query: 475 FENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI-- 532
           F   +  +   +   I  NLN    S     V GP+G GKS +   LL   +   G I  
Sbjct: 693 FSGATIGWSINNKGFILENLNVKFKSKKLNVVAGPTGAGKSLLLMSLLGETHLFKGEIHV 752

Query: 533 -TIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFC 591
            ++  +    I    L   +    Q P +++ SI++NI +G  +   +     V + C  
Sbjct: 753 PSLASKHELMIHGDGLTNSISYCSQIPWIINDSIKNNILFGSEFN--LKRYNDVIRACCL 810

Query: 592 HNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI 651
            N +    DG  +++G +G  LSGGQ+QR+++ARA+  K   +ILD+  SA+D +    I
Sbjct: 811 TNDLRLLQDGDNSIVGDRGQNLSGGQRQRVSLARAIYSKSMHIILDDCLSAVDSKCAKDI 870

Query: 652 NYTL---GQLMKSRDITIISIAHRLS-TIRRSENVIVL--------GDDGSVVEMGKFKE 699
            Y L   G LMK R  T I ++H +   I+++  +++L        G  G +++    ++
Sbjct: 871 -YDLCLTGPLMKGR--TCILVSHNVELVIKKAAYLLILDNRTTAYKGPPGDLLKDKALRQ 927

Query: 700 LYASKESKLYKLLNEKAKD--TTSKMNAET--VEKNDPSPKTE 738
            Y   +   +  LNE   +  TTS ++     +E  D S KT+
Sbjct: 928 RYCKFD---FNELNENCPNQCTTSVVHKPDYYLEDRDSSSKTQ 967

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 67/337 (19%), Positives = 133/337 (39%), Gaps = 35/337 (10%)

Query: 195  YDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKVGDL 254
            Y F   F   L  + F++  +  L    G     R+   +++  +     FF++  +G +
Sbjct: 1059 YYFFMYFFIGLCYALFSSI-KSGLTYFTGINACNRIFIKILRNVVSSKLIFFEKTPIGSI 1117

Query: 255  ISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSXXXXXXXXXXXXXXVGATI 314
            ++  S D   +   ++  I   F   +   + + ++ +++               +    
Sbjct: 1118 MNNFSKDIRSLDFELSPFIEGTFSCTLQTLMSLILITYVNPNFIFPAIFIF----LFCCF 1173

Query: 315  YGRKIRSISRDLQQSTGNLTKVA-----EEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFD 369
             G      SR+L++    +TK        E L+G+ ++++F  E + IK           
Sbjct: 1174 IGHSYLCCSRELKRYES-ITKTPIYQHFSESLAGLVSIRAFGDELRFIKV---------- 1222

Query: 370  VGKREALTNATFFSSTSVLGDFSFLI-------VLAYGSHLVLQGSLSIGDLT--AFMLY 420
            +  R    N +FF         SF I       +LA G  L+   ++    L    F   
Sbjct: 1223 IFTRVDEYNKSFFYLWEANNWLSFRIELIGSITILATGLFLLSNANMVDSGLAGITFTYA 1282

Query: 421  TEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYA---TKGVPYVPGKGEIKFEN 477
              ++ SA++ +  FY+ +     +  RL+E T+ +   Y+   T      P  G+IKF+N
Sbjct: 1283 IAFTESALWMIK-FYATMEMNMNSVERLYEYTNLEQEPYSRCITNVDNQWPNSGDIKFKN 1341

Query: 478  VSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGK 514
            V+  Y +    ++  ++ F I     + VVG +G GK
Sbjct: 1342 VTLRY-SPELPKVLQDVTFVIGDKEKIGVVGRTGAGK 1377

>SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {ON}
           highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 64/236 (27%), Positives = 105/236 (44%), Gaps = 48/236 (20%)

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           I+ ++VSF Y   S   +  ++N  +   S + +VG +G GK+T+  ++++   PT G +
Sbjct: 532 IQLQDVSFGYEENSP--LLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPTKGYV 589

Query: 533 TIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCH 592
           +           ++ R  +G   Q  +       D++      T  +D            
Sbjct: 590 S-----------RNPRLRIGYFTQHHV-------DSMDLN---TSAVD--------WMSK 620

Query: 593 NFITKFSDGYETVIGPKG----------ALLSGGQKQRIAIARALIKKPNILILDEATSA 642
            F  K  + Y   +G  G           LLSGGQK R+A A   +  P+IL+LDE ++ 
Sbjct: 621 TFPGKTDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 643 LDVESEGAI-----NYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVE 693
           LD     A+     N+T G LM S DI++I   H  S I  SE+  V   DG++ +
Sbjct: 681 LDTAGLDALIDALKNFTGGVLMVSHDISVID--HVCSEIWVSEDGTVKRFDGTIYD 734

 Score = 45.1 bits (105), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 57/97 (58%), Gaps = 6/97 (6%)

Query: 613 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHR 672
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y L + +K+   T++ ++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATVLVVSHD 423

Query: 673 LSTIRR-SENVIVLGDDGSVVEMGK-FKELYASKESK 707
            + +   + ++I   ++      G+ F   YA+KE +
Sbjct: 424 RAFLNEVATDIIYQHNERLDYYRGQDFDTFYATKEER 460

>NCAS0E00480 Chr5 (81549..83381) [1833 bp, 610 aa] {ON} 
          Length = 610

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 103/227 (45%), Gaps = 26/227 (11%)

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           + F+++SFSY     N ++ NL+F +D  S + +VGP+G GKST+  ++     P SGR+
Sbjct: 393 LAFDSISFSYDGNPENNLYENLDFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 533 TIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCH 592
           +           +     LGV  Q         +  + +     P I +     +     
Sbjct: 453 S-----------RHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYPNISQDFQYWRGQLGR 501

Query: 593 NFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVES----- 647
             +T   +G    +G     LS GQ+ R+  A   +++PN+L+LDE T+ LD+ +     
Sbjct: 502 YGLT--GEGQTVQMG----TLSEGQRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSLA 555

Query: 648 EGAINYTLGQLMKSRDITIIS-IAHRLSTIRRSENVIVLGDDGSVVE 693
           E    +  G ++ S D  ++  IA  +  +   EN      +GS++E
Sbjct: 556 EAINEFNGGVVVVSHDFRLLDKIAKDIFVV---ENKTATRWNGSILE 599

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 613 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAH 671
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+       L + +K  D T++ ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>Suva_5.134 Chr5 complement(199609..201441) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 53/228 (23%), Positives = 110/228 (48%), Gaps = 28/228 (12%)

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           + F+++SF Y +  +  ++ NLNF +D  S + +VGP+G GKST+  ++     P SGR+
Sbjct: 393 LAFDDISFHYESNPSENLYENLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 533 TIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCH 592
           +           +     LGV  Q         +  + +     P++ +     +     
Sbjct: 453 S-----------RHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYPSVSQDFQYWRGQLGR 501

Query: 593 NFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAIN 652
             +T   +G +TV   + A LS GQ+ R+  A   +++PN+L+LDE T+ LD+ +  ++ 
Sbjct: 502 YGLT--GEG-QTV---QMATLSEGQRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSLA 555

Query: 653 YTLGQLMKSRDITIISIAHRLSTIRR-SENVIVLGD------DGSVVE 693
             + +        ++ ++H    + + ++++ V+ D      DGS+++
Sbjct: 556 DAINEFNGG----VVVVSHDFRLLDKIAQDIFVVEDKTATRWDGSILQ 599

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 4/69 (5%)

Query: 603 ETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSR 662
           +T I  K   +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+       L + +K  
Sbjct: 217 KTTILKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRF 272

Query: 663 DITIISIAH 671
           D T++ ++H
Sbjct: 273 DRTLVLVSH 281

>ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {ON}
           highly similar to uniprot|P40024 Saccharomyces
           cerevisiae YER036C
          Length = 610

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 107/241 (44%), Gaps = 54/241 (22%)

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           + F+ +SF+Y     + ++ NLNF +D  S + +VGP+G GKST+  ++     P +GR+
Sbjct: 393 LAFDEISFAYDGNPEHNLYENLNFGVDMDSRIALVGPNGVGKSTLLKIMTGDLTPQAGRV 452

Query: 533 --------------TIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPT 578
                         + D  D++K + + +R     + Q+     G +     YG+     
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVREKYSHISQDFQYWRGQLG---RYGLT---- 505

Query: 579 IDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDE 638
                                DG +  +G     LS GQ+ R+  A   ++ PNIL+LDE
Sbjct: 506 --------------------GDGQKAQMGT----LSEGQRSRVVFALLALQAPNILLLDE 541

Query: 639 ATSALDVES----EGAIN-YTLGQLMKSRDITIIS-IAHRLSTIRRSENVIVLGDDGSVV 692
            T+ LD+ +      AIN +  G ++ S D  ++  IA  +  +   EN      DGS++
Sbjct: 542 PTNGLDIPTIDSLAEAINTFNGGVVVVSHDFRLLDKIAQDIFVV---ENKTAYRWDGSIL 598

Query: 693 E 693
           E
Sbjct: 599 E 599

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 40/66 (60%), Gaps = 4/66 (6%)

Query: 606 IGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDIT 665
           I  K   +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+       L + +K  D T
Sbjct: 220 IQKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRT 275

Query: 666 IISIAH 671
           ++  +H
Sbjct: 276 LVLNSH 281

>Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar to
           Ashbya gossypii AFR232C
          Length = 609

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 83/187 (44%), Gaps = 45/187 (24%)

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           + F+ +SFSY  +  N ++ NLNF +D  S V +VGP+G GKST+  ++     P  GR+
Sbjct: 392 LAFDEISFSYDEKPENNLYENLNFGVDMDSRVALVGPNGVGKSTLLKIMTGELTPQGGRV 451

Query: 533 --------------TIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPT 578
                         + D  D++K + + +R   G + ++     G +     YG+     
Sbjct: 452 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYGHISEDFQYWRGQLG---RYGLT---- 504

Query: 579 IDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDE 638
                                +G    +G     LS GQ+ R+  A   + +PN+L+LDE
Sbjct: 505 --------------------GEGQTVQMG----TLSEGQRSRVVFALLALDQPNVLLLDE 540

Query: 639 ATSALDV 645
            T+ LD+
Sbjct: 541 PTNGLDI 547

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 41/66 (62%), Gaps = 4/66 (6%)

Query: 606 IGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDIT 665
           I  K   +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+       L + +K  D T
Sbjct: 219 INKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRT 274

Query: 666 IISIAH 671
           ++ ++H
Sbjct: 275 LVLVSH 280

>KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {ON}
           Anc_8.661 YPL147W
          Length = 876

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 59/215 (27%), Positives = 106/215 (49%), Gaps = 27/215 (12%)

Query: 488 NQIFNNLN--FTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAK 545
           N+I N+++  F   +GS++ ++GP+G GKS+I  ++ + + P   +        + + +K
Sbjct: 629 NEITNDISIPFLNSAGSSLLILGPNGCGKSSIQRIIAEIW-PIYNK--------NGLLSK 679

Query: 546 SLRRHLGVVQQEPILMSG-SIRDNITYGVPYTPTIDEIRSVSKKCFCH-------NFITK 597
               +L  V Q+P    G ++RD I Y +      D  R +  K           +++ K
Sbjct: 680 PTEANLLCVPQKPYFTRGGTLRDQIIYPMSSDEFFD--RGLKDKLLVQVLREVKLDYLLK 737

Query: 598 FSDG--YETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTL 655
              G  Y   +     +LSGG+KQR+  AR +  KP  ++LDEAT+A+  + E   +Y  
Sbjct: 738 RDKGWSYLDTVSDWKDVLSGGEKQRMNFARIMFHKPRFVVLDEATNAISADME---DYLF 794

Query: 656 GQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGS 690
             L + R    I+I+ R S I+  + ++ + DD S
Sbjct: 795 NVLKRYR-FNFITISQRPSLIKYHDLLLEISDDNS 828

>SAKL0F01606g Chr6 (133318..135144) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|P40024 Saccharomyces cerevisiae
           YER036C
          Length = 608

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 84/177 (47%), Gaps = 21/177 (11%)

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           + F+++SFSY     N ++  LNF +D  S + +VGP+G GKST+  ++     P SGR+
Sbjct: 391 LAFDDISFSYDDNPENNLYEKLNFGVDMDSRIALVGPNGVGKSTLLKIMTGQLMPQSGRV 450

Query: 533 TIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITY-GVPYTPTIDEIRSVSKKC-F 590
           +           +     LGV  Q         +D +     P     D+  ++S+   +
Sbjct: 451 S-----------RHTHVKLGVYSQHS-------QDQLDLTKSPLEFVRDKYPNISQDFQY 492

Query: 591 CHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVES 647
               + ++    E      G  LS GQ+ R+  A   +++PN+L+LDE T+ LD+ +
Sbjct: 493 WRGQLGRYGLTGEAQTSQMGT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDIPT 548

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 613 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAH 671
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+       L + +K  D T++ ++H
Sbjct: 225 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 279

>YER036C Chr5 complement(223367..225199) [1833 bp, 610 aa] {ON}
           ARB1ATPase of the ATP-binding cassette (ABC) family
           involved in 40S and 60S ribosome biogenesis, has
           similarity to Gcn20p; shuttles from nucleus to
           cytoplasm, physically interacts with Tif6p, Lsg1p
          Length = 610

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 108/241 (44%), Gaps = 54/241 (22%)

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           + F+++SF Y +  +  ++ +LNF +D  S + +VGP+G GKST+  ++     P SGR+
Sbjct: 393 LAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 533 TIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIR-SVSKKCFC 591
           +               RH                 ++  GV    + D++  + S   F 
Sbjct: 453 S---------------RHT----------------HVKLGVYSQHSQDQLDLTKSALEFV 481

Query: 592 HNFITKFSDGYETVIGPKG-------------ALLSGGQKQRIAIARALIKKPNILILDE 638
            +  +  S  ++   G  G             A LS GQ+ R+  A   +++PN+L+LDE
Sbjct: 482 RDKYSNISQDFQFWRGQLGRYGLTGEGQTVQMATLSEGQRSRVVFALLALEQPNVLLLDE 541

Query: 639 ATSALDVES----EGAIN-YTLGQLMKSRDITIIS-IAHRLSTIRRSENVIVLGDDGSVV 692
            T+ LD+ +      AIN +  G ++ S D  ++  IA  +  +   EN      DGS++
Sbjct: 542 PTNGLDIPTIDSLADAINEFNGGVVVVSHDFRLLDKIAQDIFVV---ENKTATRWDGSIL 598

Query: 693 E 693
           +
Sbjct: 599 Q 599

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 613 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAH 671
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+       L + +K  D T++ ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>KLTH0G01452g Chr7 (105741..107564) [1824 bp, 607 aa] {ON} highly
           similar to uniprot|P40024 Saccharomyces cerevisiae
           YER036C
          Length = 607

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 106/227 (46%), Gaps = 26/227 (11%)

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           + F+++SF+Y  ++ N ++ +LNF +D  S V +VGP+G GKST+  ++    +  SGR+
Sbjct: 390 LAFDDISFAYDGKAENNLYEHLNFGVDMDSRVALVGPNGVGKSTLLKIMTGELSAQSGRV 449

Query: 533 TIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCH 592
           +           +     LGV  Q         +  + +     P I +     +     
Sbjct: 450 S-----------RHTHVKLGVYSQHSQEQLDLNKSPLEFVRDKFPHISQDFQYWRGQLGR 498

Query: 593 NFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVES----- 647
             +T   +G  + +G     LS GQ+ R+  A   ++ PN+L+LDE T+ LD+ +     
Sbjct: 499 YGLT--GEGQTSQMGT----LSEGQRSRVVFALLALQAPNVLLLDEPTNGLDIATIDSLA 552

Query: 648 EGAINYTLGQLMKSRDITIIS-IAHRLSTIRRSENVIVLGDDGSVVE 693
           E   ++  G ++ S D  ++  IA  +  +   EN      DGS+++
Sbjct: 553 EAINDFNGGVVVVSHDFRLLDKIAKDIFVV---ENKTATRWDGSILD 596

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 41/66 (62%), Gaps = 4/66 (6%)

Query: 606 IGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDIT 665
           I  K   +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+       L + +K  D T
Sbjct: 217 IKKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRT 272

Query: 666 IISIAH 671
           ++ ++H
Sbjct: 273 LVLVSH 278

>NDAI0I03020 Chr9 complement(713821..715650) [1830 bp, 609 aa] {ON}
           Anc_3.534
          Length = 609

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 59/227 (25%), Positives = 105/227 (46%), Gaps = 26/227 (11%)

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           + F+++SFSY     + ++ NL+F +D  S + +VGP+G GKST+  ++     P SGR+
Sbjct: 392 LAFDSISFSYDGNPEHNLYENLDFGVDMDSRIALVGPNGVGKSTLLKIMTGELMPQSGRV 451

Query: 533 TIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCH 592
           +           +     LGV  Q         +  + +     P I +     +     
Sbjct: 452 S-----------RHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYPNISQDFQYWRGQLGR 500

Query: 593 NFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVES----E 648
             +T   +G    +G     LS GQ+ R+  A   +++PN+L+LDE T+ LD+ +     
Sbjct: 501 YGLT--GEGQTVQMG----TLSEGQRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSLA 554

Query: 649 GAIN-YTLGQLMKSRDITIIS-IAHRLSTIRRSENVIVLGDDGSVVE 693
            AIN +  G ++ S D  ++  IA  +  +   EN      DGS+++
Sbjct: 555 EAINEFNGGVVVVSHDFRLLDKIAKDIFVV---ENRTATRWDGSILQ 598

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/210 (25%), Positives = 92/210 (43%), Gaps = 19/210 (9%)

Query: 472 EIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGR 531
           +IK  +VS  +       +  + N  ++ G    ++G +G GKST    L     P    
Sbjct: 80  DIKLTSVSLLF---HGKVLIQDSNLELNYGRRYGLLGENGCGKSTFLKALATREYPIPEN 136

Query: 532 ITI----DGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYT----PTIDEIR 583
           I I    +  + S+ SA  L   +   Q E   +   +   I    P +    P  + + 
Sbjct: 137 IDIYLLDEPAEPSEYSA--LEYVVREAQHELKRLEDLVEKYIIEEGPESELLEPLYERMD 194

Query: 584 SVSKKCF-CHNFITKFSDGYET-VIGPKGALLSGGQKQRIAIARALIKKPNILILDEATS 641
           S+    F     I     G+ +  I  K   +SGG K R+A+A+AL  KP +L+LD+ T+
Sbjct: 195 SLDPDTFESRAAIILIGLGFNSKTILKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTA 254

Query: 642 ALDVESEGAINYTLGQLMKSRDITIISIAH 671
            LD+E+       L + +K  D T++ ++H
Sbjct: 255 HLDLEA----CVWLEEYLKRFDRTLVLVSH 280

>TDEL0D06020 Chr4 complement(1087102..1088934) [1833 bp, 610 aa]
           {ON} Anc_3.534 YER036C
          Length = 610

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 80/173 (46%), Gaps = 17/173 (9%)

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           + F+ ++FSY     N ++ +LNF +D  S + +VGP+G GKST+  ++     P +GR+
Sbjct: 393 LAFDEINFSYDGNPENNLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQAGRV 452

Query: 533 TIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCH 592
           +           +     LGV  Q         +  + +     P I +     +     
Sbjct: 453 S-----------RHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYPQISQDFQYWRGQLGR 501

Query: 593 NFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDV 645
             +T   +G    +G     LS GQ+ R+  A   +++PN+L+LDE T+ LD+
Sbjct: 502 YGLT--GEGQTVQMG----TLSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 548

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 613 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAH 671
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+       L + +K  D T++ ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>KNAG0C01960 Chr3 complement(380896..383154) [2259 bp, 752 aa] {ON}
           Anc_1.366 YFR009W
          Length = 752

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 63/239 (26%), Positives = 106/239 (44%), Gaps = 57/239 (23%)

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           I+ ++VSF Y  +S   +  ++N  +   S + +VG +G GK+T+  ++++   PTSG +
Sbjct: 532 IQLQDVSFGYEEQSL--LLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPTSGYV 589

Query: 533 TIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCH 592
           + +G           R  +G   Q  +       D++      T  +D            
Sbjct: 590 SRNG-----------RLRIGYFTQHHV-------DSMDLN---TSAVD--------WMSK 620

Query: 593 NFITKFSDGYETVIGPKG----------ALLSGGQKQRIAIARALIKKPNILILDEATSA 642
            +  K  + Y   +G  G           LLSGGQK R+A A   +  P+IL+LDE ++ 
Sbjct: 621 TYPGKTDEEYRRHLGAFGITGTLGLQQMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 643 LDVESEGAI-----NYTLGQLMKSRDITII-SIAHRLSTIRRSENVIVLGDDGSVVEMG 695
           LD     A+      +T G LM S DI++I S+           N I + +DG+V + G
Sbjct: 681 LDTTGLEALVDALKKFTGGVLMVSHDISVIDSVC----------NEIWVSEDGNVKKFG 729

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 41/59 (69%), Gaps = 4/59 (6%)

Query: 613 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAH 671
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y L + +K+   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPSTVLTVSH 422

>YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subunit
           of a heterodimeric peroxisomal ATP-binding cassette
           transporter complex (Pxa1p-Pxa2p), required for import
           of long-chain fatty acids into peroxisomes; similarity
           to human adrenoleukodystrophy transporter ABCD1 and
           ABCD2 and ALD-related proteins; mutations in ABCD1 cause
           X-linked adrenoleukodystrophy (X-ALD), a peroxisomal
           disorder
          Length = 870

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 62/215 (28%), Positives = 104/215 (48%), Gaps = 33/215 (15%)

Query: 487 ANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPT---SGRITIDGQDISKIS 543
           AN I   L F   SGS++ ++GP+G GKS+I  ++ + + P    +G ++I  ++     
Sbjct: 626 ANDI--KLPFLQGSGSSLLILGPNGCGKSSIQRIIAEIW-PVYNKNGLLSIPSEN----- 677

Query: 544 AKSLRRHLGVVQQEPIL-MSGSIRDNITYGVPYTPTIDEIRSVSKKCFCH-------NFI 595
                 ++  + Q+P     G++RD I Y +      D  R    K           +++
Sbjct: 678 ------NIFFIPQKPYFSRGGTLRDQIIYPMSSDEFFD--RGFRDKELVQILVEVKLDYL 729

Query: 596 TKFSDG--YETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINY 653
            K   G  Y   I     LLSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E     
Sbjct: 730 LKRGVGLTYLDAIADWKDLLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDMEDY--- 786

Query: 654 TLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDD 688
            L  L+K      ISI+ R + I+  E ++ +G++
Sbjct: 787 -LFNLLKRYRFNFISISQRPTLIKYHEMLLEIGEN 820

>TBLA0C01220 Chr3 complement(263093..265348) [2256 bp, 751 aa] {ON}
           Anc_1.366 YFR009W
          Length = 751

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 100/226 (44%), Gaps = 32/226 (14%)

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           I+ ++VSF Y  +  N +  ++N  +   S + +VG +G GK+T+  +++    P  G +
Sbjct: 531 IQLQDVSFGYDEK--NLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMNQLKPLKGYV 588

Query: 533 TIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITY-GVPYTPTIDEIRSVSKKCFC 591
           + +G           R  +G   Q  +      +  + +  V Y    DE        F 
Sbjct: 589 SSNG-----------RLRIGYFTQHHVDSMDLTKSAVDWMSVKYPGKTDEEYRRHLGSF- 636

Query: 592 HNFITKFSDGYETVIG-PKGALLSGGQKQRIAIARALIKKPNILILDEAT-----SALDV 645
                    G    +G  K  LLSGGQK R+A A   +  P+IL+LDE +     + LD 
Sbjct: 637 ---------GITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDNTGLDA 687

Query: 646 ESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSV 691
             E   N++ G LM S DI++I    +   I  SEN  V   DG++
Sbjct: 688 LVESLKNFSGGVLMVSHDISVIDSVCK--EIWVSENGTVRRFDGTI 731

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 57/97 (58%), Gaps = 6/97 (6%)

Query: 613 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHR 672
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y L + +K+   T++ ++H 
Sbjct: 367 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPSTLLVVSHD 422

Query: 673 LSTIRR-SENVIVLGDDGSVVEMGK-FKELYASKESK 707
            + +   + ++I   ++      G+ F   YA+KE +
Sbjct: 423 RAFLNEVATDIIYQHNERLDYYRGQDFDTFYATKEER 459

>Kpol_1050.26 s1050 complement(62452..64284) [1833 bp, 610 aa] {ON}
           complement(62452..64284) [1833 nt, 611 aa]
          Length = 610

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 53/228 (23%), Positives = 108/228 (47%), Gaps = 28/228 (12%)

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           + F+++SF+Y     N ++ NLNF +D  S + +VGP+G GKST+  ++       +GR+
Sbjct: 393 LSFDDISFAYDGNKENNLYQNLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELQAQAGRV 452

Query: 533 TIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCH 592
           +           +     LGV  Q         +  + +     P I +     +     
Sbjct: 453 S-----------RHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYPQISQDFQYWRGQLGR 501

Query: 593 NFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAIN 652
             +T   +G    +G     LS GQ+ R+  A   +++PN+L+LDE T+ LD+ +   I+
Sbjct: 502 YGLT--GEGQTVQMG----TLSEGQRSRVVFALLALEQPNVLLLDEPTNGLDIPT---ID 552

Query: 653 YTLGQLMKSRDITIISIAHRLSTIRR-SENVIVLGD------DGSVVE 693
            +L + +   +  ++ ++H    + + ++++ V+ D      DGS+++
Sbjct: 553 -SLAEAIDEFNGGVVVVSHDFRLLDKIAKDIFVVEDKTATRWDGSILD 599

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 613 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAH 671
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+       L + +K  D T++ ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>Smik_5.159 Chr5 complement(228179..230011) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 53/242 (21%), Positives = 110/242 (45%), Gaps = 56/242 (23%)

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           + F+++SF Y +  +  ++ +LNF +D  S + +VGP+G GKST+  ++     P SGR+
Sbjct: 393 LAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 533 TIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIR-SVSKKCFC 591
           +               RH                 ++  GV    + D++  + S   F 
Sbjct: 453 S---------------RHT----------------HVKLGVYSQHSQDQLDLTKSALEFV 481

Query: 592 HNFITKFSDGYETVIGPKG-------------ALLSGGQKQRIAIARALIKKPNILILDE 638
            +  +  S  ++   G  G             A LS GQ+ R+  A   +++PN+L+LDE
Sbjct: 482 RDKYSNISQDFQFWRGQLGRYGLTGEGQTVQMATLSEGQRSRVVFALLALEQPNVLLLDE 541

Query: 639 ATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRR-SENVIVLGD------DGSV 691
            T+ LD+ +  ++   + +     +  ++ ++H    + + ++++ V+ D      DGS+
Sbjct: 542 PTNGLDIPTIDSLADAINEF----NGGVVVVSHDFRLLDKIAQDIFVVEDKTATRWDGSI 597

Query: 692 VE 693
           ++
Sbjct: 598 LQ 599

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 613 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAH 671
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+       L + +K  D T++ ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>Skud_5.145 Chr5 complement(221173..223005) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 53/242 (21%), Positives = 109/242 (45%), Gaps = 56/242 (23%)

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           + F+++SF Y +  +  ++ +LNF +D  S + +VGP+G GKST+  ++     P SGR+
Sbjct: 393 LAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 533 TIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIR-SVSKKCFC 591
           +               RH                 ++  GV    + D++  + S   F 
Sbjct: 453 S---------------RHT----------------HVKLGVYSQHSQDQLDLTKSALEFV 481

Query: 592 HNFITKFSDGYETVIGPKG-------------ALLSGGQKQRIAIARALIKKPNILILDE 638
            +  +  S  ++   G  G             A LS GQ+ R+  A   +++PN+L+LDE
Sbjct: 482 RDKYSNISQDFQFWRGQLGRYGLTGEGQTVQMATLSEGQRSRVVFALLALEQPNVLLLDE 541

Query: 639 ATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRR-SENVIVLGD------DGSV 691
            T+ LD+ +  ++   + +        ++ ++H    + + ++++ V+ D      DGS+
Sbjct: 542 PTNGLDIPTIDSLADAINEFNGG----VVVVSHDFRLLDKIAQDIFVVEDKTATRWDGSI 597

Query: 692 VE 693
           ++
Sbjct: 598 LQ 599

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 613 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAH 671
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+       L + +K  D T++ ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON}
           YPL147W (REAL)
          Length = 870

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 105/215 (48%), Gaps = 33/215 (15%)

Query: 487 ANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPT---SGRITIDGQDISKIS 543
           AN I   L F   SGS++ ++GP+G GKS+I  ++ + + P    +G ++I  ++     
Sbjct: 626 ANDI--KLPFLQGSGSSLLILGPNGCGKSSIQRIIAEIW-PVYNKNGLLSIPPEN----- 677

Query: 544 AKSLRRHLGVVQQEPIL-MSGSIRDNITYGVPYTPTIDEIRSVSKKCFCH-------NFI 595
                 ++  + Q+P     G++RD I Y +      D  R    K           +++
Sbjct: 678 ------NIFFIPQKPYFSRGGTLRDQIIYPMSSDEFFD--RGFKDKELVQILVEVKLDYL 729

Query: 596 TKFSDG--YETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINY 653
            K + G  Y   +     LLSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E     
Sbjct: 730 LKRAVGLTYLDAVADWKDLLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDMEDY--- 786

Query: 654 TLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDD 688
            L  L+K      ISI+ R + I+  E ++ +G++
Sbjct: 787 -LFNLLKRYRFNFISISQRPTLIKYHEMLLEIGEN 820

>Kwal_47.19116 s47 complement(1101559..1103382) [1824 bp, 607 aa]
           {ON} YER036C (KRE30) - Hypothetical ORF [contig 188]
           FULL
          Length = 607

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 108/235 (45%), Gaps = 42/235 (17%)

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           + F+++SF+Y  +  N ++ +LNF +D  S V +VGP+G GKST+  ++       SGR+
Sbjct: 390 LAFDDISFAYDGKPENNLYEHLNFGVDMDSRVALVGPNGVGKSTLLKIMTGELATQSGRV 449

Query: 533 TIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITY-GVPYTPTIDEIRSVSKKCFC 591
           +           +     LGV  Q         +D +     P     D+   +S     
Sbjct: 450 S-----------RHTHVKLGVYSQHS-------QDQLDLTKSPLEFVRDKYSHIS----- 486

Query: 592 HNFITKFSDGYETVIGPKG-------ALLSGGQKQRIAIARALIKKPNILILDEATSALD 644
           H+F  ++  G     G  G       A LS GQ+ R+  A   ++ PN+L+LDE T+ LD
Sbjct: 487 HDF--QYWRGQLGRYGLTGEGQTSQMATLSEGQRSRVVFALLALQAPNVLLLDEPTNGLD 544

Query: 645 VES----EGAIN-YTLGQLMKSRDITIIS-IAHRLSTIRRSENVIVLGDDGSVVE 693
           + +      AIN +  G ++ S D  ++  IA  +  +   EN      DGS+++
Sbjct: 545 IATIDSLADAINEFNGGVVVVSHDFRLLDKIAKDIFVV---ENKTATRWDGSILD 596

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 41/66 (62%), Gaps = 4/66 (6%)

Query: 606 IGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDIT 665
           I  K   +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+       L + +K  D T
Sbjct: 217 INKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRT 272

Query: 666 IISIAH 671
           ++ ++H
Sbjct: 273 LVLVSH 278

>TPHA0A05890 Chr1 complement(1334117..1335949) [1833 bp, 610 aa]
           {ON} Anc_3.534 YER036C
          Length = 610

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 83/177 (46%), Gaps = 25/177 (14%)

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           + F+++SF+Y  +  N ++N+LNF +D  S + +VGP+G GKST+  ++       SGR+
Sbjct: 393 LSFDDISFAYDGKPENNLYNHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELQAQSGRV 452

Query: 533 TIDGQDISKISAKSLRRH----LGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKK 588
           +               RH    LGV  Q         +  + +     P I +     + 
Sbjct: 453 S---------------RHSHVKLGVYSQHSQDQLDLTKSALEFVRDKYPEISQDFQYWRG 497

Query: 589 CFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDV 645
                 +T  +   +TV   +   LS GQ+ R+  A   ++ PN+L+LDE T+ LD+
Sbjct: 498 QLGRYGLTGEA---QTV---QMGTLSEGQRSRVVFALLALEAPNVLLLDEPTNGLDI 548

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 613 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAH 671
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+       L + +K  D T++ ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>KLLA0A01452g Chr1 (130078..131901) [1824 bp, 607 aa] {ON} highly
           similar to uniprot|P40024 Saccharomyces cerevisiae
           YER036C
          Length = 607

 Score = 67.8 bits (164), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 82/177 (46%), Gaps = 25/177 (14%)

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           + F+++SFSY   S N ++ +L+F +D  S + +VGP+G GKST+  ++       SGR+
Sbjct: 390 LAFDDISFSYDGNSENNLYEHLDFGVDMDSRIALVGPNGVGKSTLLKIMTGQLTTQSGRV 449

Query: 533 TIDGQDISKISAKSLRRH----LGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKK 588
           +               RH    LGV  Q         +  + +     P + +     + 
Sbjct: 450 S---------------RHSHVKLGVYSQHSQDQLDLTKSALEFVRDKYPHVSQDFQYWRG 494

Query: 589 CFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDV 645
                 +T   +G    +G     LS GQ+ R+  A   +++PN+L+LDE T+ LD+
Sbjct: 495 QLGRYGLT--GEGQTVQMGT----LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 545

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 41/66 (62%), Gaps = 4/66 (6%)

Query: 606 IGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDIT 665
           I  K   +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+       L + +K  D T
Sbjct: 217 INKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRT 272

Query: 666 IISIAH 671
           ++ ++H
Sbjct: 273 LVLVSH 278

>Suva_16.163 Chr16 (282462..285074) [2613 bp, 870 aa] {ON} YPL147W
           (REAL)
          Length = 870

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 62/215 (28%), Positives = 103/215 (47%), Gaps = 33/215 (15%)

Query: 487 ANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLL---LKYYNPTSGRITIDGQDISKIS 543
           AN I   L F   SGS++ ++GP+G GKS+I  ++      YN  +G ++I  ++     
Sbjct: 626 ANDI--KLPFLQGSGSSLLILGPNGCGKSSIQRIIADVWPVYN-KNGLLSIPSEN----- 677

Query: 544 AKSLRRHLGVVQQEPIL-MSGSIRDNITYGVPYTPTIDEIRSVSKKCFCH-------NFI 595
                 ++  + Q+P     G++RD I Y +      D  R    K           +++
Sbjct: 678 ------NIFCIPQKPYFSRGGTLRDQIIYPMSSDEFFD--RGFKDKELVQILAEVRLDYL 729

Query: 596 TKFSDG--YETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINY 653
            K   G  Y   +     LLSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E     
Sbjct: 730 LKRGVGLTYLDAVADWKDLLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDMEDY--- 786

Query: 654 TLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDD 688
            L  L+K      ISI+ R + I+  E ++ +G++
Sbjct: 787 -LFNLLKRYRFNFISISQRPTLIKYHEMLLEIGEN 820

>TPHA0A02310 Chr1 (483447..485705) [2259 bp, 752 aa] {ON} Anc_1.366
           YFR009W
          Length = 752

 Score = 67.8 bits (164), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 56/210 (26%), Positives = 91/210 (43%), Gaps = 46/210 (21%)

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           I+ ++V F Y  +    + N++N  I   S + +VG +G GK+T+  ++++   P  G +
Sbjct: 532 IQLQDVDFGYDNKEL--LLNDVNLDIQMDSRIALVGANGCGKTTLLKVMMEQLRPVKGYV 589

Query: 533 TIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCH 592
           + +G           R  +G   Q  +       D     V +  T              
Sbjct: 590 SRNG-----------RLRIGYFTQHHV----DSMDLDKSAVDWMSTA------------- 621

Query: 593 NFITKFSDGYETVIGPKG----------ALLSGGQKQRIAIARALIKKPNILILDEATSA 642
            F  K  + Y   +G  G           LLSGGQK R+A A   ++ P+IL+LDE ++ 
Sbjct: 622 -FPGKTDEEYRRHLGAFGITGSLSLQKIQLLSGGQKSRVAFAALCLENPHILVLDEPSNH 680

Query: 643 LDVESEGAI-----NYTLGQLMKSRDITII 667
           LD     A+     N+T G LM S DI++I
Sbjct: 681 LDTAGIDALVDALKNFTGGVLMVSHDISVI 710

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 41/59 (69%), Gaps = 4/59 (6%)

Query: 613 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAH 671
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y L + +K+   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPSTVLTVSH 422

>CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} highly
           similar to uniprot|P43535 Saccharomyces cerevisiae
           YFR009w GCN20 positive effector of GCN2P
          Length = 752

 Score = 67.8 bits (164), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 61/205 (29%), Positives = 98/205 (47%), Gaps = 34/205 (16%)

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           I+ ++VSF Y       +  ++N  I   S + +VG +G GK+T+  ++L+   P SG +
Sbjct: 532 IQLQDVSFGYSPDKL--LLKDVNLDIQMDSRIALVGANGCGKTTLLKVMLEQLRPLSGYV 589

Query: 533 TIDGQDISKISAKSLRRHLGVVQQ---EPILMSGSIRDNITYGVPYTPTIDEIRSVSKKC 589
           +           ++ R  +G   Q   + + +S S  D ++   P   T +E R      
Sbjct: 590 S-----------RNPRLRIGYFTQHHVDSMDLSTSAVDWMSKTFP-GKTDEEYR------ 631

Query: 590 FCHNFITKFSDGYETVIG-PKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESE 648
                +  F  G    +G  K  LLSGGQK R+A A   +  P+ILILDE ++ LD    
Sbjct: 632 ---RHLGSF--GITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSNHLDTTGI 686

Query: 649 GAI-----NYTLGQLMKSRDITIIS 668
            A+     N+T G LM S DI++I+
Sbjct: 687 DALVDAMKNFTGGILMVSHDISVIN 711

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 41/59 (69%), Gaps = 4/59 (6%)

Query: 613 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAH 671
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y L + +KS   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKSYPSTVLTVSH 422

>ZYRO0B14762g Chr2 (1201028..1205575) [4548 bp, 1515 aa] {ON} similar
            to uniprot|P32568 Saccharomyces cerevisiae YDR011W SNQ2
            ABC transporter
          Length = 1515

 Score = 67.8 bits (164), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 59/244 (24%), Positives = 120/244 (49%), Gaps = 25/244 (10%)

Query: 470  KGEIKFENVSFSYPTRSANQIF-NNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNP- 527
            KG   +++V +  P +   +I  +N+   +  G+   ++G SG GK+T+ + L K  N  
Sbjct: 866  KGVFIWQDVRYVIPYQGTEKILLDNVTGYVAPGTMTALMGESGAGKTTLLNTLAKRANVG 925

Query: 528  -TSGRITIDGQDISKISAKSLRRHLGVVQQEPI-LMSGSIRDNITY--------GVPYTP 577
              +G ++I+G+ +      S  R  G VQQ+ I +   ++R+++ +         +P   
Sbjct: 926  IVTGDMSINGKPVD----SSFERRTGYVQQQDIHIAEMTVRESLVFSARLRRPQSIPDAE 981

Query: 578  TIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILI-L 636
             + +  +V K       +    +  + ++G  GA L+  Q+++++I   L+ KP++L+ L
Sbjct: 982  KVADAETVMK-------LLDMEEYGDALVGGLGAGLNVEQRKKLSIGVELVAKPDLLLFL 1034

Query: 637  DEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTI-RRSENVIVLGDDGSVVEMG 695
            DE TS LD +S  AI   L ++ K+    + +I    +T+  + + +++L   G  V  G
Sbjct: 1035 DEPTSGLDSQSSWAIVQLLRRIAKAGQCILCTIHQPSATLFEQFDRLLLLKKGGQTVYFG 1094

Query: 696  KFKE 699
               E
Sbjct: 1095 DIGE 1098

 Score = 38.5 bits (88), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 58/250 (23%), Positives = 99/250 (39%), Gaps = 52/250 (20%)

Query: 489 QIFNNLNFTIDSGSNVCVVGPSGRGKS----TIASLLLKYYNPTSGRITIDG--QDISKI 542
           +I  N+N     G  + V+G  G G S    T A +  ++     G I  DG  Q++   
Sbjct: 178 KILQNINVLAKPGEMILVLGRPGSGCSSFLKTAAGVTDQFAGGVDGEILYDGIPQNVMMK 237

Query: 543 SAKS-------LRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFI 595
           + KS       L  H       P L   +++  + + +        + +VS+K      I
Sbjct: 238 NYKSDVIYNPELDVHF------PFL---TVKQTLDFAIACKTPAVRVNNVSRK----EHI 284

Query: 596 TKFSDGYETVIGPKGAL-----------LSGGQKQRIAIARALIKKPNILILDEATSALD 644
               D Y T+ G                +SGG+++R++IA AL  +  +   D AT  LD
Sbjct: 285 RATRDLYATIFGLTHTYDTKVGNDFVRGVSGGERKRVSIAEALAARGTVYSWDNATRGLD 344

Query: 645 VESEGAINYT-----LGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKE 699
             +  A+ Y      +  L++S     I  A        SEN+    D  +V+  G+   
Sbjct: 345 AST--ALEYAQAIRIMTNLLRSTAFVTIYQA--------SENIYETFDKVTVLHSGRQIY 394

Query: 700 LYASKESKLY 709
             ++K++K Y
Sbjct: 395 YGSTKDAKDY 404

>ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL147W
           (PXA1)
          Length = 827

 Score = 67.8 bits (164), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 67/234 (28%), Positives = 110/234 (47%), Gaps = 43/234 (18%)

Query: 501 GSNVCVVGPSGRGKSTIASLLLKY---YNPTSGRITIDGQDISKISAKSLRRHLGVVQQE 557
           GS++ ++GP+  GKS+I  +L +    YN T G ++I  +             L  + Q 
Sbjct: 598 GSSLLILGPNSCGKSSIQRILAEIWPIYNKT-GLVSIPAES-----------DLMCIAQR 645

Query: 558 PILMSG-SIRDNITYGVPYTPTID------EIRSVSKKCFCHNFITKFSDG--YETVIGP 608
           P  + G + RD I Y +      +      E+  + K+    +++ K S+G  Y   +  
Sbjct: 646 PYFIQGGTFRDQIIYPMSVDRFYEKGHKDRELVRILKEVKL-DYLLKRSEGLSYLDFVAD 704

Query: 609 KGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIIS 668
              +LSGG+KQR+  AR +  +P  L+LDEAT+A+ V+ E   +Y    L K R    IS
Sbjct: 705 WKDILSGGEKQRMNFARIMFHRPKFLVLDEATNAISVDME---DYLFNMLRKCR-FNFIS 760

Query: 669 IAHRLSTIRRSENVI-----------VLGDDGSVVEMGKFKELYASKESKLYKL 711
           I+ R S I+  + ++            LG D ++  +    E   S ESKL +L
Sbjct: 761 ISQRPSLIKYHDYLLEITSGTQWQYQTLGSDEAITSIEAEIE---SLESKLTQL 811

>NCAS0D00580 Chr4 (96350..98611) [2262 bp, 753 aa] {ON} Anc_1.366
          Length = 753

 Score = 67.4 bits (163), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 69/228 (30%), Positives = 108/228 (47%), Gaps = 36/228 (15%)

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           I+ ++VSF Y   +      NL+  +DS   + +VG +G GK+T+  ++++   PT G +
Sbjct: 533 IQLQDVSFGYDENNLLLNDVNLDVQMDS--RIALVGANGCGKTTLLKVMMEELRPTKGFV 590

Query: 533 TIDGQDISKISAKSLRRHLGVVQQ---EPILMSGSIRDNITYGVPYTPTIDEIRSVSKKC 589
           + +G           R  +G   Q   + + ++ S  D ++   P   T +E R      
Sbjct: 591 SRNG-----------RLRIGYFTQHHVDSMDLTTSAVDWMSKAYP-GKTDEEYR------ 632

Query: 590 FCHNFITKFSDGYETVIG-PKGALLSGGQKQRIAIARALIKKPNILILDEA-----TSAL 643
              + +  F  G    +G  K  LLSGGQK R+A A   +  P+IL+LDE      T+ L
Sbjct: 633 ---HHLGSF--GITGTLGLQKMELLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTTGL 687

Query: 644 DVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSV 691
           D   E   N++ G LM S DI+II   H  + I  SEN  V   DG +
Sbjct: 688 DALVESLKNFSGGVLMVSHDISIID--HVCNEIWVSENGTVKRFDGDI 733

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 41/59 (69%), Gaps = 4/59 (6%)

Query: 613 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAH 671
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y L + +K+   T+++++H
Sbjct: 369 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPSTVLTVSH 423

>NDAI0E01240 Chr5 (244737..247430) [2694 bp, 897 aa] {ON} Anc_8.661
          Length = 897

 Score = 67.8 bits (164), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 62/213 (29%), Positives = 105/213 (49%), Gaps = 39/213 (18%)

Query: 496 FTIDSGSNVCVVGPSGRGKSTIASLLLKY---YNPTSGRITIDGQDISKISAKSLRRHLG 552
           F   SGS++ ++GP+  GK++I  ++ +    YN  +G +++  Q+           ++ 
Sbjct: 660 FIHGSGSSLLILGPNSSGKTSIQRIIAEIWPIYNK-NGLLSVPSQE-----------NIF 707

Query: 553 VVQQEPILMS-GSIRDNITY----------GVPYTPTIDEIRSVSKKCFCHNFITKFSDG 601
            + Q P   S G++RD I Y          G+  +  I  ++ V+ K     ++ K S G
Sbjct: 708 CIPQRPYFTSSGTLRDQIIYPMSSDEFFDRGLKDSLLIQILKEVNLK-----YLMKRSKG 762

Query: 602 --YETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLM 659
             Y   +     LLSGG+KQRI  AR L  KP  ++LDEAT+A+  + E   +Y    L 
Sbjct: 763 LTYLDTVADWKDLLSGGEKQRINFARILFHKPRFIVLDEATNAISQDME---DYLFNILK 819

Query: 660 KSRDITIISIAHRLSTIRRSENVIVLGD--DGS 690
           K R    I+I+ R S I+  + ++ + D  DG+
Sbjct: 820 KYR-FNFITISQRPSLIKYHDLLLEISDHNDGT 851

>KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {ON}
           Anc_1.366 YFR009W
          Length = 752

 Score = 67.4 bits (163), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 92/211 (43%), Gaps = 46/211 (21%)

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           I+ ++VSF Y  +  N +  ++N  +   S + +VG +G GK+T+  ++++   P  G +
Sbjct: 532 IQLQDVSFGYDEK--NLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPLQGYV 589

Query: 533 TIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCH 592
           + +G           R  +G   Q  +       D  T  V +                 
Sbjct: 590 SRNG-----------RLRIGYFTQHHV----DSMDLTTSAVDW--------------MSK 620

Query: 593 NFITKFSDGYETVIGPKG----------ALLSGGQKQRIAIARALIKKPNILILDEATSA 642
            F  K  + Y   +G  G           LLSGGQK R+A A   +  P+ILILDE ++ 
Sbjct: 621 TFPGKNDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSNH 680

Query: 643 LDVESEGAI-----NYTLGQLMKSRDITIIS 668
           LD     A+     N++ G LM S DI++I+
Sbjct: 681 LDTTGLDALIDALKNFSGGVLMVSHDISVIN 711

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 40/59 (67%), Gaps = 4/59 (6%)

Query: 613 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAH 671
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y L + +K+   T++ ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATLLVVSH 422

>TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {ON}
           Anc_8.661 YPL147W
          Length = 915

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 63/216 (29%), Positives = 103/216 (47%), Gaps = 34/216 (15%)

Query: 488 NQIFN-NLNFTIDSGSNVCVVGPSGRGKSTIASLLLKY---YNPTSGRITIDGQDISKIS 543
           N I++  L F+   GS++ ++GP+  GKS+I  ++ +    YN  +G ++I  +D     
Sbjct: 669 NSIYDMTLPFSYGPGSSLLILGPNSCGKSSIQRIIAEIWPIYNK-NGLMSIPAED----- 722

Query: 544 AKSLRRHLGVVQQEPIL-MSGSIRDNITYGVPYTPTIDEIRSVSKKCFCH-------NFI 595
                  L  + Q P     G+ RD I Y +      D  R +  K            ++
Sbjct: 723 ------ELMCIPQRPYFSKGGTFRDQIIYPMGSDEFFD--RGLKDKLLVQILADVKLEYL 774

Query: 596 TKFSDGY---ETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAIN 652
            K   G+   + V   K  +LSGG+KQR+  AR L  KP  +ILDEAT+A+ V+ E   +
Sbjct: 775 LKRDKGWSYFDAVFDWKD-VLSGGEKQRMNFARILFHKPRFVILDEATNAISVDME---D 830

Query: 653 YTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDD 688
           Y    L K R    ISI+ R S ++  + ++ + +D
Sbjct: 831 YLFKMLKKYR-FNFISISQRPSLVKYHDLLLEISED 865

>NDAI0H03570 Chr8 complement(872905..875172) [2268 bp, 755 aa] {ON}
           Anc_1.366
          Length = 755

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 96/203 (47%), Gaps = 32/203 (15%)

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           I+ ++VSF Y   S   +  ++N  +   S + +VG +G GK+T+  ++++   PT G +
Sbjct: 535 IQLQDVSFGYDPESL--LLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEELRPTKGFV 592

Query: 533 TIDGQDISKISAKSLRRHLGVVQQ---EPILMSGSIRDNITYGVPYTPTIDEIRSVSKKC 589
           + +G           R  +G   Q   + + ++ S  D ++   P     +  R +    
Sbjct: 593 SRNG-----------RLRIGYFTQHHVDSLDLTKSAVDWMSTAYPGKNDEEYRRHLG--- 638

Query: 590 FCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEA-----TSALD 644
              +F    S G + +      LLSGGQK R+A A   +  P+IL+LDE      TS LD
Sbjct: 639 ---SFGITGSLGLQRM-----QLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTSGLD 690

Query: 645 VESEGAINYTLGQLMKSRDITII 667
              +   N++ G LM S DI+II
Sbjct: 691 ALEDSLKNFSGGVLMVSHDISII 713

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 41/59 (69%), Gaps = 4/59 (6%)

Query: 613 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAH 671
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y L + +K+   T+++++H
Sbjct: 371 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPATVLTVSH 425

>AFR232C Chr6 complement(859612..861435) [1824 bp, 607 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER036C
           (ARB1)
          Length = 607

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 80/187 (42%), Gaps = 45/187 (24%)

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           + F+ +SFSY     N ++  LNF +D  S   +VGP+G GKST+  ++     P  GR+
Sbjct: 390 LAFDEISFSYDGNPENNLYEKLNFGVDMDSRTALVGPNGVGKSTLLKIMTGELTPHGGRV 449

Query: 533 TIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIR-SVSKKCFC 591
           +               RH                 ++  GV    + D++  + S   F 
Sbjct: 450 S---------------RHT----------------HVKLGVYSQHSQDQLDLTKSALEFV 478

Query: 592 HNFITKFSDGYETVIGPKG-------------ALLSGGQKQRIAIARALIKKPNILILDE 638
            +     S+ ++   G  G             A LS GQ+ R+  A   +++PN+L+LDE
Sbjct: 479 RDKYAHISEDFQFWRGQLGRYGLTGEAQTAQMATLSEGQRSRVVFALLALEQPNVLLLDE 538

Query: 639 ATSALDV 645
            T+ LD+
Sbjct: 539 PTNGLDI 545

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 41/66 (62%), Gaps = 4/66 (6%)

Query: 606 IGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDIT 665
           I  K   +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+       L + +K  D T
Sbjct: 217 INRKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRT 272

Query: 666 IISIAH 671
           ++ ++H
Sbjct: 273 LVLVSH 278

>Kpol_1043.43 s1043 complement(86642..88900) [2259 bp, 752 aa] {ON}
           complement(86642..88900) [2259 nt, 753 aa]
          Length = 752

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 110/229 (48%), Gaps = 34/229 (14%)

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           I+ ++VSF Y  +  N +  ++N  +   S + +VG +G GK+T+  ++++   P  G +
Sbjct: 532 IQLQDVSFGYNEK--NLLLADVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPLKGYV 589

Query: 533 TIDGQDISKISAKSLRRHLGVVQQ---EPILMSGSIRDNITYGVPYTPTIDEIRSVSKKC 589
           + +G           R  +G   Q   + + ++ S  D ++   P   T +E R    + 
Sbjct: 590 SQNG-----------RLRIGYFTQHHVDSLDLTKSAVDWMSTAYP-GKTDEEYR----RH 633

Query: 590 FCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEG 649
                IT       ++   K  LLSGGQK R+A A   +  P+ILILDE ++ LD     
Sbjct: 634 LGAFGITG------SLSLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSNHLDTSGID 687

Query: 650 AI-----NYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVE 693
           A+      +T G LM S DI++IS  +  + I  SEN  V   DG++ +
Sbjct: 688 ALVDAMKKFTGGILMVSHDISVIS--NVCNEIWVSENGTVKRFDGTIYD 734

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 58/97 (59%), Gaps = 6/97 (6%)

Query: 613 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHR 672
            SGG + R+++ARAL  +P++L+LDE T+ LDV S   I Y L + +K+   T+++++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPTNMLDVPS---IAY-LSEYLKTYPSTVLTVSHD 423

Query: 673 LSTIRR-SENVIVLGDDGSVVEMGK-FKELYASKESK 707
            + +   + ++I   ++      G+ F   YA+KE +
Sbjct: 424 RAFLNEVATDIIYQHNERLDYYRGQDFDSFYATKEER 460

>KNAG0I00530 Chr9 (88076..91219) [3144 bp, 1047 aa] {ON} Anc_1.427
           YCR011C
          Length = 1047

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 70/270 (25%), Positives = 122/270 (45%), Gaps = 45/270 (16%)

Query: 457 SIYATKGVPYVPGKGE----------IKFENVSFSYP----TRSANQIFNNLNFTIDSGS 502
           S+Y+T G       GE          + FEN+S+  P    ++   ++ N++   +  G 
Sbjct: 370 SLYSTSGSDNSGDDGENFLRAQVLTTLSFENISYDVPGAKDSKIEEKVLNSITGMVKPGQ 429

Query: 503 NVCVVGPSGRGKSTIASLLL--KYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQ---- 556
            + ++G SG GK+T+  +L   +      G I ++G  I     K   + +G V Q    
Sbjct: 430 MLAIMGGSGAGKTTLLDILAMKRKTGRVQGTIAVNGHSILN---KLYSKMIGFVDQDDFL 486

Query: 557 -------EPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIG-- 607
                  E +L S  +R  +   +P+T     +  V ++        +  D  + +IG  
Sbjct: 487 LPTLTVYETVLNSALLR--LPRSMPFTAKRKRVNRVLEE-------LRIMDIKDRIIGND 537

Query: 608 -PKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDIT- 665
             +G  +SGG+K+R++IA  L+  P IL LDE TS LD  +   +   L +L K+ + T 
Sbjct: 538 FERG--ISGGEKRRVSIACELVTSPAILFLDEPTSGLDANNANNVIECLVRLAKNYNRTL 595

Query: 666 IISIAHRLSTIRRSENVIVLGDDGSVVEMG 695
           ++SI    S I    + +VL  DG ++  G
Sbjct: 596 VLSIHQPRSNIFNLFDKLVLLSDGEMIYSG 625

>Skud_16.135 Chr16 (244860..247472) [2613 bp, 870 aa] {ON} YPL147W
           (REAL)
          Length = 870

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/215 (27%), Positives = 103/215 (47%), Gaps = 33/215 (15%)

Query: 487 ANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPT---SGRITIDGQDISKIS 543
           AN I   L F   SGS++ ++GP+  GKS+I  ++ + + P    +G ++I  ++     
Sbjct: 626 ANDI--KLPFLQGSGSSLLILGPNSCGKSSIQRIIAEIW-PVYNKNGLLSIPSEN----- 677

Query: 544 AKSLRRHLGVVQQEPIL-MSGSIRDNITYGVPYTPTIDEIRSVSKKCFCH-------NFI 595
                 ++  + Q+P     G++RD I Y +      D  R    K           +++
Sbjct: 678 ------NIFCIPQKPYFSKGGTLRDQIIYPMSSDEFFD--RGFKDKELVQILVEVRLDYL 729

Query: 596 TKFSDG--YETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINY 653
            K   G  Y   +     LLSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E     
Sbjct: 730 LKRGVGLTYLDAVADWKDLLSGGEKQRVNFARVMFHKPLYVVLDEATNAISVDMEDY--- 786

Query: 654 TLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDD 688
            L  L+K      ISI+ R + I+  E ++ +G++
Sbjct: 787 -LFNLLKRYRFNFISISQRPTLIKYHEMLLEIGEN 820

>TBLA0I03330 Chr9 complement(806242..808074) [1833 bp, 610 aa] {ON}
           Anc_3.534 YER036C
          Length = 610

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 107/241 (44%), Gaps = 54/241 (22%)

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           + F+++SFSY  +  N ++ +LNF +D  S + +VGP+G GKST+  ++       SGR+
Sbjct: 393 LAFDDISFSYDGKPENNLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELMSQSGRV 452

Query: 533 TIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIR-SVSKKCFC 591
           +               RH                 ++  GV    + D++  + S   F 
Sbjct: 453 S---------------RHT----------------HVKLGVYSQHSQDQLDLTKSALEFV 481

Query: 592 HNFITKFSDGYETVIGPKG-------------ALLSGGQKQRIAIARALIKKPNILILDE 638
            +  +  S  ++   G  G               LS GQ+ R+  A   +++PN+L+LDE
Sbjct: 482 RDKYSNISQDFQYWRGQLGRYGLTGEAQTVLMGTLSEGQRSRVVFALLALEQPNVLLLDE 541

Query: 639 ATSALDVES----EGAIN-YTLGQLMKSRDITIIS-IAHRLSTIRRSENVIVLGDDGSVV 692
            T+ LD+ +      AIN +  G ++ S D  ++  IA  +  +   E+      DGS++
Sbjct: 542 PTNGLDIPTIDSLADAINEFNGGVVVVSHDFRLLDKIAKDIFVV---EHKTATRWDGSIL 598

Query: 693 E 693
           E
Sbjct: 599 E 599

 Score = 48.1 bits (113), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 42/68 (61%), Gaps = 4/68 (5%)

Query: 604 TVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRD 663
           T I  K   +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+       L + +K  D
Sbjct: 218 TTILKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFD 273

Query: 664 ITIISIAH 671
            T++ ++H
Sbjct: 274 RTLVLVSH 281

>AEL032W Chr5 (572196..574457) [2262 bp, 753 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR009W (GCN20)
          Length = 753

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 109/234 (46%), Gaps = 36/234 (15%)

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           I+ ++VSF Y    +  +  ++N  +   S + +VG +G GK+T+  ++++   P +G +
Sbjct: 533 IQLQDVSFGYD--ESQLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPITGHV 590

Query: 533 TIDGQDISKISAKSLRRHLGVVQQEPIL---MSGSIRDNITYGVPYTPTIDEIRSVSKKC 589
           +           ++ R  +G   Q  I    ++ S  D ++   P   T +E R      
Sbjct: 591 S-----------RNPRLRIGYFTQHHIDSMDLNASAVDWMSKTFP-GKTDEEYR------ 632

Query: 590 FCHNFITKFSDGYETVIG-PKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESE 648
                +  F  G    +G  K  LLSGGQK R+A A   +  P+ILILDE ++ LD    
Sbjct: 633 ---RHLGAF--GITGSLGLQKMQLLSGGQKSRVAFAALCLNSPHILILDEPSNHLDTAGL 687

Query: 649 GAI-----NYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKF 697
            A+     N++ G LM S DI++I        I  SE+  V   DG++ +  K+
Sbjct: 688 DALVQALKNFSGGVLMVSHDISVIDSV--CDEIWVSESGTVKRFDGNIHDYKKY 739

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 57/97 (58%), Gaps = 6/97 (6%)

Query: 613 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHR 672
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y L + +K+   T++ ++H 
Sbjct: 369 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPATVLVVSHD 424

Query: 673 LSTIRR-SENVIVLGDDGSVVEMGK-FKELYASKESK 707
            S +   + ++I   ++      G+ F   YA+KE +
Sbjct: 425 RSFLNEVATDIIYQHNERLDYYRGQDFDSFYATKEER 461

>Kpol_1049.23 s1049 complement(67726..68058) [333 bp, 110 aa] {ON}
           complement(67726..68058) [333 nt, 111 aa]
          Length = 110

 Score = 59.7 bits (143), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 33/94 (35%), Positives = 57/94 (60%), Gaps = 3/94 (3%)

Query: 621 IAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSE 680
           I +ARAL++   IL++DEAT+++D E++  +  T+    + +D+TI++IAHRL TI   +
Sbjct: 2   ICLARALLRSTKILLIDEATASIDYEADAKLQETIQ--TEFQDVTIVAIAHRLQTIIDYD 59

Query: 681 NVIVLGDDGSVVEMGKFKELYASKESKLYKLLNE 714
            ++VL D G V+E      L  ++    Y +  E
Sbjct: 60  KILVL-DAGQVIEYDHPYTLLKNESGHFYDICKE 92

>Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {ON}
           YPL147W (PXA1) - ABC family long-chain fatty acid
           transporter [contig 67] FULL
          Length = 831

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 61/253 (24%), Positives = 114/253 (45%), Gaps = 48/253 (18%)

Query: 473 IKFENVSFSYPT---RSANQIFNNLNFTI-----------DS-------------GSNVC 505
           I+FEN+    P+   R   ++ N L F +           DS             GS++ 
Sbjct: 546 IRFENIDVVIPSKFGRDGIKLINRLRFQVPPVIGLDNNNSDSQINLSQKLMFKGPGSSML 605

Query: 506 VVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSI 565
           ++GP+G GK++I  ++ + + P   +  +       +S  + R  + + Q+   +  G+ 
Sbjct: 606 ILGPNGSGKTSIQRIIAEIW-PIYNKNGL-------LSVPAERELICIPQKPYFIQGGTF 657

Query: 566 RDNITYGVPYTPTID------EIRSVSKKCFCHNFITKFSDGYETV--IGPKGALLSGGQ 617
           R+ I Y +      D      E+  V K+     ++ K   G+  +  +     +LSGG+
Sbjct: 658 REQIIYPMSADQYFDLGYRDKELVHVLKEVKLE-YLLKRDKGWRYLDAVAEWKDVLSGGE 716

Query: 618 KQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIR 677
           +QR+  AR +  KP  ++LDEAT+A+  + E   +Y    L + R    I+I+ R S I+
Sbjct: 717 RQRMNFARIMFHKPKFVVLDEATNAISADME---DYLFNMLKRYR-FNFITISQRPSLIK 772

Query: 678 RSENVIVLGDDGS 690
             +  + +G D S
Sbjct: 773 YHDLALEIGADES 785

>SAKL0H21010g Chr8 (1835185..1839528) [4344 bp, 1447 aa] {ON} similar
            to uniprot|P32568 Saccharomyces cerevisiae YDR011W SNQ2
            ABC transporter
          Length = 1447

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 120/238 (50%), Gaps = 21/238 (8%)

Query: 470  KGEIKFENVSFSYPTR-SANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYN-- 526
            KG   +++V +  P + S  ++ + ++  +  G    ++G SG GK+T+ ++L +  +  
Sbjct: 799  KGVFMWKDVDYVIPYKGSEKKLLDKVSGFVKPGLT-ALMGASGAGKTTLLNVLAQRMDFG 857

Query: 527  -PTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSG-SIRDNITYGVPY-----TPTI 579
              +SG I +D + + +      +R +G VQQ+ I     ++R+++ +          P  
Sbjct: 858  IVSSGEILVDAKPVDR----KFKRSVGYVQQQDIHTQELTVRESLQFSARLRRPDSVPDA 913

Query: 580  DEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILI-LDE 638
            +++  V K       +    D  + V+G  G  L+  Q+++++I   L+ KP +L+ LDE
Sbjct: 914  EKMEYVEKIIV----VLGMQDYSDAVVGEAGFGLNVEQRKKLSIGVELVAKPTLLLFLDE 969

Query: 639  ATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRS-ENVIVLGDDGSVVEMG 695
             TS LD +S  AI   L +L ++    + +I    +T+  S + +++L D GSVV  G
Sbjct: 970  PTSGLDSQSSWAILQLLRRLAEAGQAILCTIHQPSATLFESFDRLLLLKDGGSVVYWG 1027

>CAGL0C02343g Chr3 (236112..236391,236790..238672) [2163 bp, 720 aa]
           {ON} highly similar to uniprot|P40024 Saccharomyces
           cerevisiae YER036c ARB1
          Length = 720

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 54/245 (22%), Positives = 108/245 (44%), Gaps = 56/245 (22%)

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           + F+++SF+Y     N ++ +LNF +D  S   +VGP+G GKST+  ++     P SGR+
Sbjct: 503 LAFDDISFAYDGNPENNLYEHLNFGVDMDSRTALVGPNGVGKSTLLKIMTGELMPQSGRV 562

Query: 533 --------------TIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPT 578
                         + D  D++K + + +R     + Q+     G +     YG+     
Sbjct: 563 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQYWRGQLG---RYGLT---- 615

Query: 579 IDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDE 638
                                D  +  +G     LS GQ+ R+  A   ++ PN+L+LDE
Sbjct: 616 --------------------GDAQKVQMG----TLSEGQRSRVVFALLALENPNVLLLDE 651

Query: 639 ATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRR-SENVIVLGD------DGSV 691
            T+ LD+ +  ++   + +        ++ ++H    + + ++++ V+ D      DGS+
Sbjct: 652 PTNGLDIPTIDSLADAINEFNGG----VVVVSHDFRLLDKIAKDIFVVEDKTATRWDGSI 707

Query: 692 VEMGK 696
           ++  K
Sbjct: 708 LDYKK 712

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 613 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAH 671
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+       L + +K  D T++ ++H
Sbjct: 337 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 391

>Smik_7.313 Chr7 (524077..526335) [2259 bp, 752 aa] {ON} YFR009W
           (REAL)
          Length = 752

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 97/204 (47%), Gaps = 34/204 (16%)

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           I+ ++VSF Y  +  N +  ++N  +   S + +VG +G GK+T+  ++++   P  G +
Sbjct: 532 IQLQDVSFGYDEK--NLLLKDVNLDVQMDSRIALVGANGCGKTTLLKIMMEQLRPLKGFV 589

Query: 533 TIDGQDISKISAKSLRRHLGVVQQ---EPILMSGSIRDNITYGVPYTPTIDEIRSVSKKC 589
           +           ++ R  +G   Q   + + ++ S  D ++   P   T +E R      
Sbjct: 590 S-----------RNPRLRIGYFTQHHVDSMDLTTSAVDWMSKSFP-GKTDEEYR------ 631

Query: 590 FCHNFITKFSDGYETVIG-PKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESE 648
                +  F  G    +G  K  LLSGGQK R+A A   +  P+IL+LDE ++ LD    
Sbjct: 632 ---RHLGSF--GITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTTGL 686

Query: 649 GAI-----NYTLGQLMKSRDITII 667
            A+     N+  G LM S DI++I
Sbjct: 687 DALVDALKNFNGGVLMVSHDISVI 710

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 41/59 (69%), Gaps = 4/59 (6%)

Query: 613 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAH 671
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y L + +K+   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPNTVLTVSH 422

>KNAG0B00460 Chr2 (76565..78547) [1983 bp, 660 aa] {ON} Anc_3.534
           YER036C
          Length = 660

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 86/177 (48%), Gaps = 25/177 (14%)

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           + F+N+SF+Y  +  + ++ NL+F +D  S + +VGP+G GKST+  ++       +GR+
Sbjct: 443 LAFDNISFAYDGKKEHNLYENLDFGVDMDSRIALVGPNGVGKSTLLKIMTGELMAQTGRV 502

Query: 533 TIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKC-FC 591
           +           +     LGV  Q     S    D     + +    D+  ++S+   + 
Sbjct: 503 S-----------RHTHVKLGVYSQH----SQDQLDLTKSALEFVR--DKYSNISQDFQYW 545

Query: 592 HNFITKF---SDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDV 645
              + +F    +G    +G     LS GQ+ R+  A   +++PN+L+LDE T+ LD+
Sbjct: 546 RGQLGRFGLTGEGQTVQMG----TLSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 598

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 90/210 (42%), Gaps = 19/210 (9%)

Query: 472 EIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGR 531
           ++K  +VS  +       +  +    ++ G    ++G +G GKST    L     P    
Sbjct: 131 DVKLTSVSLLF---HGKVLIQDSTLELNYGRRYGLLGENGCGKSTFLKALATREYPIPEH 187

Query: 532 ITI----DGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSK 587
           I I    +  + S+ SA  L   +   Q E   +   +   I    P  P +D I     
Sbjct: 188 IDIYLLDEPAEPSEWSA--LEYVVREAQAELKRLEDLVEKYIIEEGPECPLLDPIYERMD 245

Query: 588 KCFCHNFITK-----FSDGYET-VIGPKGALLSGGQKQRIAIARALIKKPNILILDEATS 641
                 F ++        G+ +  I  K   +SGG K R+A+A+AL  KP +L+LD+ T+
Sbjct: 246 SLDPDTFESRAAVILIGLGFNSKTILKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTA 305

Query: 642 ALDVESEGAINYTLGQLMKSRDITIISIAH 671
            LD+E+       L + +K  D T++ ++H
Sbjct: 306 HLDLEA----CVWLEEYLKRFDRTLVLVSH 331

>ZYRO0A04114g Chr1 complement(328582..333138) [4557 bp, 1518 aa] {ON}
            similar to uniprot|P32568 Saccharomyces cerevisiae
            YDR011W SNQ2 ABC transporter
          Length = 1518

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 57/244 (23%), Positives = 119/244 (48%), Gaps = 25/244 (10%)

Query: 470  KGEIKFENVSFSYPTRSANQ-IFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYN-- 526
            KG   ++N+ +  P +   + + +N+   +  G+   ++G SG GK+T+ + L K  N  
Sbjct: 869  KGIFIWKNICYVIPYKGGERTLLDNVTGYVAPGTMTALMGESGAGKTTLLNTLAKRVNVG 928

Query: 527  PTSGRITIDGQDISKISAKSLRRHLGVVQQEPI-LMSGSIRDNITY--------GVPYTP 577
              +G + I+G+ +      S  R  G VQQ+ I +   ++R+++ +         +P   
Sbjct: 929  VVTGDMLINGKPVD----SSFERRTGYVQQQDIHIAEMTVRESLIFSARLRRPQSIPDAE 984

Query: 578  TIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILI-L 636
             + +  +V K       +    +  + ++G  GA L+  Q+++++I   L+ KP++L+ L
Sbjct: 985  KVADAETVMK-------LLDMEEYADALVGGLGAGLNVEQRKKLSIGVELVSKPDLLLFL 1037

Query: 637  DEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTI-RRSENVIVLGDDGSVVEMG 695
            DE TS LD +S  AI   L ++ ++    + +I    +T+  + + +++L   G  V  G
Sbjct: 1038 DEPTSGLDSQSSWAIVQLLKRISRAGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFG 1097

Query: 696  KFKE 699
               E
Sbjct: 1098 DIGE 1101

>KAFR0J02700 Chr10 complement(515978..517804) [1827 bp, 608 aa] {ON}
           Anc_3.534 YER036C
          Length = 608

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 84/174 (48%), Gaps = 19/174 (10%)

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           + F+N+SF+Y     + ++ NL+F +D  S + +VGP+G GKST+  ++       +GR+
Sbjct: 391 LAFDNISFAYDGNPEHNLYENLDFGVDMDSRIALVGPNGVGKSTLLKIMTGQLMAQAGRV 450

Query: 533 TIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKC-FC 591
           +           +     LGV  Q     S    D     + +    D+  S+S+   + 
Sbjct: 451 S-----------RHTHVKLGVYSQH----SQDQLDLTKSALEFVR--DKYSSISQDFQYW 493

Query: 592 HNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDV 645
              + ++    E+     G  LS GQ+ R+  A   +++PN+L+LDE T+ LD+
Sbjct: 494 RGQLGRYGLTGESQTVQMGT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 546

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 613 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAH 671
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+       L + +K  D T++ ++H
Sbjct: 225 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 279

>KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.661
           YPL147W
          Length = 871

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 69/250 (27%), Positives = 117/250 (46%), Gaps = 38/250 (15%)

Query: 464 VPYVPGKGEIKF-ENVSFSYP---------TRSANQI--FNNLNFTIDSG--SNVCVVGP 509
           +P V GK  IK  + ++F  P         T S   I   +N+     SG  S++ ++GP
Sbjct: 589 IPSVRGKSGIKLIKKLTFQIPPHLDQLSSKTSSLQDITSMSNIPLPFLSGQASSLLILGP 648

Query: 510 SGRGKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNI 569
           +G GKS+I  ++ + + P   +  +    +SK  + SL   L + Q+      G+ RD I
Sbjct: 649 NGCGKSSIQRIIAEIW-PIYNKNGL----LSKPDSSSL---LCIPQKPYFTRGGTFRDQI 700

Query: 570 TYGVPYTPTIDEIRSVSKKCFCH-------NFITKFSDGYETV--IGPKGALLSGGQKQR 620
            Y +      D       K           +++ K + G+  +  +     +LSGG+KQR
Sbjct: 701 IYPMSSDEFFDN--GFKDKVLVWILSEVHLDYLLKRAPGWSYLDEVTEWKDVLSGGEKQR 758

Query: 621 IAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSE 680
           +  AR L  KP  ++LDEAT+A+  + E   +Y    L K R  + I+I+ R S I+  +
Sbjct: 759 MNFARILFHKPKFIVLDEATNAISADME---DYLFNMLKKFR-FSFITISQRPSLIKYHD 814

Query: 681 NVIVLGD-DG 689
            ++ + D DG
Sbjct: 815 MLLEIADRDG 824

>YFR009W Chr6 (162488..164746) [2259 bp, 752 aa] {ON}  GCN20Positive
           regulator of the Gcn2p kinase activity, forms a complex
           with Gcn1p; proposed to stimulate Gcn2p activation by an
           uncharged tRNA
          Length = 752

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 104/226 (46%), Gaps = 40/226 (17%)

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           I+ ++VSF Y     N +  ++N  +   S + +VG +G GK+T+  ++++   P  G +
Sbjct: 532 IQLQDVSFGYDEN--NLLLKDVNLDVQMDSRIALVGANGCGKTTLLKIMMEQLRPLKGFV 589

Query: 533 TIDGQDISKISAKSLRRHLGVVQQ---EPILMSGSIRDNITYGVPYTPTIDEIRSVSKKC 589
           +           ++ R  +G   Q   + + ++ S  D ++   P   T +E R      
Sbjct: 590 S-----------RNPRLRIGYFTQHHVDSMDLTTSAVDWMSKSFP-GKTDEEYR------ 631

Query: 590 FCHNFITKFSDGYETVIG-PKGALLSGGQKQRIAIARALIKKPNILILDEA-----TSAL 643
                +  F  G    +G  K  LLSGGQK R+A A   +  P+IL+LDE      T+ L
Sbjct: 632 ---RHLGSF--GITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTTGL 686

Query: 644 DVESEGAINYTLGQLMKSRDITII-SIAHRL-----STIRRSENVI 683
           D   E   N+  G LM S DI++I S+   +      T++R E  I
Sbjct: 687 DALVEALKNFNGGVLMVSHDISVIDSVCKEIWVSEQGTVKRFEGTI 732

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 41/59 (69%), Gaps = 4/59 (6%)

Query: 613 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAH 671
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y L + +K+   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPNTVLTVSH 422

>TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]
           {ON} Anc_1.427 YCR011C
          Length = 1119

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 64/245 (26%), Positives = 122/245 (49%), Gaps = 27/245 (11%)

Query: 473 IKFENVSFSYPTRSANQ----IFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLL--KYYN 526
           + FEN+S++ P+ S N     I  N++  +  G  + ++G SG GK+T+  +L   +   
Sbjct: 433 LSFENISYNVPSISDNNSERDILKNVSGIVKPGEIMAILGGSGAGKTTLLDILAFKRKSG 492

Query: 527 PTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSG-----SIRDNITYGVPYTPTI-- 579
             SG I I+G+++S+   + + + +G V Q+  L        ++ ++    +P + T   
Sbjct: 493 HVSGDIKINGKNVSR---EIISKMIGFVDQDDFLFPTLTVYEAVLNSALLRLPNSMTFYQ 549

Query: 580 --DEIRSVSKKCFCHNFITKF-SDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILIL 636
               +  V ++   +N   +   D +E     +G  +SGG+K+R++IA  L+  P IL L
Sbjct: 550 KQQRVFQVLEELRIYNIKDRLIGDDFE-----RG--ISGGEKRRVSIACELVTSPLILFL 602

Query: 637 DEATSALDVESEGAINYTLGQLMKSRDITIISIAHR-LSTIRRSENVIVLGDDGSVVEMG 695
           DE TS LD  +   +   L +L K+ + T++   H+  S I    + +VL   G +V  G
Sbjct: 603 DEPTSGLDSNNANNVVECLVRLAKNYNRTLVLTIHQPRSNIFHLFSKLVLLSSGEMVYSG 662

Query: 696 KFKEL 700
           + + +
Sbjct: 663 EIRRV 667

>KLLA0A10857g Chr1 complement(941784..944042) [2259 bp, 752 aa] {ON}
           highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 64.7 bits (156), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 55/205 (26%), Positives = 101/205 (49%), Gaps = 34/205 (16%)

Query: 473 IKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRI 532
           I+ ++VSFSY  + ++ +  ++N  +   S + +VG +G GK+T+  ++++   PT G +
Sbjct: 532 IQLQDVSFSY--KESDPLLTDVNLDVQMDSRISLVGANGCGKTTLLKVMMEQLRPTKGFV 589

Query: 533 TIDGQDISKISAKSLRRHLGVVQQ---EPILMSGSIRDNITYGVPYTPTIDEIRSVSKKC 589
           +           ++ R  +G   Q   + + ++ S  D ++   P   T +E R      
Sbjct: 590 S-----------RNPRLRIGYFTQHHVDSMDLNQSAVDWMSTAFP-GKTDEEYR------ 631

Query: 590 FCHNFITKFSDGYETVIG-PKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESE 648
                +  F  G    +G  +  LLSGGQK R+A A   +  P+IL+LDE ++ LD    
Sbjct: 632 ---RHLGAF--GISGSLGIQRMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTAGL 686

Query: 649 GAI-----NYTLGQLMKSRDITIIS 668
            A+     ++  G LM S DI++I+
Sbjct: 687 DALVDALKSFNGGVLMVSHDISVIN 711

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 57/97 (58%), Gaps = 6/97 (6%)

Query: 613 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHR 672
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y L + +K+   T++ ++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPATVLVVSHD 423

Query: 673 LSTIRR-SENVIVLGDDGSVVEMGK-FKELYASKESK 707
            + +   + ++I   ++      G+ F   YA+KE +
Sbjct: 424 RAFLNEVATDIIYQHNERLDYYRGQDFDTFYATKEER 460

>ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} similar
            to uniprot|Q04182 Saccharomyces cerevisiae YDR406W PDR15
            ATP binding cassette (ABC) transporter of the plasma
            membrane general stress response factor implicated in
            cellular detoxification target of Pdr1p Pdr3p and Pdr8p
            transcription regulators promoter contains a PDR
            responsive element
          Length = 1498

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 111/224 (49%), Gaps = 22/224 (9%)

Query: 485  RSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRIT----IDGQDIS 540
            R + +I NN++  +  G+   ++G SG GK+T+   L +    T+G IT    +DG    
Sbjct: 866  RESKRILNNIDGWVKPGTLTALMGASGAGKTTLLDCLAE--RVTTGVITGGIFVDG---- 919

Query: 541  KISAKSLRRHLGVVQQEPI-LMSGSIRDNITYGV----PYTPTIDEIRSVSKKCFCHNFI 595
            K+  +S  R +G  QQ+ + L + ++R+++ +      P +    E R   ++      +
Sbjct: 920  KLRDESFPRSIGYCQQQDLHLKTATVRESLLFSAMLRQPKSVPASEKRKYVEEVINVLEM 979

Query: 596  TKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILI-LDEATSALDVESEGAINYT 654
              ++D    ++G  G  L+  Q++R+ I   L+ KP +LI LDE TS LD ++  +I   
Sbjct: 980  EPYADA---IVGVAGEGLNVEQRKRLTIGVELVAKPKLLIFLDEPTSGLDSQTAWSICQL 1036

Query: 655  LGQLMKSRDITIISIAHRLST--IRRSENVIVLGDDGSVVEMGK 696
            + +L  +R   I+   H+ S   I+  + ++ L   G  V  G+
Sbjct: 1037 IRKL-ANRGQAILCTIHQPSAVLIQEFDRLLFLQKGGETVYFGE 1079

>TPHA0O01000 Chr15 (185595..188630) [3036 bp, 1011 aa] {ON}
           Anc_1.427 YCR011C
          Length = 1011

 Score = 64.7 bits (156), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 81/300 (27%), Positives = 138/300 (46%), Gaps = 59/300 (19%)

Query: 473 IKFENVSFSYPT---------RSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLL- 522
           + FENVS+S            +S  +I  N++     G  + ++G SG GK+T+