Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0D06930g1.319ON69069036070.0
KLTH0H10692g1.319ON69170011711e-151
Suva_6.1371.319ON71872111181e-142
YJL061W (NUP82)1.319ON71372311011e-140
ZYRO0G20680g1.319ON69270310831e-138
TDEL0D018801.319ON69170710611e-134
Kwal_14.25801.319ON68770210581e-134
Smik_10.1791.319ON71371810401e-131
NCAS0A092101.319ON71071510401e-131
KAFR0A017201.319ON71671910151e-127
Skud_10.1581.319ON71671210131e-127
Kpol_1035.241.319ON7177249581e-119
NDAI0G057501.319ON7347239541e-118
AEL168C1.319ON6736949481e-118
Ecym_62901.319ON6716989081e-112
TBLA0F013101.319ON7427208911e-108
KNAG0C058401.319ON7477128212e-98
TPHA0O014601.319ON7217228113e-97
CAGL0J05214g1.319ON7166836671e-76
KLLA0F01661g1.319ON6877125311e-57
KLLA0A08800g4.123ON439114820.27
ZYRO0D08382g6.333ON1024108790.73
KLLA0B05885g4.171ON65877761.4
KAFR0L005607.154ON1256109752.6
ZYRO0G06600g5.702ON1820105743.1
Ecym_26257.101ON1097146733.8
ZYRO0G13838g8.828ON31569723.9
Kpol_499.197.137ON352116715.3
NDAI0A066303.167ON59234707.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0D06930g
         (690 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0D06930g Chr4 complement(573700..575772) [2073 bp, 690 aa] {...  1394   0.0  
KLTH0H10692g Chr8 complement(921787..923862) [2076 bp, 691 aa] {...   455   e-151
Suva_6.137 Chr6 complement(228953..231109) [2157 bp, 718 aa] {ON...   435   e-142
YJL061W Chr10 (320016..322157) [2142 bp, 713 aa] {ON}  NUP82Link...   428   e-140
ZYRO0G20680g Chr7 complement(1703031..1705109) [2079 bp, 692 aa]...   421   e-138
TDEL0D01880 Chr4 (366715..368790) [2076 bp, 691 aa] {ON} Anc_1.3...   413   e-134
Kwal_14.2580 s14 complement(821497..823560) [2064 bp, 687 aa] {O...   412   e-134
Smik_10.179 Chr10 (311844..313985) [2142 bp, 713 aa] {ON} YJL061...   405   e-131
NCAS0A09210 Chr1 complement(1820713..1822845) [2133 bp, 710 aa] ...   405   e-131
KAFR0A01720 Chr1 complement(349779..351929) [2151 bp, 716 aa] {O...   395   e-127
Skud_10.158 Chr10 complement(296754..298904) [2151 bp, 716 aa] {...   394   e-127
Kpol_1035.24 s1035 complement(57897..60050) [2154 bp, 717 aa] {O...   373   e-119
NDAI0G05750 Chr7 (1424856..1427060) [2205 bp, 734 aa] {ON} Anc_1...   372   e-118
AEL168C Chr5 complement(320121..322142) [2022 bp, 673 aa] {ON} S...   369   e-118
Ecym_6290 Chr6 (543547..545562) [2016 bp, 671 aa] {ON} similar t...   354   e-112
TBLA0F01310 Chr6 complement(329569..331797) [2229 bp, 742 aa] {O...   347   e-108
KNAG0C05840 Chr3 (1135516..1137759) [2244 bp, 747 aa] {ON} Anc_1...   320   2e-98
TPHA0O01460 Chr15 complement(293395..295560) [2166 bp, 721 aa] {...   317   3e-97
CAGL0J05214g Chr10 complement(501919..504069) [2151 bp, 716 aa] ...   261   1e-76
KLLA0F01661g Chr6 complement(156609..158672) [2064 bp, 687 aa] {...   209   1e-57
KLLA0A08800g Chr1 (770989..772308) [1320 bp, 439 aa] {ON} simila...    36   0.27 
ZYRO0D08382g Chr4 (724961..728035) [3075 bp, 1024 aa] {ON} simil...    35   0.73 
KLLA0B05885g Chr2 complement(530762..532738) [1977 bp, 658 aa] {...    34   1.4  
KAFR0L00560 Chr12 (102072..105842) [3771 bp, 1256 aa] {ON} Anc_7...    33   2.6  
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...    33   3.1  
Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} simila...    33   3.8  
ZYRO0G13838g Chr7 (1107010..1107957) [948 bp, 315 aa] {ON} weakl...    32   3.9  
Kpol_499.19 s499 complement(58176..59234) [1059 bp, 352 aa] {ON}...    32   5.3  
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    32   7.9  

>SAKL0D06930g Chr4 complement(573700..575772) [2073 bp, 690 aa] {ON}
           similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 690

 Score = 1394 bits (3607), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 677/690 (98%), Positives = 677/690 (98%)

Query: 1   MSAEDHPIFQNISVGKESYPKKLLTTQDGCRVVVIQGDTIRLCSSGNSQYQIIECGINTV 60
           MSAEDHPIFQNISVGKESYPKKLLTTQDGCRVVVIQGDTIRLCSSGNSQYQIIECGINTV
Sbjct: 1   MSAEDHPIFQNISVGKESYPKKLLTTQDGCRVVVIQGDTIRLCSSGNSQYQIIECGINTV 60

Query: 61  AGAALNNSGTLLCAYNETELQVIVLPSPFVSSHGGILKPHTYNITVKSPIKQVQWHPRGK 120
           AGAALNNSGTLLCAYNETELQVIVLPSPFVSSHGGILKPHTYNITVKSPIKQVQWHPRGK
Sbjct: 61  AGAALNNSGTLLCAYNETELQVIVLPSPFVSSHGGILKPHTYNITVKSPIKQVQWHPRGK 120

Query: 121 LDSVPVVLHKDDTIAMYELYNEDFQQPTAVLNTMQNQLGVTSHITDIESMCFSKDGLALY 180
           LDSVPVVLHKDDTIAMYELYNEDFQQPTAVLNTMQNQLGVTSHITDIESMCFSKDGLALY
Sbjct: 121 LDSVPVVLHKDDTIAMYELYNEDFQQPTAVLNTMQNQLGVTSHITDIESMCFSKDGLALY 180

Query: 181 LLNSSEGGDVYALYPFLPSVLVIPEQHLEMCFYKSCINYENLSSDDSPTVKRNVIKQLQF 240
           LLNSSEGGDVYALYPFLPSVLVIPEQHLEMCFYKSCINYENLSSDDSPTVKRNVIKQLQF
Sbjct: 181 LLNSSEGGDVYALYPFLPSVLVIPEQHLEMCFYKSCINYENLSSDDSPTVKRNVIKQLQF 240

Query: 241 VSRLHKQYKSETVDKARNGDLVFNIQESYRNAKIQGPFTINPFAEKLYSATATQITTMPI 300
           VSRLHKQYKSETVDKARNGDLVFNIQESYRNAKIQGPFTINPFAEKLYSATATQITTMPI
Sbjct: 241 VSRLHKQYKSETVDKARNGDLVFNIQESYRNAKIQGPFTINPFAEKLYSATATQITTMPI 300

Query: 301 DEFNELILVYFDNGTILQCFQDLDLSMCWEEIDXXXXXXXXXXXXXDILSGQIICLTPHK 360
           DEFNELILVYFDNGTILQCFQDLDLSMCWEEID             DILSGQIICLTPHK
Sbjct: 301 DEFNELILVYFDNGTILQCFQDLDLSMCWEEIDSSSNNSLVVLESLDILSGQIICLTPHK 360

Query: 361 FAVLGPKSFVVDSSEWTKALSECINFSNLEVLSQINIKSTITPVNGAFTQAGLWESNGEK 420
           FAVLGPKSFVVDSSEWTKALSECINFSNLEVLSQINIKSTITPVNGAFTQAGLWESNGEK
Sbjct: 361 FAVLGPKSFVVDSSEWTKALSECINFSNLEVLSQINIKSTITPVNGAFTQAGLWESNGEK 420

Query: 421 QLIFMSDKSVKSITLPEPNKTKDAVSKTVQPVTEVKYEPVFSQPIGEILLLNKKFQSECS 480
           QLIFMSDKSVKSITLPEPNKTKDAVSKTVQPVTEVKYEPVFSQPIGEILLLNKKFQSECS
Sbjct: 421 QLIFMSDKSVKSITLPEPNKTKDAVSKTVQPVTEVKYEPVFSQPIGEILLLNKKFQSECS 480

Query: 481 RATQTVIPPHLMDLPLQNDSNEDQLALLTDISKEVFSKIIQGQTLGLLIHNRLFEQRYEL 540
           RATQTVIPPHLMDLPLQNDSNEDQLALLTDISKEVFSKIIQGQTLGLLIHNRLFEQRYEL
Sbjct: 481 RATQTVIPPHLMDLPLQNDSNEDQLALLTDISKEVFSKIIQGQTLGLLIHNRLFEQRYEL 540

Query: 541 TRQLERSSEILHKAKCLQERYPDQNSRWEHVSKKQENIDSRFEKLQSRLNEISSSGKLKD 600
           TRQLERSSEILHKAKCLQERYPDQNSRWEHVSKKQENIDSRFEKLQSRLNEISSSGKLKD
Sbjct: 541 TRQLERSSEILHKAKCLQERYPDQNSRWEHVSKKQENIDSRFEKLQSRLNEISSSGKLKD 600

Query: 601 LAISQREMEWFKEIKSQVSLFNKFVMQQQDVKEQLEFVQSELKTAGERRVSKEDVFDWAE 660
           LAISQREMEWFKEIKSQVSLFNKFVMQQQDVKEQLEFVQSELKTAGERRVSKEDVFDWAE
Sbjct: 601 LAISQREMEWFKEIKSQVSLFNKFVMQQQDVKEQLEFVQSELKTAGERRVSKEDVFDWAE 660

Query: 661 LQELLSVDSEIIKECNEGLVEAAKELDEKI 690
           LQELLSVDSEIIKECNEGLVEAAKELDEKI
Sbjct: 661 LQELLSVDSEIIKECNEGLVEAAKELDEKI 690

>KLTH0H10692g Chr8 complement(921787..923862) [2076 bp, 691 aa] {ON}
           similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 691

 Score =  455 bits (1171), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 274/700 (39%), Positives = 399/700 (57%), Gaps = 23/700 (3%)

Query: 1   MSAEDHPIFQNISVGKESYPKKLLTTQDGCRVVVIQGDTIRLCSSGNSQYQIIEC-GINT 59
           M  E HPIFQ  S+G+    +  L T+D  R ++++G++++ C      Y+ +E   I+ 
Sbjct: 1   MLPEAHPIFQARSLGESRSERLCLHTKDLSRTILLEGNSLKWCLMDAPNYEYMELNAISN 60

Query: 60  VAGAALNNSGTLLCAYNETELQVIVLPSPFVSSHGGILKPHTYNITVKSPIKQVQWHPRG 119
              A LN+SGTLLC  N  E+QV+ L            +P +Y I V + +KQV WHPRG
Sbjct: 61  YTSAVLNDSGTLLCLNNVDEIQVLAL-------SWDQTRPESYRIKVPAGVKQVLWHPRG 113

Query: 120 KLDSVPVVLHKDDTIAMYELYNEDFQQPTAVLNTMQNQLGVTSHITDIESMCFSKDGLAL 179
           +LDS   VL+K D I +YEL +EDF  PT VLN   N+LG+ S + DIES+CFS DGL L
Sbjct: 114 RLDSCLTVLNKRDEILLYELLSEDFSAPTTVLNASTNELGMGSSVKDIESVCFSADGLTL 173

Query: 180 YLLNSSEGGDVYALYPFLPSVLVIPEQHLEMCFYKSCINYENLSSDDSPTVKRNVIKQLQ 239
           YL++ SEG DV+++YP +PS L I  + L+  F K+ + Y+ LS  DSP +K    +QL 
Sbjct: 174 YLMSVSEGADVFSIYPCMPSELSITRKALKYNFNKALLQYQELSEGDSPELKLKATRQLH 233

Query: 240 FVSRLHKQYKSETVDKARNGDLVFNIQESYRNAKIQGPFTINPFAEKLYSATATQITTMP 299
           F+S L+ Q   +  D   N    F+I+++YRNA+ QGPFTI+PF EKLY ATA QI  + 
Sbjct: 234 FMSSLYNQ-PHDADDSQTNLLQTFHIRKAYRNARAQGPFTISPFPEKLYLATAKQIKAIA 292

Query: 300 I-DEFNELILVYFDNGTILQCFQDLDLSMCWEEIDXXXXXXXXXXXXXDILSGQIICLTP 358
           + DE  EL+L+ FD+ TIL+CF DL   M WE+                 L G I  +  
Sbjct: 293 LEDETTELLLITFDDDTILECFPDLTPVMSWEDSGSSEKNSLISVGSLK-LPGSISLIYG 351

Query: 359 HKFAVLGP-KSFVVDSSEWTKALSECINFSNLEVLSQINIKSTITPVNGAFTQAGLWESN 417
             F ++   K+ VV+ S  T+++   ++  +   LS+ ++   IT   G F  AGLW  +
Sbjct: 352 SCFVLISAEKAAVVNLSRLTRSIERSLDDCDATELSEEDLTEEITEKKGTFQSAGLWPES 411

Query: 418 GEKQLIFMSDKSVKSITLPEPNKTKDAVSKTVQPVTEVKYEPVFSQPIGEILLLNKKFQS 477
           G ++++ +S+K + SI +        + ++ ++  +E   +  +SQP+ E+  LN+K QS
Sbjct: 412 GMQKIVLLSEKEITSIDISSMQTPASSTTEKIEK-SETNRQRPYSQPLSEVQTLNQKVQS 470

Query: 478 ECSRATQTVIPPHLMDLPLQNDSNEDQLALLTDISKEVFSKIIQGQTLGLLIHNRLFEQR 537
                  TVIP  L    L N  NEDQL+LLTDISKEV S++   QTLGL +H RL  Q+
Sbjct: 471 LLKSPLSTVIPAALRQKTLNNTDNEDQLSLLTDISKEVLSRVTLAQTLGLSLHLRLLGQQ 530

Query: 538 YELTRQLERSSEILHKAKCLQERYPDQNSRWEHVSKKQENIDSRFEKLQSRLNEISSSGK 597
            EL + L   SE+  K + +      Q  RWE + +K ++I  RFE L   + +IS S +
Sbjct: 531 DELAQHLRDVSELRTKKERVSAHLASQKPRWEAIQEKNKSIALRFESLHRNMTQISKSSQ 590

Query: 598 LKDLAISQREMEWFKEIKSQVSLFNKFVMQQQDVKE-------QLEFVQSELKTAGER-R 649
           L+   I++ EMEWFKE+++QV  FN+ V +QQD+ E        LE+V+ +   A  R +
Sbjct: 591 LQSQPIAKAEMEWFKELRNQVVRFNRLVHEQQDLAEALSSLKLSLEYVRVDSAEAASRSK 650

Query: 650 VSKEDV--FDWAELQELLSVDSEIIKECNEGLVEAAKELD 687
            S E      W ELQ +L+ DS IIKEC   L    +ELD
Sbjct: 651 KSAESAGGVPWDELQAMLAKDSRIIKECQAELQCTTQELD 690

>Suva_6.137 Chr6 complement(228953..231109) [2157 bp, 718 aa] {ON}
           YJL061W (REAL)
          Length = 718

 Score =  435 bits (1118), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 262/721 (36%), Positives = 407/721 (56%), Gaps = 53/721 (7%)

Query: 7   PIFQNISVGKESYPKKLLTTQDGCRVVVIQGDTIRLCS--------SGN-SQYQIIECGI 57
           PIFQ  S+     P+ + ++ +G R+VVIQ D IR CS        S N S++ +++   
Sbjct: 11  PIFQ-ASLSANQSPRYIFSSHNGTRLVVIQDDIIRWCSLLTDPSYHSLNFSRHLVLDDTF 69

Query: 58  NTVAGAALNNSGTLLCAYNETELQVIVLPSPFVS----SHGGILKPHTYNIT-----VKS 108
           + ++ A    SG LLC Y++ E+ V+ +P  +++    S     +   Y++        S
Sbjct: 70  HAISSA----SGDLLCFYSDQEIFVMEIPWGYLNLGDVSIQDAFQVFHYSVDELELGSNS 125

Query: 109 PIKQVQWHPRGKLDSVPVVLHKDDTIAMYELYNEDFQQPTAVLNTMQNQLGVTSHITDIE 168
           PIK+V +HP+   DS  VVL  DDTI M+++ N+  Q+   +LN   +  G+ + + DI 
Sbjct: 126 PIKKVLFHPKSYNDSCIVVLKNDDTITMFDILNQ--QEAPIILNKRNSSFGLDARVNDIT 183

Query: 169 SMCFSKDGLALYLLNSSEGGDVYALYPFLPSVLVIPEQHLEMCFYKSCINYENLSSDDSP 228
              FSKDGL LY LN++EGGD++A YPFLPSVL + E+ L     KS + YE+L++    
Sbjct: 184 DFAFSKDGLTLYCLNTTEGGDIFAFYPFLPSVLSLSEKDLGWILNKSLVMYESLNATTDY 243

Query: 229 TVKRNVIKQLQFVSRLHKQYKSETVDKARNGDLVFNIQESYRNAKIQGPFTINPFAEKLY 288
            VKRN+ KQLQFVS+LHK + S+             I + YR  K+QGPFTINPF  +LY
Sbjct: 244 KVKRNITKQLQFVSKLHKNWDSKLAK--------VKIDDEYRLVKMQGPFTINPFPNELY 295

Query: 289 SATATQITTMPID-EFNELILVYFDNGTILQCFQDLDLSMCWEEIDXXXXXXXXXXXXXD 347
             TA++ITT+PID + NE++ V FD+G+++  FQDL++SM W+  +              
Sbjct: 296 DFTASKITTIPIDNQQNEIVCVSFDDGSLIILFQDLEMSMSWDVDNYVYNNSLILIERIK 355

Query: 348 ILSGQIICLT--PHK----FAVLGPKSFVVDSSEWTKALSECINFSNLEVLSQINIKSTI 401
           +   ++  LT  P +    +  L      +D + WT  LS+CI+ S+L  L+ +   S  
Sbjct: 356 LQQKEMKSLTALPDQLGKLYVTLESSVHQLDCTSWTSVLSKCIDESDLNALADVKFVSKF 415

Query: 402 TPVNGAFTQAGL----WESNGEKQLIFMSDKSVKSIT-------LPEPNKTKDAVSKTVQ 450
             +      +      W       LI     ++++I+       L  P +    V+    
Sbjct: 416 EDIATIHQLSNFAYINWNDKSSLALISKEKLTIQNISNHKKEQSLNAPAELDTNVNSDKS 475

Query: 451 PVTEVKYEPVFSQPIGEILLLNKKFQSECSRATQTVIPPHLMDLPLQNDSNEDQLALLTD 510
              +  YE  F+QPI EIL LN+ FQ  C    + +IPP    LPL+N++NE+QL + TD
Sbjct: 476 DTGKRGYEISFTQPINEILSLNESFQKVCLSPCERIIPPADRQLPLKNEANENQLEIFTD 535

Query: 511 ISKEVFSKIIQGQTLGLLIHNRLFEQRYELTRQLERSSEILHKAKCLQERYPDQNSRWEH 570
           ISKE   KII+ Q+LG+ I+NR+ EQ++ELTRQL+ +S+I+ K + LQ++   Q  +W  
Sbjct: 536 ISKEFLRKIIKAQSLGVSIYNRIHEQQFELTRQLQSTSKIIAKDEILQKKLEAQTEKWNS 595

Query: 571 VSKKQENIDSRFEKLQSRLNEISSSGKLKDLAISQREMEWFKEIKSQVSLFNKFVMQQQD 630
            S +Q  + +RF KL   L++++ S K K+  IS  EMEWFKEI++Q+  FN FV  Q+ 
Sbjct: 596 QSSRQAELMTRFGKLTENLSKVAESDKFKEQNISHGEMEWFKEIRNQILQFNGFVHSQKS 655

Query: 631 VKEQLEFVQSELKTAGERRVS--KEDVFDWAELQELLSVDSEIIKECNEGLVEAAKELDE 688
           +++ L +++ EL       ++  K+   +W EL+++L VDS+IIKECNE LV  +++L  
Sbjct: 656 IQQDLSYLKRELIRIESETINADKKSQNEWDELRKMLEVDSKIIKECNEELVHVSQQLTT 715

Query: 689 K 689
           K
Sbjct: 716 K 716

>YJL061W Chr10 (320016..322157) [2142 bp, 713 aa] {ON}  NUP82Linker
           nucleoporin component of the nuclear pore complex (NPC);
           also part of the NPC cytoplasmic filaments; contributes
           to nucleocytoplasmic transport and NPC biogenesis; forms
           stable associations with three FG-nucleoporins (Nsp1p,
           Nup159p, and Nup116p)
          Length = 713

 Score =  428 bits (1101), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 269/723 (37%), Positives = 412/723 (56%), Gaps = 62/723 (8%)

Query: 7   PIFQNISVGKESYPKKLLTTQDGCRVVVIQGDTIR--------LCSSGN-SQYQIIECGI 57
           PIFQ  S+     P+ + ++Q+G R+V IQ + IR        L  S N S++ +++   
Sbjct: 11  PIFQ-ASLSASQSPRYIFSSQNGTRIVFIQDNIIRWYNVLTDSLYHSLNFSRHLVLDDTF 69

Query: 58  NTVAGAALNNSGTLLCAYNETELQVIVLPSPF-----VSSHGGILKPHTYNIT-----VK 107
           + ++      SG LLC +N+ E+ V+ +P  +     VS        H Y+I       K
Sbjct: 70  HVISST----SGDLLCLFNDNEIFVMEVPWGYSNVEDVSIQDAFQIFH-YSIDEEEVGPK 124

Query: 108 SPIKQVQWHPRGKLDSVPVVLHKDDTIAMYELYNEDFQQPTAVLNTMQNQLGVTSHITDI 167
           S IK+V +HP+   DS  VVL +DDTI M+++ N   Q+   VLN   N  G+ + + DI
Sbjct: 125 SSIKKVLFHPKSYRDSCIVVLKEDDTITMFDILNS--QEKPIVLNKPNNSFGLDARVNDI 182

Query: 168 ESMCFSKDGLALYLLNSSEGGDVYALYPFLPSVLVIPEQHLEMCFYKSCINYENLSSDDS 227
             + FSKDGL LY LN++EGGD++A YPFLPSVL++ E+ L +   KS + YE+L S   
Sbjct: 183 TDLEFSKDGLTLYCLNTTEGGDIFAFYPFLPSVLLLNEKDLNLILNKSLVMYESLDSTTD 242

Query: 228 PTVKRNVIKQLQFVSRLHKQYKSETVDKARNGDLVFNIQESYRNAKIQGPFTINPFAEKL 287
             VKRNVIKQLQFVS+LH+ + S      R G +  +IQ+ YR AK+QGPFTINPF  +L
Sbjct: 243 VIVKRNVIKQLQFVSKLHENWNS------RFGKV--DIQKEYRLAKVQGPFTINPFPGEL 294

Query: 288 YSATATQITTMPIDEF-NELILVYFDNGTILQCFQDLDLSMCWEEIDXXXXXXXXXXXXX 346
           Y  TAT I T+ ID   NE++ V FD+G+++  F+DL++SM W ++D             
Sbjct: 295 YDYTATNIATILIDNGQNEIVCVSFDDGSLILLFKDLEMSMSW-DVDNYVYNNSLVLIER 353

Query: 347 DILSGQIICLT--PHKFAVLGPKSF----VVDSSEWTKALSECINFSNLEVLSQINIKST 400
             L  +I  L   P +   L   S      V+   W   LS+CIN S+L  L+ +  +S 
Sbjct: 354 VKLQREIKSLITLPEQLGKLYVISDNIIQQVNFMSWASTLSKCINESDLNPLAGLKFESK 413

Query: 401 ITPV-------NGAFTQAGLWESNGEKQLIFMSDKS-----VKSITLPEPNKTKDAVSKT 448
           +  +       N A+     W  N +  L  MS+K+     + S   P+    + ++S  
Sbjct: 414 LEDIATIERIPNLAYIN---W--NDQSNLALMSNKTLTFQNISSDMKPQSTAAETSISTE 468

Query: 449 VQPVTEVKYEPVFSQPIGEILLLNKKFQSECSRATQTVIPPHLMDLPLQNDSNEDQLALL 508
                   ++  F+QPI EIL+LN  FQ  C    + +IP     +PL+N+++E+QL + 
Sbjct: 469 KSDTVGDGFKMSFTQPINEILILNDNFQKACISPCERIIPSADRQIPLKNEASENQLEIF 528

Query: 509 TDISKEVFSKIIQGQTLGLLIHNRLFEQRYELTRQLERSSEILHKAKCLQERYPDQNSRW 568
           TDISKE   +I++ QTLG+ IHNR+ EQ++ELTRQL+ + +I+ K   L+ ++  QN +W
Sbjct: 529 TDISKEFLQRIVKAQTLGVSIHNRIHEQQFELTRQLQSTCKIISKDDDLRRKFEAQNKKW 588

Query: 569 EHVSKKQENIDSRFEKLQSRLNEISSSGKLKDLAISQREMEWFKEIKSQVSLFNKFVMQQ 628
           +    +Q  +  RF KL  +L++I+ S K K+  IS  EM+WFKEI++Q+  FN FV  Q
Sbjct: 589 DAQLSRQSELMERFSKLSKKLSQIAESNKFKEKKISHGEMKWFKEIRNQILQFNSFVHSQ 648

Query: 629 QDVKEQLEFVQSELKT--AGERRVSKEDVFDWAELQELLSVDSEIIKECNEGLVEAAKEL 686
           + +++ L +++SEL    A   +V K+   +W EL+++L +DS+IIKECNE L++ ++E 
Sbjct: 649 KSLQQDLSYLKSELTRIEAETIKVDKKSQNEWDELRKMLEIDSKIIKECNEELLQVSQEF 708

Query: 687 DEK 689
             K
Sbjct: 709 TTK 711

>ZYRO0G20680g Chr7 complement(1703031..1705109) [2079 bp, 692 aa]
           {ON} similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 692

 Score =  421 bits (1083), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 253/703 (35%), Positives = 397/703 (56%), Gaps = 32/703 (4%)

Query: 1   MSAEDHPIFQNISVGKESYPKKLLTTQDGCRVVVIQGDTIRLCSSGNSQYQ--IIECGIN 58
           MS   H IF+  S   + +   L T+QDG +VV+ Q  +IR C++ +S+Y+  ++E  I 
Sbjct: 1   MSIGSHSIFKRASGSSKRF---LCTSQDGSKVVIYQDSSIRWCNAFDSKYEFMLLEPTIE 57

Query: 59  TVAGAALNNSGTLLCAYNETELQVIVLPSPFVS-SHGGILKPHTYNITVKSP-IKQVQWH 116
            V    L+ +GTLL  YN  E++++ +P  +   S+ G  K      + + P IK+V +H
Sbjct: 58  DVEHVVLSPTGTLLLLYNSREVRIVEIPWGYSQVSYEGFQKFRYSVDSRQDPLIKKVLFH 117

Query: 117 PRGKLDSVPVVLHKDDTIAMYELYNEDFQQPTA-VLNTMQNQLGVTSHITDIESMCFSKD 175
           P    +   V+L  D+TI + + Y    +QP   VLN      G+   +TDIES+ FS+D
Sbjct: 118 PLAYREHCIVILKTDNTIHLLDRYYPYDKQPKLLVLNQHDGAFGMEGLVTDIESITFSQD 177

Query: 176 GLALYLLNSSEGGDVYALYPFLPSVLVIPEQHLEMCFYKSCINYENLSSDDSPTVKRNVI 235
           GL LY L+ +EG D+YA YP LP  + I    L++  +KS + YENLS +     KRN I
Sbjct: 178 GLTLYALSVAEGCDIYAFYPCLPCSIEIDSHKLDLLMHKSLVQYENLSVETPDATKRNTI 237

Query: 236 KQLQFVSRLHKQYKSETVDKARNGDLVFNIQESYRNAKIQGPFTINPFAEKLYSATATQI 295
           KQ QF+S+L +  +        N     +I   +   + QGPFTI PF ++ Y  TA Q+
Sbjct: 238 KQFQFISKLRQGLE--------NDQTKIDIPMDWLRVRGQGPFTIAPFPDRYYDRTAVQL 289

Query: 296 TTMPIDEFNELILVYFDNGTILQCFQDLDLSMCWEEIDXXXXXXXXXXXXXDILSGQIIC 355
             +PI   N+L+L+ FD+GTI+  +QDL+L+MCW+                 +  G+++ 
Sbjct: 290 KILPIGANNDLLLMSFDDGTIVVLYQDLELTMCWDSKGYSYNNSLVLVESIRLERGELVL 349

Query: 356 L--TPHKFAVLGPKS--FVVDSSEWTKALSECINFSNLEVLSQINIKSTITPVNGA--FT 409
              T  +F VLG  S  ++VD+S W+K LS CI+ S+LE ++ +  KS I+ + G     
Sbjct: 350 KQGTLSQFFVLGGTSDIYLVDTSPWSKILSNCIDNSDLEPIADLQFKSEISKIEGVSQID 409

Query: 410 QAGLWESNGEKQLIFMSDKSV--KSITL-PEPNKTKDAVSKTVQ-PVTEVKYEPVFSQPI 465
              +W+ + E + +F+S  +V  KS  +  +P+  KD     V  P    +YE   +QP+
Sbjct: 410 SYAMWKKDTEPKDVFVSKDTVFVKSTAVNDQPSTVKDEKKANVDIP----RYEVALNQPM 465

Query: 466 GEILLLNKKFQSECSRATQTVIPPHLMDLPLQNDSNEDQLALLTDISKEVFSKIIQGQTL 525
            EIL LN  FQ+E  +    ++ P      L N+SNE+QL +LT +SKE   KI++ Q L
Sbjct: 466 SEILSLNASFQTEAKKPLSKLVEPSKRQTKLNNESNEEQLEILTTVSKEFLQKIVKAQAL 525

Query: 526 GLLIHNRLFEQRYELTRQLERSSEILHKAKCLQERYPDQNSRWEHVSKKQENIDSRFEKL 585
           G  +HNR  EQ+YELTRQL+ SSEIL K   L+ +   Q+S  E   ++Q+ +  RF  L
Sbjct: 526 GFNLHNRCLEQQYELTRQLQYSSEILSKQDKLRSKAQSQSSECESKIQRQDKLLQRFNSL 585

Query: 586 QSRLNEISSSGKLKDLAISQREMEWFKEIKSQVSLFNKFVMQQQDVKEQLEFVQSELKTA 645
             +L  I+ S K +++ I+ +EM WFKEI++QV +FN++V  Q++ ++QL ++Q EL+  
Sbjct: 586 SEKLGRINESPKFREMNITDKEMAWFKEIRNQVLVFNQYVHHQKNQQDQLRYLQKELENI 645

Query: 646 G--ERRVSKEDVFDWAELQELLSVDSEIIKECNEGLVEAAKEL 686
              ++ V ++   +W EL  +L  D++IIKECN  L  A+ E+
Sbjct: 646 SLEDKDVGEKSKSEWTELLSILESDTKIIKECNNQLAHASSEV 688

>TDEL0D01880 Chr4 (366715..368790) [2076 bp, 691 aa] {ON} Anc_1.319
           YJL061W
          Length = 691

 Score =  413 bits (1061), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 251/707 (35%), Positives = 396/707 (56%), Gaps = 41/707 (5%)

Query: 1   MSAEDHPIFQNISVGKESYPKKLLTTQDGCRVVVIQGDTIRLCSSGNSQYQ--IIECGIN 58
           M+ E HPIF+     +    +  LTT DG R VV+Q   IR C+     Y    +E    
Sbjct: 1   MTVETHPIFRPSLTAQSGSDRFFLTTSDGGRAVVVQDSCIRWCNVSEPGYHSMTLERAFK 60

Query: 59  TVAGAALNNSGTLLCAYNETELQVIVLPSPF--VSSHGGILKPHTYNITVKSPIKQVQWH 116
            V    ++NSG  LC YN+ EL++I +P  +  VSS     +   + ++ ++ IKQV +H
Sbjct: 61  DVKHVVMSNSGEFLCLYNDDELRIIEVPWAYTEVSSMANAFQLFRF-VSDEARIKQVLFH 119

Query: 117 PRGKLDSVPVVLHKDDTIAMYELYNEDFQQPTAVLNTMQNQLGVTSHITDIESMCFSKDG 176
           P        V+L  DD+I +    +    +P  VLN       + S ITD+E + FS+DG
Sbjct: 120 PLAYQQETVVILKDDDSITIMNWQDFGDSKPD-VLNLSNGTYSLDSSITDVECITFSQDG 178

Query: 177 LALYLLNSSEGGDVYALYPFLPSVLVIPEQHLEMCFYKSCINYENLSSDDSPTVKRNVIK 236
           L LY+L+ SEG D+YA YP L   +   +Q L+   YKS I Y+ L+      VKRN IK
Sbjct: 179 LTLYVLSVSEGADIYAFYPCLAPRMQFDKQGLDRLMYKSLIQYDVLNVGTDSEVKRNTIK 238

Query: 237 QLQFVSRLHKQYKSETVDKARNGDLVFNIQESYRNAKIQGPFTINPFAEKLYSATATQIT 296
           QL+FVS LHKQ         +N   +  I E+ R  + QGPFTI PF +++YS+T T I 
Sbjct: 239 QLKFVSGLHKQ---------QNSQRILEIPEAQRQVRGQGPFTIAPFPKQIYSSTGTGIA 289

Query: 297 TMPIDEFNELILVYFDNGTILQCFQDLDLSMCWEEIDXXXXXXXXXXXXXDILSGQI--I 354
           ++PI++ NEL+++  D+G I    QDLD++M W+                 + S +I  I
Sbjct: 290 SLPINDQNELLIMSLDDGNIAILLQDLDVTMNWDSARYNYNNSFALVELITLGSQEIQQI 349

Query: 355 CLTPHK---FAVLGPKS-FVVDSSEWTKALSECINFSNLEVLSQINIKSTITPVNGAFTQ 410
            +  HK   F+V+ P+  F +D+S+W+  ++ C+  S+L  L++  ++S +T     FT+
Sbjct: 350 VVGDHKYGQFSVMTPEGVFSIDTSKWSGVMASCLTESDLRPLAETKLESEVT-----FTE 404

Query: 411 ------AGLWESNGEKQLIFMSDKSVKSITLPEP-NKTKDAVSKTVQPVTEVKYEPVFSQ 463
                 +  W +   + ++ +S++ VKS  + E  +K  D ++ + Q     KY   +SQ
Sbjct: 405 LKDSPKSVAWWNTTPQSVVKVSNREVKSKQVSEGVSKQDDDITGSRQEPE--KYNAHYSQ 462

Query: 464 PIGEILLLNKKFQSECSRATQTVIPPHLMDLPLQNDSNEDQLALLTDISKEVFSKIIQGQ 523
           PI EI+ LN+KFQ E S+A   VIPP     PL+N+++E QL LLT+ SK+  SKI  GQ
Sbjct: 463 PIAEIMQLNQKFQLESSKAPSKVIPPRERQKPLKNEASEIQLDLLTEASKDFVSKIAVGQ 522

Query: 524 TLGLLIHNRLFEQRYELTRQLERSSEILHKAKCLQERYPDQNSRWEHVSKKQENIDSRFE 583
           TLG+ +HNR++EQ+ +LT QL+ S E++ K + +   +  Q+SR + V  +   + SRF 
Sbjct: 523 TLGVTLHNRIYEQQLDLTHQLKASGELMEKQQTILTHFHSQSSRSDAVHARHSTLMSRFN 582

Query: 584 KLQSRLNEISSSGKLKDLAISQREMEWFKEIKSQVSLFNKFVMQQQDVKEQLEFVQSEL- 642
           K +  L +I +S + KDL IS+ E+EWFKEI+ QV  FN+ V  Q+ +++QL  ++ E+ 
Sbjct: 583 KFKDNLGQIQNSQRFKDLEISKEEVEWFKEIRKQVLTFNRDVHNQKRLQDQLIHLKQEMN 642

Query: 643 ---KTAGERRVSKEDVFDWAELQELLSVDSEIIKECNEGLVEAAKEL 686
              +  G++     D  +W EL+ +L  D+ I+++CN  L  AA+++
Sbjct: 643 RIAQVTGDQNSQARD--EWHELRHMLEEDTIILQDCNNQLKSAARQV 687

>Kwal_14.2580 s14 complement(821497..823560) [2064 bp, 687 aa] {ON}
           YJL061W (NUP82) - 82-kDa protein, with putative
           coiled-coil domain, has carboxy-terminal domain,
           containing heptad repeats, that binds Nsp1p; nucleoporin
           [contig 224] FULL
          Length = 687

 Score =  412 bits (1058), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 251/702 (35%), Positives = 380/702 (54%), Gaps = 31/702 (4%)

Query: 1   MSAEDHPIFQNISVGKESYPKKLLTTQDGCRVVVIQGDTIRLCSSGNSQYQIIECGINT- 59
           M  E HPIF   +       + +       +  V+QG+T+R CS+G  +YQ +E      
Sbjct: 1   MIPESHPIFDTKTNSSGKSRRFVFNIGIASKYGVLQGNTLRWCSAGGHEYQYLEFEPRID 60

Query: 60  VAGAALNNSGTLLCAYNETELQVIVLPSPFVSSHGGILKPHTYNITVKSPIKQVQWHPRG 119
                +N SG+LLC YN  ++Q++ +      S   ++ P        + IKQ  WHPRG
Sbjct: 61  YTSVVINESGSLLCLYNSKQVQILAVSWDESKSDTILISP-------PAGIKQALWHPRG 113

Query: 120 KLDSVPVVLHKDDTIAMYELYNEDFQQPTAVLNTMQNQLGVTSHITDIESMCFSKDGLAL 179
           +L S   VL   D I +YEL  ED+ +PT +LNT   +LG+ S + DI SM FS DGL L
Sbjct: 114 RLGSCLAVLTTQDEICLYELLTEDYTEPTTILNTCTKELGMGSVVKDITSMSFSSDGLTL 173

Query: 180 YLLNSSEGGDVYALYPFLPSVLVIPEQHLEMCFYKSCINYENLSSDDSPTVKRNVIKQLQ 239
           YLL++SEG D+Y++YP LPS + I    L+  F K+ + Y++L+ +DSP ++R V KQLQ
Sbjct: 174 YLLSTSEGADIYSIYPCLPSEMEISGALLKSVFNKALLQYQDLNDNDSPDLRRKVTKQLQ 233

Query: 240 FVSRLHKQYKSETVDKARNGDLVFNIQESYRNAKIQGPFTINPFAEKLYSATATQITTMP 299
           FVS+L K  K++  D   +   V  I +++R+ + QGPFTINPF + LY AT  Q+  + 
Sbjct: 234 FVSKLQK--KNDYKDTESH---VVTISKAHRSPRAQGPFTINPFPDNLYLATGRQVEVIK 288

Query: 300 IDE-FNELILVYFDNGTILQCFQDLDLSMCWEEIDXXXXXXXXXXXXXDILSGQIICLTP 358
           +     EL+L+ FD+GTIL+CF D +  M WE+               +I  G+I  +  
Sbjct: 289 LQGCAAELLLISFDDGTILECFPDREPVMSWEDEGFCENNSLIVLGSVNI-GGEIALVNG 347

Query: 359 HKFAVLG-PKSFVVDSSEWTKALSECINFSNLEVLSQINIKSTITPVNGAFTQAGLWESN 417
           + F VL   K   V   +  + +   +N  ++    + ++   +   NG F  A +  S+
Sbjct: 348 YTFVVLSSAKVTFVSLRKLAQVIESSLNDCDISYFDEADLSEEVVEKNGRFCSAIICASS 407

Query: 418 GEKQLIFMSDKSVKSITLP---EPNKTKDAVSKTVQPVTEVKYEPVFSQPIGEILLLNKK 474
            +  +  +S+ +   I +P   +  K + A+      V +  Y P + QP+ E+L LN+K
Sbjct: 408 EKSCVALLSETTTSHIDIPFSLDAPKMRTALGTAKTDVEQ--YRP-YGQPLNEVLALNEK 464

Query: 475 FQSECSRATQTVIPPHLMDLPLQNDSNEDQLALLTDISKEVFSKIIQGQTLGLLIHNRLF 534
            Q+   +  QT + P L    L N+SNEDQL+LLT ISKEV ++I   QTL L ++ RL 
Sbjct: 465 VQALLKKPLQTGVSPSLRQAKLNNESNEDQLSLLTSISKEVMTRIASAQTLALSLYLRLS 524

Query: 535 EQRYELTRQLERSSEILHKAKCLQERYPDQNSRWEHVSKKQENIDSRFEKLQSRLNEISS 594
            Q+ ELT+ LE  S++      +  R  DQ+SRWE    K ++I SR E++ S+L ++SS
Sbjct: 525 CQQGELTQHLETVSKVEELQSKVLRRLKDQSSRWEAAQAKNKSISSRLEQISSKLKQVSS 584

Query: 595 SGKLKDLAISQREMEWFKEIKSQVSLFNKFVMQQQDVKEQLEFVQSELK---------TA 645
           SGK +   IS  E+EWFKEI+ QV  FN+ V +QQ +   L  ++ EL+          +
Sbjct: 585 SGKFQSQPISNHELEWFKEIRDQVIRFNRLVHEQQSLGNTLSNLKCELEYVHVESKEGKS 644

Query: 646 GERRVSKEDVFDWAELQELLSVDSEIIKECNEGLVEAAKELD 687
           G      +D   W EL+ LL+ D  II EC + L   AK+LD
Sbjct: 645 GSSSADNKDEVPWDELRALLAKDLRIIGECQDSLQGVAKQLD 686

>Smik_10.179 Chr10 (311844..313985) [2142 bp, 713 aa] {ON} YJL061W
           (REAL)
          Length = 713

 Score =  405 bits (1040), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 255/718 (35%), Positives = 407/718 (56%), Gaps = 52/718 (7%)

Query: 7   PIFQNISVGKESYPKKLLTTQDGCRVVVIQGDTIRL-------C--SSGNSQYQIIECGI 57
           PIFQ  S+     P+ + T+Q+G R+V IQ + IR        C  S   S++ +++   
Sbjct: 11  PIFQ-ASLSASQSPRYIFTSQNGTRIVFIQDNIIRWYNVLTDPCYHSLSLSRHLVLDDTF 69

Query: 58  NTVAGAALNNSGTLLCAYNETELQVIVLPSPFVSSHGGILKP--HTYNITV-------KS 108
           + ++      SG LLC +N+ E+ V+ +P  + +     ++     ++ +V       KS
Sbjct: 70  HVISST----SGDLLCFFNDQEIFVMEVPWGYSNVENISIQDAFQVFHYSVDETELGPKS 125

Query: 109 PIKQVQWHPRGKLDSVPVVLHKDDTIAMYELYNEDFQQPTAVLNTMQNQLGVTSHITDIE 168
            IK+V +HP+   DS  VVL ++DTI M+++ N+  Q+   +LN   N  G+ + + DI 
Sbjct: 126 LIKKVLFHPKSYHDSCIVVLKENDTIIMFDILNQ--QEKPIILNKPNNSFGLDARLNDIT 183

Query: 169 SMCFSKDGLALYLLNSSEGGDVYALYPFLPSVLVIPEQHLEMCFYKSCINYENLSSDDSP 228
            + FSKDGL LY LN++EGGD++A YPFLPS L++ E  L     KS + YE+L      
Sbjct: 184 DLVFSKDGLTLYCLNTTEGGDIFAFYPFLPSALLLNENDLSWILNKSLVMYESLDPTTDV 243

Query: 229 TVKRNVIKQLQFVSRLHKQYKSETVDKARNGDLVFNIQESYRNAKIQGPFTINPFAEKLY 288
           TVKRN+IKQLQFVS+LH+ + S+ ++K        +I   YR  K+QGPFTINPF  +LY
Sbjct: 244 TVKRNIIKQLQFVSKLHENWDSK-LNKV-------DIDSEYRLVKVQGPFTINPFPNELY 295

Query: 289 SATATQITTMPID-EFNELILVYFDNGTILQCFQDLDLSMCWEEIDXXXXXXXXXXXXXD 347
             TA  I T+ ID + NE+  + FD+G+++   +DL++SM W+ +               
Sbjct: 296 DYTAKNIATISIDNQQNEIFCISFDDGSLILLLKDLEMSMSWD-VGNYVYNDSLVLIERV 354

Query: 348 ILSGQIICLT--PHKFAVLG--PKSFV--VDSSEWTKALSECINFSNLEVLSQINIKS-- 399
            +  +I  L   P +   L    K+FV  V+S+ WT  +S+CIN S+L  L  +  +S  
Sbjct: 355 KMQKEIESLITLPEQMGKLYVFSKNFVYQVNSTSWTSTISKCINESDLNPLGDLKFESKI 414

Query: 400 -TITPVNGAFTQAGLWESNGEKQLIFMSDKSVKSITLP-----EPNKTKDAVSKTVQPVT 453
             I  V G    A ++ +N    L   S+K +   T+      +  +T+  +      + 
Sbjct: 415 ENIATVEGMPNLAHIYWNNT-SNLALASNKELTFQTVSVDQKMQSTETETDIGTEESGLA 473

Query: 454 EVKYEPVFSQPIGEILLLNKKFQSECSRATQTVIPPHLMDLPLQNDSNEDQLALLTDISK 513
           + +YE  F+QP+ EIL LN+ FQ  C    + +IP     +PL+N+++E+QL + TD+SK
Sbjct: 474 KCRYELRFTQPLSEILTLNENFQRACISPCEQIIPSTDRQIPLKNEASENQLEIFTDVSK 533

Query: 514 EVFSKIIQGQTLGLLIHNRLFEQRYELTRQLERSSEILHKAKCLQERYPDQNSRWEHVSK 573
           E   KI + Q+LG+ I+NR+ EQ+ ELTRQL+ + +I+ K   L++++  QN +W+    
Sbjct: 534 EFLQKIAKAQSLGVSIYNRIHEQQLELTRQLQSTCKIISKDVDLRKKFEAQNKKWDAQII 593

Query: 574 KQENIDSRFEKLQSRLNEISSSGKLKDLAISQREMEWFKEIKSQVSLFNKFVMQQQDVKE 633
           +Q  +  RF KL   L+EIS S K K+  IS  EMEWFKEI++Q+  FN +V  Q+ +++
Sbjct: 594 RQSKLMERFSKLTENLSEISKSNKFKEKNISNAEMEWFKEIRNQILQFNCYVHSQKSLQQ 653

Query: 634 QLEFVQSELKTAGER--RVSKEDVFDWAELQELLSVDSEIIKECNEGLVEAAKELDEK 689
            L +++ EL        +V K+   +W EL+++L +DS+IIKECNE L  A+++L  K
Sbjct: 654 DLSYLKRELTRIETETIQVDKKSQSEWNELRKMLEIDSKIIKECNEELQHASQQLTTK 711

>NCAS0A09210 Chr1 complement(1820713..1822845) [2133 bp, 710 aa]
           {ON} Anc_1.319 YJL061W
          Length = 710

 Score =  405 bits (1040), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 253/715 (35%), Positives = 394/715 (55%), Gaps = 40/715 (5%)

Query: 2   SAEDHPIFQNISVGKESYPKKLLTTQDGCRVVVIQGDTIRLCSSGNSQYQIIECGI---- 57
           S   HPIFQ +   +++ P+ L T+  G R+VV+QG  +R CS   S +  +        
Sbjct: 6   SIASHPIFQGLDCTQDAAPRFLFTSHHGTRMVVLQGGLLRWCSVTASSFNSMTIDFFQPE 65

Query: 58  -NTVAGAALNNSGTLLCAYNETELQVI------VLPSPFVSSHGGILKPHTYNITVKSPI 110
                 A L+NSG  +C Y    ++VI      V PSP + S   +   +  +    SPI
Sbjct: 66  STAPQKAILSNSGEFICVYTNHTIEVIEIPWGYVTPSPSMVSKFQLFSYNNKDDDGYSPI 125

Query: 111 KQVQWHPRGKLDSVPVVLHKDDTIAMYELYNEDFQQPTAVLNTMQNQLGVTSHITDIESM 170
           KQV +HP    DS  VVL+ + TI++ ++        T  LN      G+ + ITDIES+
Sbjct: 126 KQVLFHPEAYKDSCLVVLYDNGTISLMDVTQ---ITKTITLNKRVATFGIDTQITDIESI 182

Query: 171 CFSKDGLALYLLNSSEGGDVYALYPFLPSVLVIPEQHLEMCFYKSCINYENLSSDDSPTV 230
           CFSKDG  LY L+ S+GGD+YA YP LP  L +  + +    ++S + YE+L  D    V
Sbjct: 183 CFSKDGWTLYALSISDGGDIYAFYPCLPQQLEVKREKITSLLHESVLLYESLKLDTDRDV 242

Query: 231 KRNVIKQLQFVSRLHKQYKSETVDKARNGDLVFNIQESYRNAKIQGPFTINPFAEKLYSA 290
           KRNVI+Q+QFV++L+        +K  N D +  I++ YR  + QGPFTI+P+ E+LYSA
Sbjct: 243 KRNVIRQVQFVNKLNGLLTEN--EKNSNEDFI-EIEQEYRLIRGQGPFTIDPYPERLYSA 299

Query: 291 TATQITTMPIDEFNELILVYFDNGTILQCFQDLDLSMCWE---EIDXXXXXXXXXXXXXD 347
           TA +I+T+PI+  NEL+ + FD+G+I   F+DL L+M W+    +              D
Sbjct: 300 TALEISTLPINSNNELMCMIFDDGSIALLFKDLPLTMSWDVDNYVHNNSFSLVELMQLKD 359

Query: 348 ILSGQIICL--TPHKFAVLGPKS-FVVDSSEWTKALSECINFSNLEVLSQINIKSTIT-- 402
               +I+    T  +F + G  S F+V +  W+  L++ I+ SNL  L ++N  S +   
Sbjct: 360 TDVKRIVSYPDTYGQFFIFGDSSLFLVHTHIWSDLLAKAIDNSNLNELLEMNFTSKLDFF 419

Query: 403 PVNGAFTQAGLWESNGEKQLIFMSDKSVKSITLPEPNKTKDAVSKTVQPVT----EVK-- 456
                 T+    +  G   ++F++ + V    +      K  +    +PV     E+K  
Sbjct: 420 ETTNGITKCSPCKWRGRDVILFITKEDV---YMHPVEMRKSGILGNNKPVLVNNEELKHQ 476

Query: 457 -YEPVFSQPIGEILLLNKKFQSECSRATQTVIPPHLMDLPLQNDSNEDQLALLTDISKEV 515
            Y+  F QP+ E++ LNK FQ +CS     +I P    + L N++NE QL LL+D+SKEV
Sbjct: 477 EYKTSFKQPVEELMALNKLFQQQCSMGVSKLIAPEERQVLLNNENNEVQLELLSDVSKEV 536

Query: 516 FSKIIQGQTLGLLIHNRLFEQRYELTRQLERSSEILHKAKCLQERYPDQNSRWEHVSKKQ 575
            SKI QGQ L L +H+RL EQ+YELTRQL+    I+ K   L+ +  +Q+ RW+  + + 
Sbjct: 537 ISKIGQGQNLALNLHHRLLEQQYELTRQLKIVHTIMSKQSDLRRKSEEQSRRWDDQTSRS 596

Query: 576 ENIDSRFEKLQSRLNEISSSGKLKDLAISQREMEWFKEIKSQVSLFNKFVMQQQDVKEQL 635
             +  R + L +++ EI++S KLK+  I+ +E+EWFKEI++QV  FN FV  Q+D +E+L
Sbjct: 597 SQLIKRLQDLDAKILEINNSPKLKEYPINDKELEWFKEIRNQVLKFNSFVHNQRDAQEEL 656

Query: 636 EFVQSEL----KTAGERRVSKEDVFDWAELQELLSVDSEIIKECNEGLVEAAKEL 686
             ++ +L    K   + R  K D  +W EL+++L  D++II+ECN+ L+   + L
Sbjct: 657 NHLKKDLARISKETSQLRDEKSDK-EWDELRDILKHDAQIIQECNKELLSTTEAL 710

>KAFR0A01720 Chr1 complement(349779..351929) [2151 bp, 716 aa] {ON}
           Anc_1.319 YJL061W
          Length = 716

 Score =  395 bits (1015), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 247/719 (34%), Positives = 396/719 (55%), Gaps = 51/719 (7%)

Query: 4   EDHPIFQNISVGKESYPKKLLT----TQDGCRVVVIQGDTIRLCSSGNSQYQ---IIECG 56
           E+ PIF+          ++  +     QD     + + + +R  S  +SQY    ++   
Sbjct: 17  ENRPIFKTSLSSSLLNSERSFSLPILAQDSS---IYKKNQLRWGSVASSQYHSLPLLFFD 73

Query: 57  INTVAGAALNNSGTLLCAYNETELQVIVLPSPF---VSSHGGILKPHTYNITVKSPIKQV 113
            +      ++NSG  LC Y++  L +I +P  +   V+S     +    ++   S IK++
Sbjct: 74  DSAYENVIISNSGQFLCLYDKKSLSLIEIPWGYDGAVTSIKSSFQRVFRDVNKSSDIKKI 133

Query: 114 QWHPRGKLDSVPVVLHKDDTIAMYELYNEDFQQPTAVLNTMQNQLGVTSHITDIESMCFS 173
            +HP+   D   V+L ++D I +++L     +     LN   N+LG+ + +TDIE M FS
Sbjct: 134 LFHPKAADDGCVVILFENDVICLFDLR----KSEKLFLNKTANKLGIETRVTDIEDMEFS 189

Query: 174 KDGLALYLLNSSEGGDVYALYPFLPSVLVIPEQHLEMCFYKSCINYENLSSDDSPTVKRN 233
           +DGL LY+L+ ++GGD+YA YP LP  L + +  LE  F KS I Y++L S  S  V++N
Sbjct: 190 QDGLTLYMLSVTDGGDIYAFYPCLPPKLSLKKSVLEDLFNKSRILYDSLDSTVSIEVRKN 249

Query: 234 VIKQLQFVSRLHKQYKSETVDKARNGDLVFNIQESYRNAKIQGPFTINPFAEKLYSATAT 293
           V+KQ++F++ L    +  + D+ +N  L   I   +R  K QGPFT+ P+ EKLY ATA 
Sbjct: 250 VLKQIKFIASL----RDSSSDETKNSCL--EISNDFRQVKAQGPFTVAPYPEKLYEATAK 303

Query: 294 QITTMPIDEFNELILVYFDNGTILQCFQDLDLSMCWEEIDXXXXXXXXXXXXXDILSGQI 353
           +I T+ I   NEL  + FDNGT+    +DL+LSM W   +             ++    I
Sbjct: 304 EIYTLDIGNNNELFAITFDNGTVTLLLKDLELSMSWNADNYVYNNSFVLIESVEMGPESI 363

Query: 354 ICLTPHKFAVLGPKSFV---------VDSSEWTKALSECINFSNLEVLSQINIKSTITP- 403
             L   K + L  + F+         +D++ W+  +S+CI  S+L  L  ++ KS I+  
Sbjct: 364 KLL---KSSSLTGQMFISQNHSSVRKIDTTAWSFKVSKCITNSDLTSLIDVDFKSKISDL 420

Query: 404 -VNGAFTQAGLWESNGEKQLIFMSDKSVKSITLPEPNKT------KDAVSKTVQ-PVTEV 455
            +       G+W   GE+ ++F+S+ SV S TLPE + +      + + SK ++ PVT+ 
Sbjct: 421 DIKENVDCYGVWSLRGERGILFVSNSSVISRTLPESDSSFVIKLDEMSRSKNIEDPVTK- 479

Query: 456 KYEPVFSQPIGEILLLNKKFQSECSRATQTVIPPHLMDLPLQNDSNEDQLALLTDISKEV 515
           KYE  F+QPI EI+ LN  FQ  C    + +I P      L NDSNE QLA LT+IS ++
Sbjct: 480 KYEVSFTQPISEIMNLNDSFQRICRHPFKKIISPEERQTVLSNDSNETQLATLTEISNDL 539

Query: 516 FSKIIQGQTLGLLIHNRLFEQRYELTRQLERSSEILHKAKCLQERYPDQNSRWEHVSKKQ 575
            S I++GQ+LGL++ NRL+EQ+YELT+QL+ S +++ K   L+  Y D+  RW    KKQ
Sbjct: 540 VSNIVEGQSLGLVLRNRLYEQQYELTKQLKESIQLIEKQSLLKSSYDDKMVRWNKNLKKQ 599

Query: 576 ENIDSRFEKLQSRLNEISSSGKLKDLAISQREMEWFKEIKSQVSLFNKFVMQQQDVKEQL 635
           + +  RF  L   L +I  S ++    IS++E+EWFKE+++Q+  FN FV   ++++EQ+
Sbjct: 600 DELIQRFNALNGNLAKIHESKEISKTPISEKEVEWFKEVRNQILKFNDFVHVHRNMQEQI 659

Query: 636 EFVQSEL----KTAGERRVSKEDVFDWAELQELLSVDSEIIKECNEGLVEAAKELDEKI 690
            F++  L       G+R  S     +WAE +++L  D+ IIKECNE L +A  +LD ++
Sbjct: 660 NFLRKGLSRIESKVGQR--SSHLTSEWAEFKKILETDTNIIKECNEELTKAHTQLDAEV 716

>Skud_10.158 Chr10 complement(296754..298904) [2151 bp, 716 aa] {ON}
           YJL061W (REAL)
          Length = 716

 Score =  394 bits (1013), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 260/712 (36%), Positives = 397/712 (55%), Gaps = 46/712 (6%)

Query: 7   PIFQNISVGKESYPKKLLTTQDGCRVVVIQGDTIRLCSS-GNSQYQIIECGINTVAGAAL 65
           PIFQ  S+     P  + ++ +G RVV IQ + IR C+S   S YQ ++   + +     
Sbjct: 11  PIFQ-ASLSASQSPSYIFSSHNGTRVVFIQDNIIRWCNSLTESSYQSLDFSRHLILDDTF 69

Query: 66  ----NNSGTLLCAYNETELQVIVLPSPF----VSSHGGILKPHTYNIT-----VKSPIKQ 112
               + SG LL  +N  E+ V+ +P  +     +S     +   Y++       +S IK+
Sbjct: 70  RVISSASGDLLGFFNVQEIFVMEVPWGYNNIEEASVQDAFQLFHYSVGQVENGSRSLIKK 129

Query: 113 VQWHPRGKLDSVPVVLHKDDTIAMYELYNEDFQQPTAVLNTMQNQLGVTSHITDIESMCF 172
           V +HP+   DS  VVL +DDTI M+++ N+  Q    VLN   N  G+ + + DI  + F
Sbjct: 130 VLFHPKSYHDSCIVVLKEDDTITMFDILNQ--QHKPIVLNKRSNSFGLDARVNDITDLAF 187

Query: 173 SKDGLALYLLNSSEGGDVYALYPFLPSVLVIPEQHLEMCFYKSCINYENLSSDDSPTVKR 232
           S+DGL LY LN++EGGDV+A YP LP VL++ E+ L     KS + YE+L S    TVKR
Sbjct: 188 SRDGLTLYCLNTTEGGDVFAFYPLLPPVLLLGEKDLGWILNKSLVMYESLDSTTDITVKR 247

Query: 233 NVIKQLQFVSRLHKQYKSETVDKARNGDLVFNIQESYRNAKIQGPFTINPFAEKLYSATA 292
           N+IKQLQ VS+LH+   S+       G +   I E YR  K+QGPFTINPF ++LY  TA
Sbjct: 248 NIIKQLQLVSKLHENLDSQL------GKV--EIDEEYRLVKMQGPFTINPFPDELYEYTA 299

Query: 293 TQITTMPIDEF-NELILVYFDNGTILQCFQDLDLSMCWE-----EIDXXXXXXXXXXXXX 346
             ITT+PID   NE++ V FD+G++   FQDL++SM W+       +             
Sbjct: 300 ANITTIPIDNMQNEIVCVGFDDGSLNLLFQDLEMSMSWDVDNYVHNNSLVLIERIKIQET 359

Query: 347 DILSGQIICLTPHKFAVLGPKSF-VVDSSEWTKALSECINFSNLEVLSQINIKSTIT--- 402
           DI S + +     K  V    S   +DS+ W+  LS CI  S+L  L  +  +S +    
Sbjct: 360 DIKSLKTLPEELGKLYVFSENSVHQLDSTNWSAILSRCIEESDLNALGDVKFESKLENIV 419

Query: 403 ----PVNGAFTQAGLWESNGEKQLIFMSDKSVKSITLPEPNKTK--DAVSKTVQPVTEVK 456
               P N A+     W       L      + ++I+  +  +T   DA +K+ +      
Sbjct: 420 TIEHPSNLAYIS---WNDTSNLVLTARGKLTFQNISNDKELQTTKFDANNKSDRIDAGKH 476

Query: 457 YEPVFSQPIGEILLLNKKFQSECSRATQTVIPPHLMDLPLQNDSNEDQLALLTDISKEVF 516
           YE  F+QPI EIL LN+ FQ  C    + +IPP    +PL+N+++E+QL + T ISKE  
Sbjct: 477 YEMSFTQPINEILSLNESFQKACISPCEKIIPPAYRQMPLKNEASENQLEIFTGISKEFL 536

Query: 517 SKIIQGQTLGLLIHNRLFEQRYELTRQLERSSEILHKAKCLQERYPDQNSRWEHVSKKQE 576
            KII+ Q+LG  I+NR+ EQ++ELTRQL+ +S+I+ K   LQE+   QN +W+    +Q 
Sbjct: 537 QKIIKAQSLGFSIYNRIQEQQFELTRQLQATSKIISKDADLQEKLGAQNKKWDAQVSRQV 596

Query: 577 NIDSRFEKLQSRLNEISSSGKLKDLAISQREMEWFKEIKSQVSLFNKFVMQQQDVKEQLE 636
            +  RF+KL   L++I+ S KL++  I++ EM+WFKEI++Q+  FN FV  Q+ +++ L 
Sbjct: 597 KLMERFKKLTENLSQIAESKKLREKNINRGEMKWFKEIRNQILQFNNFVRSQKSLQQDLS 656

Query: 637 FVQSELKT--AGERRVSKEDVFDWAELQELLSVDSEIIKECNEGLVEAAKEL 686
           +++ EL    A   +  ++   +W EL+++L  DS+IIKECNE L+  +++L
Sbjct: 657 YMKKELTRIEAETIKTDEKTQNEWDELRKMLEEDSKIIKECNEELMHVSQQL 708

>Kpol_1035.24 s1035 complement(57897..60050) [2154 bp, 717 aa] {ON}
           complement(57897..60050) [2154 nt, 718 aa]
          Length = 717

 Score =  373 bits (958), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 255/724 (35%), Positives = 394/724 (54%), Gaps = 48/724 (6%)

Query: 1   MSAEDHPIFQNISVGKESYPKKLLTTQDGCRVVVIQGDTIRLC-SSGNSQYQIIECGINT 59
           MS E +PIF+  SV +E   +   +  +G R+++ Q  TIR   SS N  YQ +    + 
Sbjct: 1   MSFELNPIFKRPSVSRELTKRFFFSANNGTRIILFQDSTIRWSFSSDNDHYQSMALRDSD 60

Query: 60  --VAGAALNNSGTLLCAYNETELQVIVLP------SPFVSSHGGILKPHTYNITV-KSPI 110
             V GA +++ G  LC YN  +++VI +P          +S    L+   YN    K  +
Sbjct: 61  MDVTGAIISDPGDYLCLYNSHQIRVIEIPWGLTNVDEISNSMASSLQERVYNFNEDKLSV 120

Query: 111 KQVQWHPRGKLDSVPVVLHKDDTIAMYELYN----EDFQQPTAVLNTMQNQLGVTSHITD 166
           KQV +HP  K     VVL     IA  +L N     D      +  T  N +G+ + + +
Sbjct: 121 KQVLFHPLSKSSPFLVVLFSGSQIAFVDLKNVFKSSDIPIDCFLNLTDSNVMGIDNRVEN 180

Query: 167 IESMCFSKDGLALYLLNSSEGGDVYALYPFLPSVLVIPEQHLEMCFYKSCINYENLSSDD 226
           I+ + F+ D L+LY L  +   DVY  YP LP V  + +  ++    KS + YENL  D 
Sbjct: 181 IQYVVFADDCLSLYSLTDT---DVYCFYPCLPPVASLSKNRVDELINKSIVLYENLGIDA 237

Query: 227 SPTVKRNVIKQLQFVSRLHKQYKSETVDKARNGDLVFNIQ--ESYRNAKIQGPFTINPFA 284
              V++NVIKQLQ  S L K  K E  + A NG++  N++    +R  K QG F+I+P+ 
Sbjct: 238 DDIVRKNVIKQLQLASSLRK--KIEEFENA-NGEVEVNVEIDLEFRQTKAQGYFSISPYP 294

Query: 285 EKLYSATATQITTMPIDEFNELILVYFDNGTILQCFQDLDLSMCWEEIDXXXXXXXXXXX 344
           E LY+ T  QI+ +PI E NEL LV FDNGT+L  F+D + +M W+  D           
Sbjct: 295 ESLYTCTGKQISVLPIGEGNELFLVSFDNGTVLVVFKDKESTMSWDVNDYSFNNSFTLVE 354

Query: 345 XXDI----LSGQIICLTP-HKFAVLGPKS-FVVDSSEWTKALSECINFSNLEVLSQINIK 398
                   LS  ++      KF V G KS  +VD+++W+  +S+CI  ++L  L  + +K
Sbjct: 355 IIKFKPEELSNMVVLQGELGKFVVSGEKSTILVDTTKWSSVISKCIRDNDLRPLVGLEMK 414

Query: 399 STITPVNG--AFTQAGLWESNGEKQLIFMSDKSVKSITL--------PEPNKTKDAVSKT 448
           STIT +N        G+W S   K L+ +    V    L        PE   + + +S  
Sbjct: 415 STITHINSDMQINSCGIWNSGEAKSLLLVDTNVVVGYQLFKKEVEFKPE---SAEEISTE 471

Query: 449 VQPVTEVKYEPVFSQPIGEILLLNKKFQSECSRATQTVIPPHLMDLPLQNDSNEDQLALL 508
           ++  T  K    F+ P  E+   N KFQ   S     VIP ++  +P  +++ E+QL +L
Sbjct: 472 LENFTLDK----FTVPENELKAANYKFQEAVSVPYSKVIPANIKQVPFGSNAMEEQLKIL 527

Query: 509 TDISKEVFSKIIQGQTLGLLIHNRLFEQRYELTRQLERSSEILHKAKCLQERYPDQNSRW 568
            DIS++V SKI+QGQ+LGL++++RL EQ+ +L+ QL  +++IL +AK +Q  YP Q S+ 
Sbjct: 528 NDISRDVGSKIVQGQSLGLMLYDRLLEQQDKLSEQLIITNKILIRAKKVQGDYPAQLSKL 587

Query: 569 EHVSKKQENIDSRFEKLQSRLNEISSSGKLKDLAISQREMEWFKEIKSQVSLFNKFVMQQ 628
           +   KKQE+++    K++S LN I  S KLK L +S++E++ FKE++SQ+ LFN FV +Q
Sbjct: 588 DEKLKKQEHLEKILLKMESNLNTIQESQKLKSLPLSEKEIQLFKELRSQILLFNNFVHKQ 647

Query: 629 QDVKEQLEFVQSELKT---AGERRVSKEDVFDWAELQELLSVDSEIIKECNEGLVEAAKE 685
           +D K+ ++F++ EL+          SK  + +W EL+++L+ D++IIKECNE L + +KE
Sbjct: 648 KDQKQNIQFLKKELQKIIDISRSESSKGMLNEWEELRQILADDAKIIKECNEQLTQISKE 707

Query: 686 LDEK 689
           LD K
Sbjct: 708 LDTK 711

>NDAI0G05750 Chr7 (1424856..1427060) [2205 bp, 734 aa] {ON}
           Anc_1.319 YJL061W
          Length = 734

 Score =  372 bits (954), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 238/723 (32%), Positives = 383/723 (52%), Gaps = 47/723 (6%)

Query: 6   HPIFQNISVGKESYPKKLLTTQDGCRVVVIQGDTIRLCSSGNSQYQIIEC-----GINTV 60
           HPIF    +  E   +   T+  G R+V++QG  ++ C+  ++ Y  ++          +
Sbjct: 11  HPIFGTSIITNEDSQRFFFTSHQGTRMVLLQGCILKWCNVIDTTYHSMKVKSIFNNKRKI 70

Query: 61  AGAALNNSGTLLCAYNETELQVIVLPSPFVSSHGGIL---KPHTYNITVKS-------PI 110
               L+ SG  LC Y    + ++ +P  +      +L   +P  Y+I+  +        I
Sbjct: 71  IDVKLSESGDFLCIYTTKTIDILEIPWGYEKIPDELLSKFQPFHYDISSSTSALSSPSDI 130

Query: 111 KQVQWHPRGKLDSVPVVLHKDDTIAMYELYNEDFQQPTAVLNTMQNQLGVTSHITDIESM 170
           KQV +HP+   ++  V+L++D  I   +L +      T  +N     LGV + + DIES+
Sbjct: 131 KQVLFHPKSYHETCLVILYEDSII---QLIDTTASTETITINQPTGTLGVETRVIDIESI 187

Query: 171 CFSKD-GLALYLLNSSEGGDVYALYPFLPSVLVIPEQHLEMCFYKSCINYENLSSDDSPT 229
           CF K  GL LY L+ S+GGD+YALYP LP+ L + ++ +++   KS + Y++L  + S  
Sbjct: 188 CFDKTTGLILYALSISDGGDIYALYPCLPTRLDVSKKEVDLLLQKSIVLYDSLKENMSND 247

Query: 230 VKRNVIKQLQFVSRLHKQY---------KSETVDKARNGDLVFNIQESYRNAKIQGPFTI 280
           VKRNVIKQLQF ++L  Q+         +  T    ++  L+ ++   YR    QGPFTI
Sbjct: 248 VKRNVIKQLQFATKLQGQFLEQLKGEKDEERTRHAQKDLKLILDVDLEYRLVNFQGPFTI 307

Query: 281 NPFAEKLYSATATQITTMPIDEFNELILVYFDNGTILQCFQDLDLSMCWE-----EIDXX 335
           +PF  +LYSATA +   M I+E NEL+++ FD+G++   F+DL+L+M W+       +  
Sbjct: 308 SPFPNELYSATAKESQCMKINENNELLIMTFDDGSVALLFRDLELTMSWDIANYIHDNSF 367

Query: 336 XXXXXXXXXXXDILSGQIICLTPH--KFAVLGPKS-FVVDSSEWTKALSECINFSNLEVL 392
                      DI  G++I    +  KF +L      +V ++ W+  L++ I+ SNL +L
Sbjct: 368 ALVELIKLKPTDI--GRLIIYQDNFGKFFLLSDDVIMLVHTNSWSDKLAKAIDDSNLNIL 425

Query: 393 SQINIKSTIT--PVNGAFTQAGLWESNGEKQLIFMSDKSVKSITLPEPNKTKD----AVS 446
           S+I  +S IT   V G F      + +G++ +IF+S  +V    L + +   +    + S
Sbjct: 426 SEIGFESEITWFDVMGKFNNCTPCKYHGKESIIFVSSDNVFVENLTKKHSMNNIKGSSTS 485

Query: 447 KTVQPVTEVKYEPVFSQPIGEILLLNKKFQSECSRATQTVIPPHLMDLPLQNDSNEDQLA 506
            + +   E +Y+  F QPI E++ LN+ FQ +C      +I P    + L N+SNE QL 
Sbjct: 486 NSNEETAESEYKVTFKQPIDELMTLNELFQKQCRMPFSKLIKPEDRQIELSNESNEIQLE 545

Query: 507 LLTDISKEVFSKIIQGQTLGLLIHNRLFEQRYELTRQLERSSEILHKAKCLQERYPDQNS 566
           +LTD+SKE+ +KII GQTLG  +HNRL EQ+ ELTRQL+ +  +  K  C++ +  +   
Sbjct: 546 ILTDLSKELITKIIDGQTLGFNLHNRLKEQQLELTRQLKHTQIVFEKQDCIKNKNKEILK 605

Query: 567 RWEHVSKKQENIDSRFEKLQSRLNEISSSGKLKDLAISQREMEWFKEIKSQVSLFNKFVM 626
           RW     +   +  R + L  +L  I+ S  L    I+  E+EWFKEI++QV  FN FV 
Sbjct: 606 RWNEQLNRSVKLTDRLQNLNEKLITINDSPNLSSYPITSVELEWFKEIRNQVHKFNSFVH 665

Query: 627 QQQDVKEQLEFVQSELKTAGERRVSKED---VFDWAELQELLSVDSEIIKECNEGLVEAA 683
            Q+D  E+L F++ EL        S  D     +W EL+ +L  DS+IIKECN  L +  
Sbjct: 666 TQRDANEELSFLKKELDRISNDVTSVVDEKSKKEWEELRAILEQDSKIIKECNIELTKTT 725

Query: 684 KEL 686
           + +
Sbjct: 726 ESM 728

>AEL168C Chr5 complement(320121..322142) [2022 bp, 673 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL061W
           (NUP82)
          Length = 673

 Score =  369 bits (948), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 238/694 (34%), Positives = 361/694 (52%), Gaps = 27/694 (3%)

Query: 1   MSAEDHPIFQNISVGKESYPKKLLTTQDGCRVVVIQGDTIRLCSSGNSQYQIIECGINTV 60
           M+ E HPIF   ++G  S+     T  DG ++V      +RL       Y+     ++  
Sbjct: 1   MTGELHPIFNADALGA-SHRLHAHTHGDGTKIVGYYNKHLRLGRFTEQTYKSWHAEVDAK 59

Query: 61  AGAALNNSGTLLCAYNETELQVIVLPSPFVSSHGGILKPHTYNITVKSPIKQVQWHPRGK 120
           A + LN SG+LL  Y +  ++V+      ++            +TV   IKQV WHP   
Sbjct: 60  ASSILNGSGSLLAFYGDHIIEVVDREGKKIT------------LTVNGGIKQVLWHPLAY 107

Query: 121 LDSVPVVLHKDDTIAMYELYNEDFQQPTAVLNTMQNQLGVTSHITDIESMCFSKDGLALY 180
           LDS  VVL   +TI +YEL    +++PT VLN   +QLG++S + DI ++ F+ DGL+LY
Sbjct: 108 LDSCLVVLTGQETIEIYELNEPRYEKPTLVLNEPTSQLGISSRVIDITNIAFAPDGLSLY 167

Query: 181 LLNSSEGGDVYALYPFLPSVLVIPEQHLEMCFYKSCINYENLSSDDSPTVKRNVIKQLQF 240
           L ++SEGGDV+ + P LPS +          + K+   Y  L+ D     K   I+ L+F
Sbjct: 168 LFSTSEGGDVHVICPLLPSRIKADRAKWARQWNKATALYSTLTKDTPDDAKVATIEYLEF 227

Query: 241 VSRLHKQYKSETVDKARNGDLVFNIQESYRNAKIQGPFTINPFAEKLYSATATQITTMPI 300
           V++L +  +    D    G+LV  I E  R    QGP+ I+ F EKLYSA  T++T +P+
Sbjct: 228 VTQLLQAIEKNGSD----GELV--IPEHRRRTISQGPYNIHGFPEKLYSAVGTKLTVVPL 281

Query: 301 DEFN-ELILVYFDNGTILQCFQDLDLSMCWEEIDXXXXXXXXXXXXXDILSGQIICLTPH 359
            E    L+L+ FD+ T +  F   ++ M W +               +  +      T  
Sbjct: 282 GESEAHLLLLSFDDSTNILLFPSTEVLMSWTK---DLKNAYTLMLVEEFTATGTAFATCD 338

Query: 360 KFAVLGPKSFVVDSSEWTKALSECINFSNLEVLSQINIKSTITPVNGAFTQAGLWESNGE 419
             AVLG  S       + +AL +CI   NL  L  IN  S+I  + G F     + + G 
Sbjct: 339 GVAVLGIDSAQRVEIPYLQALEDCIRDCNLAALQDINFTSSICKIPGKFHSVARFNAPGN 398

Query: 420 KQLIFMSDKSVKSITLPEPNKTKDAVSKTVQPVTEVKYEPVFSQPIGEILLLNKKFQSEC 479
           K +I + D   K +   E  K+        QP  E  Y   F   + EIL  NK+ Q   
Sbjct: 399 KGIILVGDHHAKIVPSTEAAKSDTETELDSQPGKEPTYTVCFPNSLEEILNTNKELQRRK 458

Query: 480 SRATQTVIPPHLMDLPLQNDSNEDQLALLTDISKEVFSKIIQGQTLGLLIHNRLFEQRYE 539
            +    ++PP L ++PL +D NE  LA LT+ISKEV  +II  Q+ GLL+HNRL  Q+YE
Sbjct: 459 HQPL-PLVPPALKNIPLNSDLNEQHLATLTNISKEVMDRIILSQSAGLLMHNRLSLQQYE 517

Query: 540 LTRQLERSSEILHKAKCLQERYPDQNSRWEHVSKKQENIDSRFEKLQSRLNEISSSGKLK 599
           L RQ+E  ++I  +   L++     +SR   V K+   +  R   LQS LN I+SS K  
Sbjct: 518 LHRQVETVADICSRHSVLRDSSEAMSSRLTSVLKRDRRLKQRLCMLQSTLNRINSSHKFS 577

Query: 600 DLAISQREMEWFKEIKSQVSLFNKFVMQQQDVKEQLEFVQSELKTAGERR---VSKEDVF 656
           DL +S++E +WF+E+K+Q   FN +V+Q   ++++L F+++EL++  E R     +E+ F
Sbjct: 578 DLPLSKKEADWFRELKNQAISFNDYVLQSAQLRDELAFLKNELESLPEHRQHDRQEEEPF 637

Query: 657 DWAELQELLSVDSEIIKECNEGLVEAAKELDEKI 690
           D+  LQELL +DS+II EC + L  AA+EL+ K+
Sbjct: 638 DFRRLQELLKLDSKIITECTDNLSAAARELERKL 671

>Ecym_6290 Chr6 (543547..545562) [2016 bp, 671 aa] {ON} similar to
           Ashbya gossypii AEL168C
          Length = 671

 Score =  354 bits (908), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 230/698 (32%), Positives = 365/698 (52%), Gaps = 37/698 (5%)

Query: 1   MSAEDHPIFQNISVGKESYPKKLLTTQDGCRVVVIQGDTIRLCSSGNSQYQIIECGINTV 60
           M+ + HPIFQ +   +      +   ++  ++V      +R        ++     I   
Sbjct: 1   MTGDPHPIFQ-VPPFRTLSKLHVHVCKNATQIVTCFDKNLRYARVTEHTFKSKHLDIKHS 59

Query: 61  AGAALNNSGTLLCAYNETELQVIVLPSPFVSSHGGILKPHTYNITVKSPIKQVQWHPRGK 120
             + LNNSGTL+  Y   ++++  +                  + V+  IKQV WHP   
Sbjct: 60  EHSILNNSGTLIAFYGSNDVELFDMDG------------KKSCLRVELGIKQVLWHPLAY 107

Query: 121 LDSVPVVLHKDDTIAMYELYNEDFQQPTAVLNTMQNQLGVTSHITDIESMCFSKDGLALY 180
           LDS  VVL K++TI +YEL   +F  PT VLN    QLG++SH+++I SM FS DGL LY
Sbjct: 108 LDSCLVVLTKENTIELYELAKANFMYPTVVLNEKLPQLGISSHVSEICSMAFSPDGLTLY 167

Query: 181 LLNSSEGGDVYALYPFLPSVLVIPEQHLEMCFYKSCINYENLSSDDSPTVKRNVIKQLQF 240
           LL+  EGGDVYAL+P LPS L I     E  +YK+   YE++  D     K  +I+   F
Sbjct: 168 LLSLEEGGDVYALHPLLPSRLRIKRSFWESQWYKATALYESIDKDTPNEKKIAMIEHFDF 227

Query: 241 VSRLHKQY--KSETVDKARNGDLVFNIQESYRNAKIQGPFTINPFAEKLYSATATQITTM 298
           VS+++K     SE  D         NI E  R    +GPF+I  F E+LY+ TAT++ T+
Sbjct: 228 VSKIYKMIDKDSEFFD--------VNIPEHKRMVTPRGPFSIYGFPEELYNTTATKLITL 279

Query: 299 PI-DEFNELILVYFDNGTILQCFQDLDLSMCWEEIDXXXXXXXXXXXXXDILSGQIICLT 357
           P+ DE   ++++ FD+GTIL  F D++L M W                    +G  I   
Sbjct: 280 PVNDEGAYVLILSFDDGTILSLFPDIELLMSWSR---SLNNACSFVLIEKFRAGGEIFAI 336

Query: 358 PHKFAVLGPKSFVVDSSEWTKALSECINFSNLEVLSQINIKSTITPVNGAFTQAGLWESN 417
               A+L   +  +    + KAL ECI   ++  +  + + S ITP+ G++     W   
Sbjct: 337 ESGVAILEKNNAHIVRFPYLKALGECIKEGDIAPMVDVKLTSDITPLAGSYHTVVTWNEP 396

Query: 418 GEKQLIFMSDKSVKSITLPEPNKTK-DAVSKTVQPVTE--VKYEPVFSQPIGEILLLNKK 474
             K ++F+ +  ++SI    P+     +    V P      KY   F   + E+L  NK 
Sbjct: 397 STKGILFIGNSVIRSI----PDDVGLSSFKPRVDPAISQNGKYTVCFPSTMEELLKTNKA 452

Query: 475 FQSECSRATQTVIPPHLMDLPLQNDSNEDQLALLTDISKEVFSKIIQGQTLGLLIHNRLF 534
            Q    R    ++P    ++PL ++ NE QLA LT IS EV  +II  Q+LG L++NR  
Sbjct: 453 LQHTL-RQPLPLVPLEQKNVPLNSEFNEHQLATLTKISTEVMDRIILAQSLGYLMYNRAA 511

Query: 535 EQRYELTRQLERSSEILHKAKCLQERYPDQNSRWEHVSKKQENIDSRFEKLQSRLNEISS 594
            Q++EL RQLE  S++  ++  L++       R + VSKK   + SR EKLQ  L++++ 
Sbjct: 512 TQQFELCRQLETVSKLNDRSVTLKQNTKSLTCRLDSVSKKDIALRSRLEKLQQSLDKVNE 571

Query: 595 SGKLKDLAISQREMEWFKEIKSQVSLFNKFVMQQQDVKEQLEFVQSELKT--AGERRVSK 652
           S K  +L +S +E  WF+E+K+ V  FN++V+Q   + E+L F++ EL+   +    +  
Sbjct: 572 SPKFNELPLSMKERAWFRELKNDVLAFNEYVLQNSKLCEELNFLKKELELIESNHGNIPN 631

Query: 653 EDVFDWAELQELLSVDSEIIKECNEGLVEAAKELDEKI 690
           E++F++ +LQ+LL++DS++I +CN+ L+ AAK+L+ K+
Sbjct: 632 EELFNFEKLQDLLTLDSKMIGDCNDQLLAAAKDLENKL 669

>TBLA0F01310 Chr6 complement(329569..331797) [2229 bp, 742 aa] {ON}
           Anc_1.319 YJL061W
          Length = 742

 Score =  347 bits (891), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 233/720 (32%), Positives = 375/720 (52%), Gaps = 37/720 (5%)

Query: 6   HPIFQN---ISVGKESYPKKLLTTQDGCRVVVIQGDTIRLCSSGNSQYQ--IIECGINTV 60
           HPIF+     S  +E+ P+   TT    RVVV+Q  +IR C + +  Y    I      +
Sbjct: 18  HPIFKRNYLSSSFQETSPRFFFTTNRDNRVVVVQDGSIRWCYTFSQNYHSYTIASRNFDI 77

Query: 61  AGAALNNSGTLLCAYNETELQVIVLP----SPFVSSHGGILKPHTYNITVKS-PIKQVQW 115
             + ++NSG+ +C Y++T++ ++ +P    +   +S    ++ + Y+    S  +KQV +
Sbjct: 78  KDSLISNSGSFVCYYSDTDISIMEIPWSHSNSVNASSSHCIQKYRYSFKKYSLTVKQVLF 137

Query: 116 HPRGKLDSVPVVLHKDDTIAMYELYNE-DFQQPTAVLNTMQNQLGVTSHITDIESMCFSK 174
           HP   L+S  VVL  DDTI   +     D      +LN     +G++S I+DI+S+ FS+
Sbjct: 138 HPLATLESCLVVLLSDDTIVFIDFSKSFDLLSSDYILNKKSKSIGLSSQISDIQSLTFSQ 197

Query: 175 DGLALYLLNSSEGGDVYALYPFLPSVLVIPEQHLEMCFYKSCINYENLSSDDSPTVKRNV 234
           DGL LY L+SS   DVYA YP LP       + LE    KS + YE L  DD   +K N+
Sbjct: 198 DGLTLYALSSSAATDVYAFYPCLPPSAQFSLEQLENLVNKSVVQYEELREDDPTALKINI 257

Query: 235 IKQLQFVSRLHKQYKSETVDKARNGDLVFNIQESYRNAKIQGPFTINPFAEKLYSATATQ 294
           IKQL+F S L+K+ K    +   +    +++   YR  + QGPFTI+PF + LY ++ T 
Sbjct: 258 IKQLKFTSDLYKKGKRALEEDTDSKTWKYDVPLEYRLIRPQGPFTISPFPDSLYYSSPTH 317

Query: 295 ITTMPIDEFNELILVYFDNGTILQCFQDLDLSMCWEEIDXXXXXXXXXXXXXDILSGQII 354
           I ++PID  NEL+++ F +G+++  FQDL+L+M W++ +                   I 
Sbjct: 318 IVSVPIDTTNELLVLSFSDGSVVSLFQDLELTMSWDQDNFNENNSLVLLELIKTKEQNIR 377

Query: 355 CLTPHK-----FAVLGP-KSFVVDSSEWTKALSECINFSNLEVLSQINIKSTITPVNGA- 407
            LT +      F +LG  K+F V +S W+  L+ CI  S++  LS + IKS I P + A 
Sbjct: 378 KLTTYAHQYGTFYILGSVKNFEVLTSHWSSTLAICIKSSDIRDLSNLLIKSVIKPFDNAA 437

Query: 408 --FTQAGLWESNGEKQLIFMSDKSVKSITLPEPNK--TKDAVSKTVQPVTEVKYEPVFSQ 463
              T  G W S     L+F++  +V  I L E  K    D  +  +      KY P    
Sbjct: 438 YELTSGGWWCSPTISSLLFINKSTV--IELNEKPKLLLSDDTTHLLTSELAQKYIPPLED 495

Query: 464 PIGEILL-----------LNKKFQSECSRATQTVIPPHLMDLPLQNDSNEDQLALLTDIS 512
            I +I L           +N  F+ E ++     IP    ++ L N +NE+QL  LT IS
Sbjct: 496 KIFKIELPMGILISDLNNMNTVFKEESNKQLTIPIPSQERNVTLFNKTNENQLETLTKIS 555

Query: 513 KEVFSKIIQGQTLGLLIHNRLFEQRYELTRQLERSSEILHKAKCLQERYPDQNSRWEHVS 572
           K +  KI  GQ+LG  I+N++ +Q+  +  QL ++  +L K K L  +Y +Q  +    +
Sbjct: 556 KVIGIKISMGQSLGFGIYNKILDQQNIVELQLRQTQRLLEKEKILNTKYNEQADKLRAFT 615

Query: 573 KKQENIDSRFEKLQSRLNEISSSGKLKDLAISQREMEWFKEIKSQVSLFNKFVMQQQDVK 632
           ++QE + SR   +  +L +      L +++IS++E+E+FKEI+ QV LFN+FV +Q+D  
Sbjct: 616 ERQEKLMSRLLIMNEKLKKADLDTNLLNISISKKELEFFKEIRKQVLLFNEFVHKQKDQH 675

Query: 633 EQLEFVQSEL-KTAGERRVSKEDVF-DWAELQELLSVDSEIIKECNEGLVEAAKELDEKI 690
           + L F++ EL +  GE  +  E+ F  W  L+++L  D+  I+ C E +     +LD  +
Sbjct: 676 DTLLFIKKELIRIKGENAIVDENDFKQWDRLRDMLHDDATTIETCTESIKNINFDLDRAL 735

>KNAG0C05840 Chr3 (1135516..1137759) [2244 bp, 747 aa] {ON}
           Anc_1.319 YJL061W
          Length = 747

 Score =  320 bits (821), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 217/712 (30%), Positives = 356/712 (50%), Gaps = 53/712 (7%)

Query: 21  KKLLTTQDGCRVVVIQ--GDTIRLCSSGNSQYQIIECGINTVAGAALN----NSGTLLCA 74
           + + TT  G + V +      +R  S    +Y  +   I+  A  ++N    +SG  LC 
Sbjct: 39  RYVFTTDKGTKYVYLDKTNGLLRWGSVSEDEYNSMPLKISNFADKSVNVILSDSGEFLCV 98

Query: 75  YNETELQVIVLPSPFVSSH--GGILKPHTYNITVKSPIKQVQWHPRGKLDSVPVVLHKDD 132
           Y++  + VI +P  + +      + +     I   S IK+V +HPR    +  V+L +DD
Sbjct: 99  YSKDCVTVIEVPWRYRNPEEMSYVFQTSFKEIRKDSFIKKVLFHPRAIKKTCMVILFEDD 158

Query: 133 TIAMYELYNEDFQQPTAVLNTMQNQLGVTSHITDIESMCFSKDGLALYLLNSSEGGDVYA 192
           TI ++++ + +       LN     +G+   IT I  + FS+DGL LY+L++ + GDVYA
Sbjct: 159 TIYLFDVEDNN----KIALNVPSGNIGIEDRITSIADIEFSQDGLTLYVLSAEDCGDVYA 214

Query: 193 LYPFLPSVLVIPEQHLEMCFYKSCINYENLSSDDSPTVKRNVIKQLQFVSRLHKQYKSET 252
           +YP LP +L + ++ L+    +S + Y++L+      VK+ VIKQ++F+S+L  Q  S  
Sbjct: 215 IYPCLPPILAMSQKELKSLMNRSVLLYDSLTETTPSAVKKGVIKQVEFISQL--QNISHG 272

Query: 253 VDKARNGDLVFNIQESYRNAKIQGPFTINPFAEKLYSATATQITTMPIDEFNELILVYFD 312
            ++  N   V  I   YR AK QGPFTI PF EKLYSATAT+I  + I   NE++ + +D
Sbjct: 273 KEEISN---VLEIDTIYRLAKPQGPFTIAPFPEKLYSATATEICPLNIGGGNEILCIAYD 329

Query: 313 NGTILQCFQDLDLSMCWEEIDXXXXXXXXXXXXXDILSGQIICLTPHKFAVLG------- 365
           NGT L  F+DL+LSM W+                D+ +   + +    F + G       
Sbjct: 330 NGTALFLFKDLELSMAWDVGGIYYNNSLVLMEEFDLQTESAVSIL-KSFKMDGLILFKVS 388

Query: 366 --------PKSFV---------------VDSSEWTKALSECINFSNLEVLSQINIKS--- 399
                    KSF+               VD+  W+  +S+CI+  ++  L  ++ KS   
Sbjct: 389 DSVQHIDVSKSFIQDGDLLVQQSSMIRCVDTKAWSSVVSDCIDRHDINALITVSFKSKGH 448

Query: 400 TITPVNGAFTQAGLWESNGEKQLIFMSDKSVKSITLPEPNKTKDAVSKTVQPVTEVKYEP 459
           T        T  G W   G + + ++++KSV    L +    K   S + +   +   +P
Sbjct: 449 TWAIAGSDITSCGAWNHGGTEGVTWITNKSVTCKELKKQVSWKPEQSTSSEKKKQAFPKP 508

Query: 460 VFSQPIGEILLLNKKFQSECSRATQTVIPPHLMDLPLQNDSNEDQLALLTDISKEVFSKI 519
            FS PI E+  LN  +Q  C      +I P     PL N SNE QL ++T +S  + + +
Sbjct: 509 EFSVPISELNALNINYQDTCRIGFHDIISPLDRQKPLLNPSNEKQLQVMTSLSNYLLATV 568

Query: 520 IQGQTLGLLIHNRLFEQRYELTRQLERSSEILHKAKCLQERYPDQNSRWEHVSKKQENID 579
            +GQ LG+ ++NRL EQ+ ELT+QL+ S++IL K   + ++  +Q S W     KQ  + 
Sbjct: 569 GKGQGLGMTLYNRLLEQQLELTKQLQCSNKILMKQPAIAKKLEEQKSVWNEKLAKQNKLK 628

Query: 580 SRFEKLQSRLNEISSSGKLKDLAISQREMEWFKEIKSQVSLFNKFVMQQQDVKEQLEFVQ 639
            RF  LQ +L  I  + K  DL I+  E  WFKE+K +   FN  V +Q+ V++ L F++
Sbjct: 629 ERFSSLQQKLAAIDKTKKSTDLVITDEESVWFKEVKKEALTFNDLVYKQESVQDDLRFLK 688

Query: 640 SELKT--AGERRVSKEDVFDWAELQELLSVDSEIIKECNEGLVEAAKELDEK 689
            EL T  +  +R+      +W  LQE+L  DS +++   +   +A+ ++  +
Sbjct: 689 RELSTFVSDSQRLPGTANTEWHSLQEMLKHDSLLLRADKKDKKDASSQVSRR 740

>TPHA0O01460 Chr15 complement(293395..295560) [2166 bp, 721 aa] {ON}
           Anc_1.319 YJL061W
          Length = 721

 Score =  317 bits (811), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 216/722 (29%), Positives = 387/722 (53%), Gaps = 44/722 (6%)

Query: 1   MSAEDHPIFQNISVGKESYPKKLLTTQDGCRVVVIQGDTIR--LCSSGNSQYQIIECGIN 58
           +S + H IF   SVGK S  +  +T  +G ++++ Q +T+R    +  +  ++ I     
Sbjct: 2   VSPQLHTIFNRFSVGKVSSKRSSITVDNGLKIILYQNNTVRYGFVNDADGNFKSITLEKE 61

Query: 59  TVAGAAL--NNSGTLLCAYNETELQVIVLPSPFVSSH-------GGILKPHTYNI-TVKS 108
            +   ++  +  G  LC +NE E++VI LP     +          +++  +Y++ +  +
Sbjct: 62  MIGDVSIIADQIGNYLCLFNEFEIRVIELPWKLWDAKEDSSFQLDNMVQIRSYDLKSFGT 121

Query: 109 PIKQVQWHPRGKLDSVPVVLHKDDTIAMYELYN--EDFQQPTAVLNTMQNQ--LGVTSHI 164
            I+++ +HP G      VVL K+  I   ++    +  + P+  + T   +  +G++S I
Sbjct: 122 TIQKILFHPLGLAYPCLVVLLKNSNICSIDIKRILKVEEIPSTCITTFHTKGVMGLSSCI 181

Query: 165 TDIESMCFSKDGLALYLLNSSEGGDVYALYPFLPSVLVIPEQHLEMCFYKSCINYENLSS 224
            DI  + FS D L+LY L  +   D+Y  YPFL   + + +  ++  F KS I +ENL +
Sbjct: 182 DDIIDISFSSDKLSLYALTET---DIYLFYPFLIPTISVTKNEIDQLFQKSIILFENLEN 238

Query: 225 DDSPTVKRNVIKQLQFVSRLHKQYKSETVDKARNGD--LVFNI--QESYRNAKIQGPFTI 280
           D S  V+RN+IKQLQ +S L    K++ + + +N D   ++NI     YR+   QG F+I
Sbjct: 239 DSSEAVRRNIIKQLQLLSTLSGDIKTQ-MKQVKNTDETKIYNIDINTEYRSVNAQGSFSI 297

Query: 281 NPFAEKLYSATATQITTMPIDEFNELILVYFDNGTILQCFQDLDLSMCWEEIDXXXXXXX 340
            PF E+LY  +A  ++ + I   NEL ++ +D+GT+L  ++DL+ SM W+  D       
Sbjct: 298 APFPEELYKQSAVNLSVIQIGHGNELYVITYDDGTVLILYRDLESSMSWDSNDYTFNNSF 357

Query: 341 XXXXXXDILSGQI--ICLTPHK---FAVLGPKSF-VVDSSEWTKALSECINFSNLEVLSQ 394
                      +   I   P K   FA+ G ++  ++D+S W+  LS+CI  +++  L+ 
Sbjct: 358 ILLEKLKFNPDETKSILDIPFKNGIFAIAGDQTVNLIDTSCWSDILSQCIKDNDIRNLAG 417

Query: 395 INIKSTITPVNGAF--TQAGLWESNGEKQLIFMSDKSVKSITLPEPNKTKDAVSKTVQPV 452
           ++I+S    +N         LW  + +K+L+F+++  + S  + E N  + A    V  +
Sbjct: 418 LSIESHKQTINTLEEPNSCILWNEHNKKELLFITETKLISSDILESN-NESAEKLPVPAI 476

Query: 453 TEVK-YEPV----FSQPIGEILLLNKKFQSECSRATQTVIPPHLMDLPLQNDSNEDQLAL 507
            ++K  E +    +SQPI EI +  ++++  C      VIP ++   P  ND NEDQLA 
Sbjct: 477 NDIKKIEKLQLKNYSQPIKEINIAVQRYKDSCKVPYSKVIPANIRQKPFANDENEDQLAY 536

Query: 508 LTDISKEVFSKIIQGQTLGLLIHNRLFEQRYELTRQLERSSEILHKAKCLQERYPDQNSR 567
           +T+IS+E+ SKI+QGQT+ L++H RL EQ+     QL  +++ L   K +++ Y  Q+++
Sbjct: 537 ITEISQEIGSKILQGQTIALMMHTRLREQQDVFAEQLMHTNKELLHNKTIKQTYDIQSTK 596

Query: 568 WEHVSKKQENIDSRFEKLQSRLNEISSSGKLKDLAISQREMEWFKEIKSQVSLFNKFVMQ 627
            +H++++   ++ R  KL   + +I  S + K++ I+  E + FKEIK QV +FN  V +
Sbjct: 597 IKHITERNTKLNERTSKLIEMMEKIKQSQQYKNMPINDSESKLFKEIKKQVLIFNDAVNR 656

Query: 628 QQDVKEQLEFVQSELKTAGERRVSKEDVF------DWAELQELLSVDSEIIKECNEGLVE 681
           QQ+ +E ++F+Q+EL    E+     D        +W EL +LL+ D++II++CN  L  
Sbjct: 657 QQEQQEAIKFLQTELNNIIEQPAQSHDAIIDSDEDEWNELCDLLNRDAKIIEDCNAELSS 716

Query: 682 AA 683
           A+
Sbjct: 717 AS 718

>CAGL0J05214g Chr10 complement(501919..504069) [2151 bp, 716 aa]
           {ON} similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061w NUP82 nuclear pore protein
          Length = 716

 Score =  261 bits (667), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 189/683 (27%), Positives = 331/683 (48%), Gaps = 36/683 (5%)

Query: 23  LLTTQDGCRVVVIQG-DTIRLCSSGNSQYQIIECGI---NTVAGAALNNSGTLLCAYNET 78
           L ++ DG ++V I     +R C S ++ Y+ ++  +     V GA  + +   +C YN  
Sbjct: 22  LFSSSDGTKIVSIADRGHLRWCHSTSTTYKSLDFDLQFEGKVEGAVSSTTADYVCIYNRD 81

Query: 79  ELQVIVLPSPFVSSHGGI---LKPHTYNITVKSPIKQVQWHPRGKLDSVPVVLHKDDTIA 135
           EL V+ +P  +     G+      +++       IKQV +HP+  LDS  +VL  DD+I 
Sbjct: 82  ELHVLEVPWMYSGEENGLKHLCHIYSHKFDENHSIKQVLFHPKSYLDSTILVLTNDDSIF 141

Query: 136 MYELYNEDFQQPTAVLNTMQNQLGVTSHITDIESMCFSKDGLALYLLNSSEGGDVYALYP 195
           M    +    +    LN+  + LG+   I DI+ + FS+DGL+L +L++ EG D++ +YP
Sbjct: 142 MINTDDNRSDKNMINLNSKNSALGLYDRINDIQKIIFSQDGLSLLILSAEEGCDIFTIYP 201

Query: 196 FLPSVLVIPEQHLEMCFYKSCINYENLSSDDSPTVKRNVIKQLQFVSRLHKQYKSETVDK 255
            LP    I    ++  F KS + Y N++ + +P  KRN++KQL F+ ++  Q  +     
Sbjct: 202 CLPRRWDISLHEVDTLFAKSLLLYNNMNVNTTPQEKRNIVKQLNFMEKIRGQKTA----- 256

Query: 256 ARNGDLVFNIQESYRNAKIQGPFTINPFAEKLYSATATQITTMPIDEFNELILVYFDNGT 315
            RN      ++++Y NA+ QGPF++ P+  +LY   AT I  + I +   L+ + F NGT
Sbjct: 257 FRNDKKPLILEDAYLNAQPQGPFSMTPYPNELYDFMATDINIIQITQNISLLAIAFSNGT 316

Query: 316 ILQCFQDLDLSMCWE--EIDXXXXXXXXXXXXXDILSGQIICLTP---HKFAVLG--PKS 368
           +L    DL+  M W+                  +I         P    KF V      +
Sbjct: 317 VLLFLSDLEPIMSWDISRFPGSNSLALLEQIKLEITDNAKFLSIPGTYGKFVVTDNVKSN 376

Query: 369 FVVDSSEWTKALSECINFSNLEVLSQINIKSTITPVN---GAFTQAGLWESNGEKQLIFM 425
           F V++ +W+  L++ I+ S++++L+ + +KS I  +      F     W++        +
Sbjct: 377 FFVNTCDWSTILAQIIDDSDIKLLANLKVKSNIENLQQLATTFKSIIYWKNENISCNYII 436

Query: 426 SDKSVKSITLPE------PNKTKDAVSKTVQP---VTEVK---YEPVFSQPIGEILLLNK 473
           SDK ++ + + +       +K  D  +  V+    + E+K   YE  F++P+ EI    +
Sbjct: 437 SDKKIEELDMLDGISSTTKHKLIDQSNSQVESKLDLPELKNGLYEVKFARPLTEIQHYEQ 496

Query: 474 KFQSECSRATQTVIPPHLMDLPLQNDSNEDQLALLTDISKEVFSKIIQGQTLGLLIHNRL 533
            +         T IP  +   PL+N SNE+QL  LT IS+     I   QTLG +   R+
Sbjct: 497 IYYKNLQNQNFTKIPLEIRSAPLKNSSNENQLESLTKISESYMKMISMAQTLGYIYRKRM 556

Query: 534 FEQRYELTRQLERSSEILHKAKCLQERYPDQNSRWEHVSKKQENIDSRFEKLQSRLNEIS 593
            +   E +RQ+E + +I       ++    QN++ + V +KQ+ +  R   L  ++    
Sbjct: 557 IDSIEEFSRQIETTYQINKFWDNFEQIREVQNTKIDKVKEKQQKLMERLSSLYDKVEGQK 616

Query: 594 SSGKLKDLAISQREMEWFKEIKSQVSLFNKFVMQQQDVKEQLEFVQSELKTAGERR--VS 651
             G + +  IS  E EWF EIK  V  FN +V +     ++LEF++ +      ++  +S
Sbjct: 617 EMGSMNNSNISAAESEWFAEIKRSVIEFNSYVRKASTNHQELEFIKEQQAQIANQKPDIS 676

Query: 652 KEDVFDWAELQELLSVDSEIIKE 674
            E+  +W +LQ+LL  D +II E
Sbjct: 677 SENGKEWNDLQQLLRTDLKIISE 699

>KLLA0F01661g Chr6 complement(156609..158672) [2064 bp, 687 aa] {ON}
           weakly similar to uniprot|P40368 Saccharomyces
           cerevisiae YJL061W NUP82 Subunit of the nuclear pore
           complex (NPC) forms a subcomplex with Nup159p and Nsp1p
           interacts with Nup116p and is required for proper
           localization of Nup116p in the NPC
          Length = 687

 Score =  209 bits (531), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 182/712 (25%), Positives = 325/712 (45%), Gaps = 71/712 (9%)

Query: 8   IFQNISVGKESYPKKLLTTQDGCRVVVIQGDTIRLCSSGNSQYQIIECGINTVA-GAALN 66
           IFQ +S+     P   L   +   + + Q + +R+ S   +QY+     +  V     ++
Sbjct: 12  IFQEVSLN----PSDRLVCNNSNTIYLWQDNILRVQSDHETQYRSYNVELPFVPEQMVIS 67

Query: 67  NSGTLLCAYNETELQVIVLPSPFVSSHGGILKPHTYNITVKSPIKQVQWHPRGKLDSVPV 126
            SG L+  +  +EL V+ +      +    L+ H +N ++   IK++ WHP        V
Sbjct: 68  PSGGLVAFHANSELYVMEV------NEQSRLRKH-FNTSLG--IKKLLWHPLATYGLSFV 118

Query: 127 VLHKDDTIAMYELYNEDFQ-QPTAVLNTMQNQLGVTSHITDIESMCFSKDGLALYLLNSS 185
           +LH D TI +Y+L  ED + +   V N      G++ H+  +  + F   GL LYLL+S 
Sbjct: 119 ILHDDSTIRIYDL--EDLEPESITVFNRKSRSFGLSDHVESVCDIAFDPTGLTLYLLSSF 176

Query: 186 EGGDVYALYPFLPSVLVIPEQ-------------------HLEMCFYKSCINYENLSSDD 226
              D+YA++P LP    +                      H  +  Y S      L S  
Sbjct: 177 NYCDIYAIHPCLPKNFSLRSNDTSNVTSRTKNGSLADYMLHKSLSLYNSLDKQLKLISGS 236

Query: 227 SP-------TVKRNVIKQLQFVSRLHKQYKSETVDKARNGDLVFNIQESYRNAKIQGPFT 279
            P       T+K +++KQ+QF     K    +T              ++ RN+  QGPF 
Sbjct: 237 DPDVESDYLTLKHDLLKQIQFFDNYKKNDGIDTF-----------TSKAIRNSVPQGPFI 285

Query: 280 INPFAEKLYSATATQITTMPIDEFNELILVYFDNGTILQCFQDLDLSMCWEEIDXXXXXX 339
           I  F   L +   T +T +P+ E   L+ + F +GT +  F D ++ M W          
Sbjct: 286 IKKFPTALNAKEVTGLTIIPVGERLGLLNLQFIDGTNVVLFSDSEIVMSWSLRSNTTFNN 345

Query: 340 XXXXXXXDILSG-QIICLTPHKFAVLGPKSFVVDSSEWTKALSECINFSNLEVLSQINIK 398
                  +     Q++  +  K    G  S  +    W + L++CI   +  ++  +  +
Sbjct: 346 LSVITMFNAKGQCQLLNSSEPKLVFTGDSSTTIMEMPWLEPLAQCIRLHDFSIIDDVKFE 405

Query: 399 STITPVNGAFTQAGLWESNGEKQLIFMSDKSVKSITLPEPNKTKDAVSKTVQPVTEVKY- 457
           + I  V+G F    L   +G+   I  +  S K I   + + T+  +++T     EVKY 
Sbjct: 406 NKIRTVSGTFLGV-LSTLSGD---ILYNGNSFKVIESNDKSTTQKPINRT----DEVKYT 457

Query: 458 -EPVFSQPIGEILLLNKKFQSECSRATQTVIPPHLMDLPLQNDSNEDQLALLTDISKEVF 516
            +P       E+ +L  K+++E +    + IP  L  LPL+N+SNE QL +++++ KE  
Sbjct: 458 YKPSLPTSGKELDMLLTKYKTEAN-GFISGIPDSLAPLPLKNNSNERQLEVVSELYKETM 516

Query: 517 SKIIQGQTLGLLIHNRLFEQRYELTRQLERSSEILHKAKCLQERYPDQNSRWEHVSKKQE 576
            ++  GQ +   + N+  E+  EL RQL +++EI      L     D   R+    +K +
Sbjct: 517 KRVKLGQMILFRMFNKSNEEVAELHRQLRKTNEIEMLRNKLNGNLGDLQERYSRYEEKSK 576

Query: 577 NIDSRFEKLQSRLNEISSSGKLKDLAISQREMEWFKEIKSQVSLFNKFVMQQQDVKEQLE 636
            ++ R +KL+   + I ++ KL+  +IS+ E+ WFK IK+QV  FN +V     ++E+LE
Sbjct: 577 TLEKRLDKLKETFSSIENNEKLRTSSISEAELVWFKSIKNQVLKFNNYVHLTNKLREELE 636

Query: 637 FVQSELK--TAGERRVSKEDVFDWAELQELLSVDSEIIKECNEGLVEAAKEL 686
           F+ ++L+  T G+   S+    +++ LQ++L  D ++I  C   L  + ++L
Sbjct: 637 FLDTQLRSTTKGDDFFSE---LEFSSLQQMLLNDKKVINSCMNELSASIEDL 685

>KLLA0A08800g Chr1 (770989..772308) [1320 bp, 439 aa] {ON} similar
           to uniprot|P39706 Saccharomyces cerevisiae YAR003W SWD1
           Subunit of the COMPASS complex which methylates histone
           H3 on lysine 4 and is required in transcriptional
           silencing near telomeres
          Length = 439

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 54/114 (47%), Gaps = 24/114 (21%)

Query: 83  IVLPSPFVSSHGGILK--PHTYNITVKSPIKQV--QWHPRGKLDSVPVVLHKDDTIAMYE 138
           ++L  PF     G+LK  P     T++ P+  V  ++ PRG   +V      +  I +Y+
Sbjct: 4   LLLQDPF-----GVLKEYPEKLTHTLEVPVAAVCVKFSPRGDYLAVGC---SNGAIIIYD 55

Query: 139 LYNEDFQQPTAVLNTMQNQLGVTSHITDIESMCFSKDGLALYLLNSSEGGDVYA 192
           +   D  +P A+L T        +H   ++S+C+S DG  L+    S G D YA
Sbjct: 56  M---DSLKPIAMLGTHSG-----AHTRSVQSVCWSNDGRYLW----SSGRDWYA 97

>ZYRO0D08382g Chr4 (724961..728035) [3075 bp, 1024 aa] {ON} similar
           to uniprot|P11655 Saccharomyces cerevisiae YNR026C SEC12
           Guanine nucleotide exchange factor (GEF) glycosylated
           integral membrane protein of the endoplasmic reticulum
           important for the initiation of transport vesicle
           budding from the endoplasmic reticulum through
           activation of the GTPase Sar1p
          Length = 1024

 Score = 35.0 bits (79), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 49/108 (45%), Gaps = 6/108 (5%)

Query: 295 ITTMPIDEFNEL-ILVYFDNGTILQCFQDLDLSMCWEEIDXXXXXXXXXXXXXDILSGQI 353
           +T M +D  NEL +L   DN   +   +DL L   ++++               +++   
Sbjct: 264 VTAMDVDHKNELAVLAGSDNSLAIVKLKDLSLGRTFKQVHSFAITRVSFSSDSGLIASVS 323

Query: 354 ICLTPHKFAVLGPKSFVVDSSEWTKALSECINF---SNLEVLSQINIK 398
              T H   V  P++F   +S W+K L   +NF   + L  L+QI++K
Sbjct: 324 AANTVHVIKV--PENFAQSTSIWSKLLKLLLNFVFIALLAFLAQISLK 369

>KLLA0B05885g Chr2 complement(530762..532738) [1977 bp, 658 aa] {ON}
           conserved hypothetical protein
          Length = 658

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 39/77 (50%), Gaps = 6/77 (7%)

Query: 238 LQFVSRLHKQYKSETVDKARNGDLVFNIQESYRNAKIQGPFTINPFAEKLYSATATQITT 297
           ++ ++++  Q+  +  DK  + D + NI++ Y  AK+     IN F + L+S     + T
Sbjct: 370 IELITKMETQFNKD-ADKCNDEDALMNIKDKYNLAKL----FINEFNDMLFSTRGVNMNT 424

Query: 298 MPIDEFNELILVYFDNG 314
           +   E+ + IL  F N 
Sbjct: 425 LATREYTD-ILTRFANS 440

>KAFR0L00560 Chr12 (102072..105842) [3771 bp, 1256 aa] {ON}
           Anc_7.154 YER008C
          Length = 1256

 Score = 33.5 bits (75), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 55/109 (50%), Gaps = 12/109 (11%)

Query: 576 ENIDSRFEKLQSRLNEISSSG-----KLKDLA--ISQREMEWFKEIKSQVSLFNKFVMQQ 628
           ++ D+  EKL+S+L E   S      +L+D A  +S  EM+  KE       F+ F+M+ 
Sbjct: 563 DDADTLLEKLESKLTETEQSFYNNMLQLQDSAPKLSAFEMDVTKECDKLNPSFSIFLMEM 622

Query: 629 QDVKEQLEFVQSELKTAGERRVSKEDVFDWAELQELL---SVDSEIIKE 674
            +V E +E+V+S+    G +  S      W  L EL+   S+D   +KE
Sbjct: 623 NNVSEDIEYVESQ--QNGLQVESANKKLLWNTLSELINTVSLDEGTLKE 669

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] {ON}
            some similarities with uniprot|Q02455 Saccharomyces
            cerevisiae YKR095W MLP1 Myosin-like protein associated
            with the nuclear envelope, connects the nuclear pore
            complex with the nuclear interior; involved in the Tel1p
            pathway that controls telomere length; involved in the
            retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 54/105 (51%), Gaps = 11/105 (10%)

Query: 537  RYELTRQLERSSEILHK--------AKCLQERYPDQNSRWEHVSKKQENIDSRFEKLQSR 588
            + E  R  ERS EILHK         K L+E+     ++ +  +K+ + +D RF +L+ +
Sbjct: 1295 KEEANRWKERSQEILHKHDRIDPEDHKELKEKVSILETKLDETNKENKELDDRFNRLKKQ 1354

Query: 589  LNEISSSGKLKDLAISQREMEWFKEIKSQVSLFNKFVMQQQDVKE 633
             +E  +S K+    +S  ++   +E KS+  L  KF  +++ V E
Sbjct: 1355 AHEKLNSSKIAQTTLSN-QLNELREAKSE--LEGKFEAEERKVHE 1396

>Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} similar to
            Ashbya gossypii AEL337
          Length = 1097

 Score = 32.7 bits (73), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 65/146 (44%), Gaps = 32/146 (21%)

Query: 549  EILHKAKCLQERYPDQNSRWEHVSKKQ---------------ENIDSRFEKLQSRLNEIS 593
            + L   K LQE+ P Q  R   + +K                ENI +RF KL   LN + 
Sbjct: 897  QTLSDIKYLQEKLPGQVKRLSSIRRKMWSIRSELEPRLDEIVENISTRFRKL--FLN-VG 953

Query: 594  SSGKLKDLAISQREMEWFKEIKSQVSLFNKFVMQQQDVKEQLEFVQSELKTAGERRVSKE 653
            S+G++  L       EW  EIK       KF    +DV E L+ + S +++ GER VS  
Sbjct: 954  SAGEVC-LVKPDLYSEWKIEIKV------KF----RDVAE-LKKLDSHIQSGGERAVS-- 999

Query: 654  DVFDWAELQELLSVDSEIIKECNEGL 679
             V     LQE  +    ++ E N+G+
Sbjct: 1000 TVLYMISLQEFTNAPFRVVDEINQGM 1025

>ZYRO0G13838g Chr7 (1107010..1107957) [948 bp, 315 aa] {ON} weakly
           similar to uniprot|Q03760 Saccharomyces cerevisiae
           YML107C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the nuclear
           periphery
          Length = 315

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 9/69 (13%)

Query: 615 KSQVSLFNKFVMQQQDVKEQLEFVQSELKTAGERRVSKEDVFDWAELQELLSVDSEIIKE 674
           K+Q  L N++ +Q  ++  +LE +          RVSKE      +LQ L  +D E +K 
Sbjct: 186 KNQFDLVNEYYLQSWNLVRELERI-------SRSRVSKESALFSGKLQSLFQIDDESLKL 238

Query: 675 CNEG--LVE 681
           C +G  LVE
Sbjct: 239 CLQGYELVE 247

>Kpol_499.19 s499 complement(58176..59234) [1059 bp, 352 aa] {ON}
           complement(58176..59234) [1059 nt, 353 aa]
          Length = 352

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 58/116 (50%), Gaps = 7/116 (6%)

Query: 571 VSKKQENIDSRFEKLQSRLNEISSSGKLKDLAISQREMEWFKEIKSQVSLFNKFVMQQQD 630
           + K  +N++  + K+  R   +SS+GK K+LAI     ++ KE+    SL         D
Sbjct: 76  LKKSLKNVNKSYAKIMKRRTILSSNGKNKNLAIVD---DFNKEVDGLESLITGLKETVHD 132

Query: 631 VKEQLEFVQSELKTAGERRVSKEDVFD--WAELQELLSVD-SEIIKECNEGLVEAA 683
           + + L    S+LK +  + V+KE++    +  L E+L  D + I KE N   V+ A
Sbjct: 133 MIDDLVTADSQLK-SNNKSVTKEEINSQHYPLLFEILQKDYNHIFKESNNLSVQDA 187

>NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa]
           {ON} Anc_3.167
          Length = 592

 Score = 31.6 bits (70), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 21/34 (61%)

Query: 219 YENLSSDDSPTVKRNVIKQLQFVSRLHKQYKSET 252
           Y N+S  DS   K+N +K  +F  +LH++ KS T
Sbjct: 174 YNNVSDSDSAKRKKNTLKLTRFFKKLHEEVKSAT 207

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 72,325,692
Number of extensions: 3158077
Number of successful extensions: 12188
Number of sequences better than 10.0: 209
Number of HSP's gapped: 12630
Number of HSP's successfully gapped: 231
Length of query: 690
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 573
Effective length of database: 40,065,477
Effective search space: 22957518321
Effective search space used: 22957518321
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)