Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0D01760g8.829ON38138118590.0
KLLA0D01639g8.829ON38138115590.0
YMR272C (SCS7)8.829ON38438114220.0
ZYRO0G13948g8.829ON38438214120.0
Smik_13.4858.829ON38438114090.0
KLTH0C04114g8.829ON37837914010.0
Skud_13.4448.829ON38438113960.0
TDEL0B006808.829ON38338013890.0
Kwal_27.103328.829ON37837913730.0
NCAS0C004708.829ON42637913760.0
Suva_13.4608.829ON38438113450.0
AAL183W8.829ON37737812991e-179
NDAI0K004708.829ON38638412771e-176
CAGL0F03399g8.829ON38038112731e-175
Ecym_27128.829ON38138012631e-174
Kpol_541.98.829ON37438012461e-171
KNAG0J003208.829ON37338012051e-165
KAFR0B038508.829ON37738311971e-164
TBLA0D031808.829ON40038311601e-158
TPHA0C047108.829ON37737910821e-146
Kpol_1069.48.829ON2772458431e-111
Kpol_505.142.166ON123701732e-14
TDEL0F012102.166ON126711732e-14
ZYRO0B09812g2.166ON183741702e-13
Skud_14.2212.166ON120731591e-12
TPHA0F017902.166ON182701552e-11
Suva_14.2282.166ON120731475e-11
NDAI0F027302.166ON121701476e-11
TBLA0B013102.166ON123751467e-11
KLTH0D09284g2.166ON123751468e-11
KNAG0I020402.166ON119691459e-11
CAGL0L03828g2.166ON121681451e-10
NCAS0G025702.166ON121711451e-10
AFL223W2.166ON165791471e-10
Kwal_26.84612.166ON123751441e-10
TDEL0D00190singletonON552791552e-10
KLLA0F23672g2.166ON123751405e-10
KAFR0B045502.166ON126671396e-10
YNL111C (CYB5)2.166ON120731396e-10
Smik_14.2162.166ON120731388e-10
KLLA0F27577gna 1ON172701428e-10
SAKL0E10626g2.166ON123751344e-09
TDEL0H02180na 1ON203571385e-09
Kwal_47.18167na 1ON227561386e-09
NDAI0D04700na 2ON625591401e-08
Kpol_1014.54.304ON596571392e-08
Ecym_54202.166ON145701292e-08
KLTH0A04026gna 1ON233571333e-08
TPHA0B018204.304ON576571373e-08
KLTH0C11858gsingletonON555761355e-08
NDAI0D047104.304ON616541347e-08
KLLA0D02640g4.304ON589561331e-07
SAKL0F08316gna 1ON178521261e-07
KLTH0D06930g2.536ON204771271e-07
ADL085Cna 1ON273531291e-07
KLTH0C11770gsingletonON618521312e-07
KNAG0E038604.304ON604541302e-07
NCAS0A027804.304ON602631302e-07
Kwal_23.2823na 3ON560641283e-07
NCAS0A02770na 2ON609581258e-07
CAGL0K10736g4.304ON593541259e-07
ZYRO0D16654gna 1ON190571181e-06
KLLA0B14795gna 3ON556711232e-06
Kwal_26.80462.536ON198531172e-06
KAFR0I005204.304ON586601222e-06
CAGL0K03069g2.536ON194471172e-06
YML054C (CYB2)4.304ON591521213e-06
Smik_13.924.304ON591521213e-06
Suva_13.1054.304ON591521204e-06
Ecym_4346na 1ON209501146e-06
Skud_13.924.304ON591521186e-06
ZYRO0C18524gsingletonON554711186e-06
ZYRO0B13728g4.304ON598541178e-06
SAKL0F16610gsingletonON564711169e-06
SAKL0G16852g4.304ON580471105e-05
TPHA0G035502.536ON218521041e-04
KAFR0A047406.106ON483721043e-04
TDEL0D011404.304ON584481043e-04
ZYRO0B02090g2.536ON194561003e-04
NCAS0F008702.536ON18951985e-04
Kwal_14.807singletonON578481017e-04
SAKL0A09570g2.536ON21151950.002
NDAI0I016206.106ON44179970.002
Kpol_348.122.536ON21753950.002
KNAG0F032506.106ON48980960.002
TBLA0I015302.536ON22160930.003
NDAI0H013702.536ON22451930.004
Skud_7.2266.106ON50978940.004
KLLA0E18459g2.536ON14857890.005
Kpol_478.176.106ON48474930.006
YGL055W (OLE1)6.106ON51078920.008
CAGL0I00418g6.106ON49078920.009
Smik_7.2256.106ON51078920.009
KAFR0A018902.536ON16150870.012
Ecym_30806.106ON47978900.015
AAR153C6.106ON47878870.029
KLTH0H06798g6.106ON48878870.035
Suva_13.2502.536ON20148830.052
SAKL0A07326g6.106ON48078850.052
Smik_13.2522.536ON20148830.061
TBLA0C06220singletonON49452840.065
Skud_13.2292.536ON20148820.067
KNAG0C057802.536ON18042820.070
TDEL0A031102.536ON20057820.075
Ecym_72512.536ON19558800.14
KLLA0C05566g6.106ON47778810.17
Kwal_14.18456.106ON28878800.19
YMR073C (IRC21)2.536ON20148790.20
ZYRO0C05016g6.106ON48352800.21
TDEL0G036506.106ON48352790.31
Kwal_23.5693na 4ON51368790.35
AAL078Wna 4ON59283780.44
NCAS0D032506.106ON49752770.55
KLTH0G06358gna 4ON51352750.85
TPHA0B027006.106ON48879750.95
SAKL0G10274gna 4ON52274741.1
TDEL0E03250na 4ON53652741.2
KLLA0C10692gna 4ON52052741.4
ZYRO0G16742gna 4ON54352731.5
Ecym_3180na 4ON62183731.6
KNAG0M021902.576ON33789721.8
Ecym_2214na 5ON53154722.1
AFL079Wna 5ON53857712.5
Suva_7.2166.106ON47066712.7
KLTH0H04488gna 5ON57455695.2
KAFR0B015605.47ON616105695.2
KLLA0E19471gna 5ON57355695.2
SAKL0A04774gna 5ON56855687.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0D01760g
         (381 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0D01760g Chr4 (140050..141195) [1146 bp, 381 aa] {ON} simila...   720   0.0  
KLLA0D01639g Chr4 complement(146344..147489) [1146 bp, 381 aa] {...   605   0.0  
YMR272C Chr13 complement(809623..810777) [1155 bp, 384 aa] {ON} ...   552   0.0  
ZYRO0G13948g Chr7 complement(1109941..1111095) [1155 bp, 384 aa]...   548   0.0  
Smik_13.485 Chr13 complement(792640..793794) [1155 bp, 384 aa] {...   547   0.0  
KLTH0C04114g Chr3 (357195..358331) [1137 bp, 378 aa] {ON} highly...   544   0.0  
Skud_13.444 Chr13 complement(783092..784246) [1155 bp, 384 aa] {...   542   0.0  
TDEL0B00680 Chr2 (128650..129801) [1152 bp, 383 aa] {ON} Anc_8.8...   539   0.0  
Kwal_27.10332 s27 (289484..290620) [1137 bp, 378 aa] {ON} YMR272...   533   0.0  
NCAS0C00470 Chr3 (78059..79339) [1281 bp, 426 aa] {ON} Anc_8.829      534   0.0  
Suva_13.460 Chr13 complement(792221..793375) [1155 bp, 384 aa] {...   522   0.0  
AAL183W Chr1 (13713..14846) [1134 bp, 377 aa] {ON} Syntenic homo...   504   e-179
NDAI0K00470 Chr11 (107509..108669) [1161 bp, 386 aa] {ON} Anc_8....   496   e-176
CAGL0F03399g Chr6 complement(333955..335097) [1143 bp, 380 aa] {...   494   e-175
Ecym_2712 Chr2 (1378070..1379215) [1146 bp, 381 aa] {ON} similar...   491   e-174
Kpol_541.9 s541 complement(23399..24523) [1125 bp, 374 aa] {ON} ...   484   e-171
KNAG0J00320 Chr10 (50267..51388) [1122 bp, 373 aa] {ON} Anc_8.82...   468   e-165
KAFR0B03850 Chr2 complement(796399..797532) [1134 bp, 377 aa] {O...   465   e-164
TBLA0D03180 Chr4 complement(774883..776085) [1203 bp, 400 aa] {O...   451   e-158
TPHA0C04710 Chr3 complement(1015392..1016525) [1134 bp, 377 aa] ...   421   e-146
Kpol_1069.4 s1069 (6163..6996) [834 bp, 277 aa] {ON} (6163..6996...   329   e-111
Kpol_505.14 s505 (37085..37456) [372 bp, 123 aa] {ON} (37085..37...    71   2e-14
TDEL0F01210 Chr6 complement(216322..216702) [381 bp, 126 aa] {ON...    71   2e-14
ZYRO0B09812g Chr2 (765874..766425) [552 bp, 183 aa] {ON} similar...    70   2e-13
Skud_14.221 Chr14 complement(407119..407481) [363 bp, 120 aa] {O...    66   1e-12
TPHA0F01790 Chr6 (412270..412818) [549 bp, 182 aa] {ON} Anc_2.16...    64   2e-11
Suva_14.228 Chr14 complement(413753..414115) [363 bp, 120 aa] {O...    61   5e-11
NDAI0F02730 Chr6 (669821..670186) [366 bp, 121 aa] {ON} Anc_2.166      61   6e-11
TBLA0B01310 Chr2 (276173..276544) [372 bp, 123 aa] {ON} Anc_2.16...    61   7e-11
KLTH0D09284g Chr4 (770560..770931) [372 bp, 123 aa] {ON} similar...    61   8e-11
KNAG0I02040 Chr9 (397527..397886) [360 bp, 119 aa] {ON} Anc_2.16...    60   9e-11
CAGL0L03828g Chr12 (442660..443025) [366 bp, 121 aa] {ON} simila...    60   1e-10
NCAS0G02570 Chr7 complement(460218..460583) [366 bp, 121 aa] {ON...    60   1e-10
AFL223W Chr6 (19601..20098) [498 bp, 165 aa] {ON} Syntenic homol...    61   1e-10
Kwal_26.8461 s26 (794482..794853) [372 bp, 123 aa] {ON} YNL111C ...    60   1e-10
TDEL0D00190 Chr4 (29971..31629) [1659 bp, 552 aa] {ON}                 64   2e-10
KLLA0F23672g Chr6 (2212223..2212594) [372 bp, 123 aa] {ON} simil...    59   5e-10
KAFR0B04550 Chr2 (946561..946941) [381 bp, 126 aa] {ON} Anc_2.16...    58   6e-10
YNL111C Chr14 complement(416940..417302) [363 bp, 120 aa] {ON}  ...    58   6e-10
Smik_14.216 Chr14 complement(396585..396947) [363 bp, 120 aa] {O...    58   8e-10
KLLA0F27577g Chr6 (2556662..2557180) [519 bp, 172 aa] {ON} some ...    59   8e-10
SAKL0E10626g Chr5 (885272..885643) [372 bp, 123 aa] {ON} similar...    56   4e-09
TDEL0H02180 Chr8 (369539..370150) [612 bp, 203 aa] {ON}                58   5e-09
Kwal_47.18167 s47 complement(716570..717253) [684 bp, 227 aa] {O...    58   6e-09
NDAI0D04700 Chr4 (1103670..1105547) [1878 bp, 625 aa] {ON}             59   1e-08
Kpol_1014.5 s1014 complement(3107..4897) [1791 bp, 596 aa] {ON} ...    58   2e-08
Ecym_5420 Chr5 (865505..865942) [438 bp, 145 aa] {ON} similar to...    54   2e-08
KLTH0A04026g Chr1 complement(337200..337901) [702 bp, 233 aa] {O...    56   3e-08
TPHA0B01820 Chr2 complement(406416..408146) [1731 bp, 576 aa] {O...    57   3e-08
KLTH0C11858g Chr3 (979073..980740) [1668 bp, 555 aa] {ON} simila...    57   5e-08
NDAI0D04710 Chr4 (1106280..1108130) [1851 bp, 616 aa] {ON} Anc_4...    56   7e-08
KLLA0D02640g Chr4 complement(225482..227251) [1770 bp, 589 aa] {...    56   1e-07
SAKL0F08316g Chr6 complement(634949..635485) [537 bp, 178 aa] {O...    53   1e-07
KLTH0D06930g Chr4 complement(604805..605419) [615 bp, 204 aa] {O...    54   1e-07
ADL085C Chr4 complement(535293..536114) [822 bp, 273 aa] {ON} NO...    54   1e-07
KLTH0C11770g Chr3 (970979..972835) [1857 bp, 618 aa] {ON} simila...    55   2e-07
KNAG0E03860 Chr5 (763388..765202) [1815 bp, 604 aa] {ON} Anc_4.3...    55   2e-07
NCAS0A02780 Chr1 (531072..532880) [1809 bp, 602 aa] {ON} Anc_4.304     55   2e-07
Kwal_23.2823 s23 (29032..30714) [1683 bp, 560 aa] {ON} YML054C (...    54   3e-07
NCAS0A02770 Chr1 (528814..530643) [1830 bp, 609 aa] {ON}               53   8e-07
CAGL0K10736g Chr11 (1046127..1047908) [1782 bp, 593 aa] {ON} hig...    53   9e-07
ZYRO0D16654g Chr4 complement(1380316..1380888) [573 bp, 190 aa] ...    50   1e-06
KLLA0B14795g Chr2 (1299429..1301099) [1671 bp, 556 aa] {ON} simi...    52   2e-06
Kwal_26.8046 s26 complement(621715..622311) [597 bp, 198 aa] {ON...    50   2e-06
KAFR0I00520 Chr9 complement(107239..108999) [1761 bp, 586 aa] {O...    52   2e-06
CAGL0K03069g Chr11 complement(285190..285774) [585 bp, 194 aa] {...    50   2e-06
YML054C Chr13 complement(165533..167308) [1776 bp, 591 aa] {ON} ...    51   3e-06
Smik_13.92 Chr13 complement(163135..164910) [1776 bp, 591 aa] {O...    51   3e-06
Suva_13.105 Chr13 complement(168279..170054) [1776 bp, 591 aa] {...    51   4e-06
Ecym_4346 Chr4 (739106..739735) [630 bp, 209 aa] {ON} similar to...    49   6e-06
Skud_13.92 Chr13 complement(163654..165429) [1776 bp, 591 aa] {O...    50   6e-06
ZYRO0C18524g Chr3 (1450641..1452305) [1665 bp, 554 aa] {ON} simi...    50   6e-06
ZYRO0B13728g Chr2 (1110636..1112432) [1797 bp, 598 aa] {ON} simi...    50   8e-06
SAKL0F16610g Chr6 (1373674..1375368) [1695 bp, 564 aa] {ON} simi...    49   9e-06
SAKL0G16852g Chr7 (1452894..1454636) [1743 bp, 580 aa] {ON} simi...    47   5e-05
TPHA0G03550 Chr7 complement(755688..756344) [657 bp, 218 aa] {ON...    45   1e-04
KAFR0A04740 Chr1 (942850..944301) [1452 bp, 483 aa] {ON} Anc_6.1...    45   3e-04
TDEL0D01140 Chr4 complement(214858..216612) [1755 bp, 584 aa] {O...    45   3e-04
ZYRO0B02090g Chr2 complement(169589..170173) [585 bp, 194 aa] {O...    43   3e-04
NCAS0F00870 Chr6 (177678..178247) [570 bp, 189 aa] {ON} Anc_2.53...    42   5e-04
Kwal_14.807 s14 complement(57218..58954) [1737 bp, 578 aa] {ON} ...    44   7e-04
SAKL0A09570g Chr1 complement(838406..839041) [636 bp, 211 aa] {O...    41   0.002
NDAI0I01620 Chr9 complement(382761..384086) [1326 bp, 441 aa] {O...    42   0.002
Kpol_348.12 s348 complement(21978..22631) [654 bp, 217 aa] {ON} ...    41   0.002
KNAG0F03250 Chr6 complement(607667..609136) [1470 bp, 489 aa] {O...    42   0.002
TBLA0I01530 Chr9 (334102..334767) [666 bp, 221 aa] {ON} Anc_2.53...    40   0.003
NDAI0H01370 Chr8 (336807..337481) [675 bp, 224 aa] {ON} Anc_2.536      40   0.004
Skud_7.226 Chr7 (402118..403647) [1530 bp, 509 aa] {ON} YGL055W ...    41   0.004
KLLA0E18459g Chr5 (1641507..1641953) [447 bp, 148 aa] {ON} simil...    39   0.005
Kpol_478.17 s478 (61375..62829) [1455 bp, 484 aa] {ON} (61375..6...    40   0.006
YGL055W Chr7 (398628..400160) [1533 bp, 510 aa] {ON}  OLE1Delta(...    40   0.008
CAGL0I00418g Chr9 (30058..31530) [1473 bp, 490 aa] {ON} highly s...    40   0.009
Smik_7.225 Chr7 (393200..394732) [1533 bp, 510 aa] {ON} YGL055W ...    40   0.009
KAFR0A01890 Chr1 complement(392001..392486) [486 bp, 161 aa] {ON...    38   0.012
Ecym_3080 Chr3 (149461..150900) [1440 bp, 479 aa] {ON} similar t...    39   0.015
AAR153C Chr1 complement(619953..621389) [1437 bp, 478 aa] {ON} S...    38   0.029
KLTH0H06798g Chr8 (596966..598432) [1467 bp, 488 aa] {ON} unipro...    38   0.035
Suva_13.250 Chr13 complement(393510..394115) [606 bp, 201 aa] {O...    37   0.052
SAKL0A07326g Chr1 (648420..649862) [1443 bp, 480 aa] {ON} unipro...    37   0.052
Smik_13.252 Chr13 complement(396365..396970) [606 bp, 201 aa] {O...    37   0.061
TBLA0C06220 Chr3 (1507690..1509174) [1485 bp, 494 aa] {ON}             37   0.065
Skud_13.229 Chr13 complement(386598..387203) [606 bp, 201 aa] {O...    36   0.067
KNAG0C05780 Chr3 (1124591..1125133) [543 bp, 180 aa] {ON} Anc_2....    36   0.070
TDEL0A03110 Chr1 complement(554890..555492) [603 bp, 200 aa] {ON...    36   0.075
Ecym_7251 Chr7 (530372..530959) [588 bp, 195 aa] {ON} similar to...    35   0.14 
KLLA0C05566g Chr3 complement(497877..499310) [1434 bp, 477 aa] {...    36   0.17 
Kwal_14.1845 s14 (491597..492463) [867 bp, 288 aa] {ON} YGL055W ...    35   0.19 
YMR073C Chr13 complement(412268..412873) [606 bp, 201 aa] {ON}  ...    35   0.20 
ZYRO0C05016g Chr3 (394581..396032) [1452 bp, 483 aa] {ON} simila...    35   0.21 
TDEL0G03650 Chr7 (673347..674798) [1452 bp, 483 aa] {ON} Anc_6.1...    35   0.31 
Kwal_23.5693 s23 (1277807..1279348) [1542 bp, 513 aa] {ON} YGL05...    35   0.35 
AAL078W Chr1 (209600..211378) [1779 bp, 592 aa] {ON} Non-synteni...    35   0.44 
NCAS0D03250 Chr4 (608476..609969) [1494 bp, 497 aa] {ON} Anc_6.106     34   0.55 
KLTH0G06358g Chr7 complement(503325..504866) [1542 bp, 513 aa] {...    33   0.85 
TPHA0B02700 Chr2 (620423..621889) [1467 bp, 488 aa] {ON} Anc_6.1...    33   0.95 
SAKL0G10274g Chr7 complement(874738..876306) [1569 bp, 522 aa] {...    33   1.1  
TDEL0E03250 Chr5 complement(612008..613618) [1611 bp, 536 aa] {O...    33   1.2  
KLLA0C10692g Chr3 complement(916718..918280) [1563 bp, 520 aa] {...    33   1.4  
ZYRO0G16742g Chr7 (1373818..1375449) [1632 bp, 543 aa] {ON} weak...    33   1.5  
Ecym_3180 Chr3 (344929..346794) [1866 bp, 621 aa] {ON} similar t...    33   1.6  
KNAG0M02190 Chr13 complement(404364..405377) [1014 bp, 337 aa] {...    32   1.8  
Ecym_2214 Chr2 (422005..423600) [1596 bp, 531 aa] {ON} similar t...    32   2.1  
AFL079W Chr6 (290134..291750) [1617 bp, 538 aa] {ON} NOHBY604; N...    32   2.5  
Suva_7.216 Chr7 (391750..393162) [1413 bp, 470 aa] {ON} YGL055W ...    32   2.7  
KLTH0H04488g Chr8 (401548..403272) [1725 bp, 574 aa] {ON} conser...    31   5.2  
KAFR0B01560 Chr2 (295684..297534) [1851 bp, 616 aa] {ON} Anc_5.4...    31   5.2  
KLLA0E19471g Chr5 complement(1730651..1732372) [1722 bp, 573 aa]...    31   5.2  
SAKL0A04774g Chr1 (435965..437671) [1707 bp, 568 aa] {ON} unipro...    31   7.1  

>SAKL0D01760g Chr4 (140050..141195) [1146 bp, 381 aa] {ON} similar
           to uniprot|Q03529 Saccharomyces cerevisiae YMR272C SCS7
           Required for the hydroxylation of the very long chain
           fatty acid (VLCFA) located in the endoplasmic reticulum
           desaturase/hydroxylase enzyme
          Length = 381

 Score =  720 bits (1859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/381 (92%), Positives = 353/381 (92%)

Query: 1   MSESKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITE 60
           MSESKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITE
Sbjct: 1   MSESKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITE 60

Query: 61  IMKDKLVHEHSESAYEIMNDMYLVGYLAXXXXXXXXXXXXDHTVEVKLNESTQFDSTTFV 120
           IMKDKLVHEHSESAYEIMNDMYLVGYLA            DHTVEVKLNESTQFDSTTFV
Sbjct: 61  IMKDKLVHEHSESAYEIMNDMYLVGYLANEEEEKKLLTNEDHTVEVKLNESTQFDSTTFV 120

Query: 121 KELPTEDKLSIATDYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGKGSA 180
           KELPTEDKLSIATDYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGKGSA
Sbjct: 121 KELPTEDKLSIATDYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGKGSA 180

Query: 181 PLFGNFLEPLSKTPWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIEYCL 240
           PLFGNFLEPLSKTPWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIEYCL
Sbjct: 181 PLFGNFLEPLSKTPWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIEYCL 240

Query: 241 HRFLFHLDQYLPERQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVFSLL 300
           HRFLFHLDQYLPERQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVFSLL
Sbjct: 241 HRFLFHLDQYLPERQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVFSLL 300

Query: 301 PYYWACAGFAGGMLGYTCYDLTHYFLHHAKLPPYMRXXXXXXXXXXXXXXXXGFGVTSWF 360
           PYYWACAGFAGGMLGYTCYDLTHYFLHHAKLPPYMR                GFGVTSWF
Sbjct: 301 PYYWACAGFAGGMLGYTCYDLTHYFLHHAKLPPYMRKLKKYHLEHHYKNYELGFGVTSWF 360

Query: 361 WDKVFGTYLGSDAPLSKMKYE 381
           WDKVFGTYLGSDAPLSKMKYE
Sbjct: 361 WDKVFGTYLGSDAPLSKMKYE 381

>KLLA0D01639g Chr4 complement(146344..147489) [1146 bp, 381 aa] {ON}
           similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 381

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/381 (75%), Positives = 317/381 (83%)

Query: 1   MSESKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITE 60
           MS S+ LPL SKT L +HN K DCWVSLY RK+YNVT FL+EHPGG +YILD+AG DIT+
Sbjct: 1   MSSSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITD 60

Query: 61  IMKDKLVHEHSESAYEIMNDMYLVGYLAXXXXXXXXXXXXDHTVEVKLNESTQFDSTTFV 120
           +MKD L HEHSESAYEIM++ YLVGYLA            DH VEV L  + +FDST FV
Sbjct: 61  VMKDVLTHEHSESAYEIMDESYLVGYLATEEEEKKLLTNKDHVVEVNLKGNNEFDSTVFV 120

Query: 121 KELPTEDKLSIATDYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGKGSA 180
           KELPTEDKLSIATDY +DYKKHKFLDL+KPLLWQV+FG FTKDFYLDQVHRPRHYGKGSA
Sbjct: 121 KELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGSA 180

Query: 181 PLFGNFLEPLSKTPWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIEYCL 240
           PLFGNFLEPLSKTPW+ +P+ WLPVV YH+Y AL NMN+ FA+FLF++GVFVWTLIEY L
Sbjct: 181 PLFGNFLEPLSKTPWWMVPVVWLPVVTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYGL 240

Query: 241 HRFLFHLDQYLPERQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVFSLL 300
           HRFLFHLD  LPE+Q AF LHFLLHGVHHYLPMDR+RLVMPPTLFV+LCTPFYKLVF+LL
Sbjct: 241 HRFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFALL 300

Query: 301 PYYWACAGFAGGMLGYTCYDLTHYFLHHAKLPPYMRXXXXXXXXXXXXXXXXGFGVTSWF 360
           PYYWACAGFAGGMLGY CYDLTHYFLHH++LPPYMR                GFGVTSWF
Sbjct: 301 PYYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRKLKKYHLEHHYKNYELGFGVTSWF 360

Query: 361 WDKVFGTYLGSDAPLSKMKYE 381
           WDKVFGTYLG +APLS MKY+
Sbjct: 361 WDKVFGTYLGENAPLSNMKYD 381

>YMR272C Chr13 complement(809623..810777) [1155 bp, 384 aa] {ON}
           SCS7Sphingolipid alpha-hydroxylase, functions in the
           alpha-hydroxylation of sphingolipid-associated very long
           chain fatty acids, has both cytochrome b5-like and
           hydroxylase/desaturase domains, not essential for growth
          Length = 384

 Score =  552 bits (1422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/381 (68%), Positives = 305/381 (80%), Gaps = 1/381 (0%)

Query: 2   SESKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEI 61
           + SKTL L SK  + +HNT  DCWV+  NRK+Y+VT FL EHPGGD+ ILD+AG+DITEI
Sbjct: 4   NTSKTLELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITEI 63

Query: 62  MKDKLVHEHSESAYEIMNDMYLVGYLAXXXXXXXXXXXXDHTVEVKLN-ESTQFDSTTFV 120
           MKD  VHEHS+SAYEI+ D YL+GYLA            +H VEV+L+ + T+FDSTTFV
Sbjct: 64  MKDSDVHEHSDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVEVQLSADGTEFDSTTFV 123

Query: 121 KELPTEDKLSIATDYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGKGSA 180
           KELP E+KLSIATDYS+DYKKHKFLDL++PLL Q++  +F KDFY+DQ+HRPRHYGKGSA
Sbjct: 124 KELPAEEKLSIATDYSNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGKGSA 183

Query: 181 PLFGNFLEPLSKTPWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIEYCL 240
           PLFGNFLEPL+KT W+ +P+AWLPVV YH+ VAL NMN+ FA FLF +GVFVWTLIEY L
Sbjct: 184 PLFGNFLEPLTKTAWWVVPVAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIEYGL 243

Query: 241 HRFLFHLDQYLPERQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVFSLL 300
           HRFLFH D +LPE  +AFA HFLLHG HHYLPMD+YRLVMPPTLFV+LC PFYKLVF+LL
Sbjct: 244 HRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFALL 303

Query: 301 PYYWACAGFAGGMLGYTCYDLTHYFLHHAKLPPYMRXXXXXXXXXXXXXXXXGFGVTSWF 360
           P YWA AGFAGG+ GY CYD  H+FLHH+KLPP+MR                GFGVTSWF
Sbjct: 304 PLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVTSWF 363

Query: 361 WDKVFGTYLGSDAPLSKMKYE 381
           WD+VFGTYLG DAPLSKMKYE
Sbjct: 364 WDEVFGTYLGPDAPLSKMKYE 384

>ZYRO0G13948g Chr7 complement(1109941..1111095) [1155 bp, 384 aa]
           {ON} similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 384

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/382 (68%), Positives = 302/382 (79%), Gaps = 2/382 (0%)

Query: 2   SESKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEI 61
           ++S TL L S+ QLS+HN ++DCWVS+Y RK+YNVT FL+EHPGG +YIL +AG DITE+
Sbjct: 3   TKSPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEV 62

Query: 62  MKDKLVHEHSESAYEIMNDMYLVGYLAXXXXXXXXXXXXDHTVEVKLNE--STQFDSTTF 119
           +KD+ VHEHSESAYEI++D YLVGYLA             H VEV L +  ++ FDSTTF
Sbjct: 63  LKDRDVHEHSESAYEILDDNYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDSTTF 122

Query: 120 VKELPTEDKLSIATDYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGKGS 179
           V ELP E+KL+IATDY  DYKKHKFLDL++ LL QV+FGNF+KDFYLDQVHRPRHYGKGS
Sbjct: 123 VPELPAEEKLNIATDYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHYGKGS 182

Query: 180 APLFGNFLEPLSKTPWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIEYC 239
           APLFGNFLEP+SKTPW+AIPI W+PVV +H YV  TNMNK F+ FLF LG+FVWTLIEYC
Sbjct: 183 APLFGNFLEPISKTPWWAIPIIWIPVVSFHFYVGFTNMNKLFSTFLFCLGIFVWTLIEYC 242

Query: 240 LHRFLFHLDQYLPERQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVFSL 299
           LHRFLFHLD++LP+   A  LHFLLHGVHHYLPMDRYRLVMPPTL ++L  P YK VF L
Sbjct: 243 LHRFLFHLDEWLPDNNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKTVFGL 302

Query: 300 LPYYWACAGFAGGMLGYTCYDLTHYFLHHAKLPPYMRXXXXXXXXXXXXXXXXGFGVTSW 359
           LP YWA +GFAGG+ GY CYDLTHYFLHHAKLP YMR                GFGVTSW
Sbjct: 303 LPTYWAYSGFAGGLFGYVCYDLTHYFLHHAKLPSYMRKLKKYHLEHHYKNYQLGFGVTSW 362

Query: 360 FWDKVFGTYLGSDAPLSKMKYE 381
           FWD VFGTYLG DAPL+ MKY+
Sbjct: 363 FWDNVFGTYLGPDAPLAHMKYD 384

>Smik_13.485 Chr13 complement(792640..793794) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  547 bits (1409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/381 (67%), Positives = 304/381 (79%), Gaps = 1/381 (0%)

Query: 2   SESKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEI 61
           + SKTL L SK  + +HNT +DCWV+  NRK+Y+VT FL EHPGGD+ ILD+AG+DITE+
Sbjct: 4   NTSKTLELFSKKTVEKHNTAKDCWVTYQNRKIYDVTKFLSEHPGGDESILDYAGKDITEV 63

Query: 62  MKDKLVHEHSESAYEIMNDMYLVGYLAXXXXXXXXXXXXDHTVEVKLN-ESTQFDSTTFV 120
           MKD  VHEHS+SAYEI+ D YL+GYLA            +H VEV+L+ + T+FDSTTFV
Sbjct: 64  MKDTDVHEHSDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVEVQLSSDGTEFDSTTFV 123

Query: 121 KELPTEDKLSIATDYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGKGSA 180
           K+LP E+KLSIATDY +DYKKHKFLDL++PLL Q++  +F KDFY+DQ+HRPRHYGKGSA
Sbjct: 124 KDLPAEEKLSIATDYGNDYKKHKFLDLNRPLLMQILCSDFKKDFYVDQIHRPRHYGKGSA 183

Query: 181 PLFGNFLEPLSKTPWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIEYCL 240
           PLFGNFLEPL+KT W+ +P AWLPVV YH+ VAL NMN+ FA FLF +GVFVWTLIEY L
Sbjct: 184 PLFGNFLEPLTKTAWWVVPTAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIEYGL 243

Query: 241 HRFLFHLDQYLPERQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVFSLL 300
           HRFLFH D +LPE  +AFA HFLLHG HHYLPMD+YRLVMPPTLFV+LC PFYKLVF+LL
Sbjct: 244 HRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFALL 303

Query: 301 PYYWACAGFAGGMLGYTCYDLTHYFLHHAKLPPYMRXXXXXXXXXXXXXXXXGFGVTSWF 360
           P YWA AGFAGG+ GY CYD  H+FLHH+KLPP+MR                GFGVTSWF
Sbjct: 304 PLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVTSWF 363

Query: 361 WDKVFGTYLGSDAPLSKMKYE 381
           WD+VFGTYLG DAPLSKMKYE
Sbjct: 364 WDEVFGTYLGPDAPLSKMKYE 384

>KLTH0C04114g Chr3 (357195..358331) [1137 bp, 378 aa] {ON} highly
           similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 378

 Score =  544 bits (1401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/379 (68%), Positives = 304/379 (80%), Gaps = 2/379 (0%)

Query: 3   ESKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIM 62
           E+KTLPL S++QL QHNT++DCWVSL++RK+YNVT+FL+EHPGG + I ++AG+D+TEIM
Sbjct: 2   ETKTLPLYSQSQLEQHNTRDDCWVSLHHRKIYNVTSFLDEHPGGAELIEEYAGKDVTEIM 61

Query: 63  KDKLVHEHSESAYEIMNDMYLVGYLAXXXXXXXXXXXXDHTVEVKLNESTQFDSTTFVKE 122
           KD   HEHS  AYE++++ Y VGYLA            +H VEVKL E   +DST FV E
Sbjct: 62  KDGPTHEHSYVAYEVLDEEYHVGYLATPEEEKKLLGNPEHPVEVKLEED--YDSTVFVPE 119

Query: 123 LPTEDKLSIATDYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGKGSAPL 182
           +P E+KLSI TDY+ DY +HKFLDL++PLL Q++  +F+K+FYLDQVHRPRHYG+GSAPL
Sbjct: 120 VPPEEKLSIVTDYTKDYGRHKFLDLNRPLLMQMLTSDFSKEFYLDQVHRPRHYGRGSAPL 179

Query: 183 FGNFLEPLSKTPWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIEYCLHR 242
           FGNFLEPLSKT WY IP+ W PVV YH+Y AL NMN   A+FLF LGVFVWTLIEY LHR
Sbjct: 180 FGNFLEPLSKTAWYVIPLVWFPVVVYHMYTALQNMNNVLAVFLFCLGVFVWTLIEYGLHR 239

Query: 243 FLFHLDQYLPERQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVFSLLPY 302
           FLFHLD YLP  Q+A+ +HFLLHGVHHYLPMDRYRLVMPPTLFV+LCTPFYKLVF+LLP 
Sbjct: 240 FLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMPPTLFVVLCTPFYKLVFALLPK 299

Query: 303 YWACAGFAGGMLGYTCYDLTHYFLHHAKLPPYMRXXXXXXXXXXXXXXXXGFGVTSWFWD 362
           YWACAGFAGGM GY CYDLTHYFLHHAKLP YMR                GFGVTSWFWD
Sbjct: 300 YWACAGFAGGMFGYMCYDLTHYFLHHAKLPSYMRKLKKYHMEHHYKNYELGFGVTSWFWD 359

Query: 363 KVFGTYLGSDAPLSKMKYE 381
           KVFGTYLG +APLS+MK++
Sbjct: 360 KVFGTYLGDNAPLSQMKFD 378

>Skud_13.444 Chr13 complement(783092..784246) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  542 bits (1396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/381 (67%), Positives = 302/381 (79%), Gaps = 1/381 (0%)

Query: 2   SESKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEI 61
           + SKTL L S+  + +HNT +DCWV+  NRK+Y+VT FL EHPGGD+ ILD+AG+D+TEI
Sbjct: 4   NTSKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEI 63

Query: 62  MKDKLVHEHSESAYEIMNDMYLVGYLAXXXXXXXXXXXXDHTVEVKLN-ESTQFDSTTFV 120
           MKD  VHEHS+SAYEI+ D YL+GYLA             H VEV+L+ +  +FDSTTFV
Sbjct: 64  MKDSDVHEHSDSAYEILEDEYLIGYLATDEEATRLLTNKSHKVEVQLSADGKEFDSTTFV 123

Query: 121 KELPTEDKLSIATDYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGKGSA 180
           K LPTE+KLSIATDY +DYKKHKFLDL++PLL Q++  +F KDFY+DQ+HRPRHYGKGSA
Sbjct: 124 KNLPTEEKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGKGSA 183

Query: 181 PLFGNFLEPLSKTPWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIEYCL 240
           PLFGNFLEPL+KT W+ +P+ WLPVV YH+ VAL NMN+ FA FLF +GVFVWTLIEY L
Sbjct: 184 PLFGNFLEPLTKTAWWVVPLPWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIEYGL 243

Query: 241 HRFLFHLDQYLPERQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVFSLL 300
           HRFLFH D +LPE  +AFA HFLLHG HHYLPMD+YRLVMPPTLFV+LC PFYKLVF+LL
Sbjct: 244 HRFLFHFDDWLPESNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFALL 303

Query: 301 PYYWACAGFAGGMLGYTCYDLTHYFLHHAKLPPYMRXXXXXXXXXXXXXXXXGFGVTSWF 360
           P YWA AGFAGG+ GY CYD  H+FLHH+KLPP+MR                GFGVTSWF
Sbjct: 304 PLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVTSWF 363

Query: 361 WDKVFGTYLGSDAPLSKMKYE 381
           WD+VFGTYLG DAPLSKMKYE
Sbjct: 364 WDEVFGTYLGPDAPLSKMKYE 384

>TDEL0B00680 Chr2 (128650..129801) [1152 bp, 383 aa] {ON} Anc_8.829
           YMR272C
          Length = 383

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/380 (68%), Positives = 297/380 (78%), Gaps = 2/380 (0%)

Query: 3   ESKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIM 62
           +SKTL L S+ Q+S+HN   DCWV++ NRK+Y+VT FL+EHPGG QYILD+AG+DITE++
Sbjct: 5   QSKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVL 64

Query: 63  KDKLVHEHSESAYEIMNDM-YLVGYLAXXXXXXXXXXXXDHTVEVKLNESTQFDSTTFVK 121
           KD  +HEHSESAYEI+ D  YLVGY+A             H VEVKL  +  FDSTTFVK
Sbjct: 65  KDSTIHEHSESAYEILEDSSYLVGYMATELEEKELLTNSSHKVEVKL-ATLDFDSTTFVK 123

Query: 122 ELPTEDKLSIATDYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGKGSAP 181
           +LPTE+KLSIATDYS DYK+H FLDL KPLL QV+FG FTKDFY+DQ+HRPRHYGKGSAP
Sbjct: 124 DLPTEEKLSIATDYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRHYGKGSAP 183

Query: 182 LFGNFLEPLSKTPWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIEYCLH 241
           LFGNFLEPLSKT WY IP+ WLPVV YH+ VA  NMN  F +F F LG FVWTLIEY LH
Sbjct: 184 LFGNFLEPLSKTSWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWTLIEYGLH 243

Query: 242 RFLFHLDQYLPERQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVFSLLP 301
           RFLFH D +LPE  + F LHFLLHGVHHYLPMD+YRLVMPPTLFV+LCTPFYKLVF LLP
Sbjct: 244 RFLFHFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYKLVFGLLP 303

Query: 302 YYWACAGFAGGMLGYTCYDLTHYFLHHAKLPPYMRXXXXXXXXXXXXXXXXGFGVTSWFW 361
            Y A AGFAGG+ GY CYDLTHYFLHH+KLP +MR                GFGVTSWFW
Sbjct: 304 LYVAYAGFAGGLFGYVCYDLTHYFLHHSKLPSFMRKLKKYHLEHHYKNYQLGFGVTSWFW 363

Query: 362 DKVFGTYLGSDAPLSKMKYE 381
           DKVFGTYL   +P+S+MKY+
Sbjct: 364 DKVFGTYLSPTSPISQMKYD 383

>Kwal_27.10332 s27 (289484..290620) [1137 bp, 378 aa] {ON} YMR272C
           (SCS7) - desaturase/hydroxylase enzyme [contig 36] FULL
          Length = 378

 Score =  533 bits (1373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/379 (65%), Positives = 302/379 (79%), Gaps = 2/379 (0%)

Query: 3   ESKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIM 62
           E+KTLPL S +Q+ +HN+ +DCWV+L NRK+Y+VT FLE+HPGG   I+++AG+DITE+M
Sbjct: 2   ETKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVM 61

Query: 63  KDKLVHEHSESAYEIMNDMYLVGYLAXXXXXXXXXXXXDHTVEVKLNESTQFDSTTFVKE 122
           KD  +H HS  AYE++++ Y VGYLA             H VEVKL +  ++DST FV E
Sbjct: 62  KDGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKLED--EYDSTVFVPE 119

Query: 123 LPTEDKLSIATDYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGKGSAPL 182
           +P E+KLSI TDY+ DY +HKFLDL++PLL Q++  +FTK+FYLDQVHRPRHYG+GSAPL
Sbjct: 120 VPAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPL 179

Query: 183 FGNFLEPLSKTPWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIEYCLHR 242
           FGNFLEPLSKT WY IPI WLPVV YH++ A+ NMNK FA+FLF +G+FVWTLIEY +HR
Sbjct: 180 FGNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHR 239

Query: 243 FLFHLDQYLPERQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVFSLLPY 302
           FLFHLD YLP  Q+A+ +HFLLHGVHHYLPMDRYRLVMPPTLF+LLCTPFYKLVF+LLPY
Sbjct: 240 FLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMPPTLFLLLCTPFYKLVFALLPY 299

Query: 303 YWACAGFAGGMLGYTCYDLTHYFLHHAKLPPYMRXXXXXXXXXXXXXXXXGFGVTSWFWD 362
           YWACAGFAGGMLGY CYDLTHYFLHHAKLP  ++                GFGVTSW WD
Sbjct: 300 YWACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWD 359

Query: 363 KVFGTYLGSDAPLSKMKYE 381
           KVFGTYL  +APLS+MK++
Sbjct: 360 KVFGTYLAENAPLSQMKFD 378

>NCAS0C00470 Chr3 (78059..79339) [1281 bp, 426 aa] {ON} Anc_8.829
          Length = 426

 Score =  534 bits (1376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/379 (64%), Positives = 299/379 (78%), Gaps = 5/379 (1%)

Query: 4   SKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMK 63
           SKTL L SK Q+++HNT+EDCWV++Y+RK+Y+V+ FL +HP GD+ IL HAG+DITE++K
Sbjct: 52  SKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLK 111

Query: 64  DKLVHEHSESAYEIMNDMYLVGYLAXXXXXXXXXXXXDHTVEVKLNESTQ-FDSTTFVKE 122
           D+ + + ++    +++D YL+GY+A            DH VEVKLNEST  FDSTTFVK+
Sbjct: 112 DEKIDQQTD----LLDDQYLIGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDSTTFVKD 167

Query: 123 LPTEDKLSIATDYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGKGSAPL 182
           LPTEDKLSIATDY  D KKH FLDL+KPLL Q++FGNFTKDFYLDQ+HRPRHYG+ SAPL
Sbjct: 168 LPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQESAPL 227

Query: 183 FGNFLEPLSKTPWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIEYCLHR 242
           FGNFLEP +KT WY +PIAWLPVVFYH+ +A  N+N  FA+ LF +GV+VWT IEYC+HR
Sbjct: 228 FGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIEYCMHR 287

Query: 243 FLFHLDQYLPERQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVFSLLPY 302
           FLFH D+ LPE   A+ +HFLLHG HHYLPMD+YRLV+PP LF+ LC PFYKLVF+LLPY
Sbjct: 288 FLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVFALLPY 347

Query: 303 YWACAGFAGGMLGYTCYDLTHYFLHHAKLPPYMRXXXXXXXXXXXXXXXXGFGVTSWFWD 362
           YWACAGFAGGM GY CYDL HYFLHH+KLPP+MR                G+GVTSW+WD
Sbjct: 348 YWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRKLKKYHLEHHYKNYQLGYGVTSWYWD 407

Query: 363 KVFGTYLGSDAPLSKMKYE 381
           K FGTYL  D+PLSKMKY+
Sbjct: 408 KKFGTYLSPDSPLSKMKYQ 426

>Suva_13.460 Chr13 complement(792221..793375) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  522 bits (1345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/381 (68%), Positives = 304/381 (79%), Gaps = 1/381 (0%)

Query: 2   SESKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEI 61
           + SKTL L SK  + +HNT +DCWV+  NRK+Y+VT FL EHPGG++ ILD+AG+DITE+
Sbjct: 4   NTSKTLELFSKKTVEEHNTAKDCWVTYQNRKIYDVTKFLSEHPGGEESILDYAGKDITEV 63

Query: 62  MKDKLVHEHSESAYEIMNDMYLVGYLAXXXXXXXXXXXXDHTVEVKLN-ESTQFDSTTFV 120
           MKD  VHEHSESAYEI+ D YLVGYLA            +H VEV+L+ + T+FDSTTFV
Sbjct: 64  MKDSDVHEHSESAYEILEDEYLVGYLATDEEATRLLTNKNHKVEVQLSADGTEFDSTTFV 123

Query: 121 KELPTEDKLSIATDYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGKGSA 180
           K+LPTE+KLSIATDY SDYKKHKFLDL+KPLL Q++  +FT+DFY+DQ+HRPRHYGKGSA
Sbjct: 124 KDLPTEEKLSIATDYGSDYKKHKFLDLNKPLLMQILRSDFTRDFYVDQIHRPRHYGKGSA 183

Query: 181 PLFGNFLEPLSKTPWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIEYCL 240
           PLFGNFLEPL+KT W+ +P+AW+PVV YH+ VAL NMN  FA FLF +G+FVWTLIEY L
Sbjct: 184 PLFGNFLEPLTKTAWWVVPVAWVPVVVYHMGVALKNMNPLFACFLFGVGMFVWTLIEYSL 243

Query: 241 HRFLFHLDQYLPERQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVFSLL 300
           HRFLFH D +LPE  +AFA HFLLHG HHYLPMD YRLVMPP+LFV+LC PFYKLVF+LL
Sbjct: 244 HRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDGYRLVMPPSLFVILCAPFYKLVFALL 303

Query: 301 PYYWACAGFAGGMLGYTCYDLTHYFLHHAKLPPYMRXXXXXXXXXXXXXXXXGFGVTSWF 360
           P YWA AGFAGG+ GY CYD  HYF+HH+KLPP+MR                GFGVTSWF
Sbjct: 304 PLYWAYAGFAGGLFGYVCYDECHYFIHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVTSWF 363

Query: 361 WDKVFGTYLGSDAPLSKMKYE 381
           WD VFGTYLG DAPLSKMKYE
Sbjct: 364 WDDVFGTYLGPDAPLSKMKYE 384

>AAL183W Chr1 (13713..14846) [1134 bp, 377 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR272C (SCS7)
          Length = 377

 Score =  504 bits (1299), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 238/378 (62%), Positives = 286/378 (75%), Gaps = 3/378 (0%)

Query: 4   SKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMK 63
           SKTLPL SK  L +H  +  CWVS+ NRK+Y+V+ FL+EHPGGDQYILD+AG+DIT ++K
Sbjct: 3   SKTLPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVLK 62

Query: 64  DKLVHEHSESAYEIMNDMYLVGYLAXXXXXXXXXXXXDHTVEVKLNESTQFDSTTFVKEL 123
           DKL+HEH+E+AYEI+++ YLVGYLA             H +EV        D+TTFVKEL
Sbjct: 63  DKLIHEHTEAAYEILDESYLVGYLATEEEEIKLLTNEKHVMEVT---PENLDTTTFVKEL 119

Query: 124 PTEDKLSIATDYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGKGSAPLF 183
           P E+ LS+ATD+ +DY KH FLDL+KPLL QV+ GNFT+DFY+DQ+HRPRHYGKGSAPLF
Sbjct: 120 PAEEVLSVATDFGTDYTKHHFLDLNKPLLMQVLRGNFTRDFYIDQIHRPRHYGKGSAPLF 179

Query: 184 GNFLEPLSKTPWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIEYCLHRF 243
           GNFLEPLSKT W+ +P+ W PVV Y+L  AL NM    AL  F+ GVFVWTLIEY LHRF
Sbjct: 180 GNFLEPLSKTVWWVVPMVWYPVVLYYLTRALQNMPAHLALTCFAAGVFVWTLIEYSLHRF 239

Query: 244 LFHLDQYLPERQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVFSLLPYY 303
           LFH D  +PE  +AF +HFLLHGVHHYLPMD+YRLVMPP LFV+LC PFY+LVFS+ P Y
Sbjct: 240 LFHFDDNMPESNIAFTVHFLLHGVHHYLPMDKYRLVMPPALFVVLCAPFYRLVFSIFPEY 299

Query: 304 WACAGFAGGMLGYTCYDLTHYFLHHAKLPPYMRXXXXXXXXXXXXXXXXGFGVTSWFWDK 363
            AC  FAGG+ GY CYD+THYFLHH KLPP+MR                GFGVTSW+WDK
Sbjct: 300 CACGCFAGGLFGYVCYDVTHYFLHHHKLPPFMRKLKKYHLEHHYKNYELGFGVTSWYWDK 359

Query: 364 VFGTYLGSDAPLSKMKYE 381
           VFGTYL S++P+S+ K E
Sbjct: 360 VFGTYLASNSPVSRPKCE 377

>NDAI0K00470 Chr11 (107509..108669) [1161 bp, 386 aa] {ON} Anc_8.829
          Length = 386

 Score =  496 bits (1277), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 235/384 (61%), Positives = 290/384 (75%), Gaps = 3/384 (0%)

Query: 1   MSESKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHP--GGDQYILDHAGEDI 58
           ++ SKTL L SK +++ HNT +DCW++  +RK+Y+VT FL ++P       +L+ AG+DI
Sbjct: 3   INTSKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDI 62

Query: 59  TEIMKDKLVHEHSESAYEIMNDMYLVGYLAXXXXXXXXXXXXDHTVEVKLNESTQ-FDST 117
           T+ +KDK+    + S   +  D YL+GYLA            DH VEV+LNE+T  FDST
Sbjct: 63  TDELKDKIDSIKNPSFPILQTDQYLIGYLATDHEEKTLLTNKDHKVEVQLNEATNGFDST 122

Query: 118 TFVKELPTEDKLSIATDYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGK 177
           TFVK+LPTEDKLSIATD   D +KHKFLDLDKPLL Q++FGNFTKDFYLDQ+HRPRHYG 
Sbjct: 123 TFVKDLPTEDKLSIATDTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRHYGD 182

Query: 178 GSAPLFGNFLEPLSKTPWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIE 237
            SAPLFGN LEPL+KT WY +PI WLPVVFYH+ VALTNMN  FA+ LF++G++VWTLIE
Sbjct: 183 KSAPLFGNILEPLTKTSWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWTLIE 242

Query: 238 YCLHRFLFHLDQYLPERQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVF 297
           YC+HRFLFH D+ LPE  + + +HFLLHG HHYLPMD+YRLV+PPTLF+ LC PFYK+VF
Sbjct: 243 YCMHRFLFHFDERLPEHNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYKVVF 302

Query: 298 SLLPYYWACAGFAGGMLGYTCYDLTHYFLHHAKLPPYMRXXXXXXXXXXXXXXXXGFGVT 357
            LLP YWA AGFAGG+ GY CYDL HYFLHH+K+PP +R                G+GVT
Sbjct: 303 KLLPLYWAYAGFAGGLFGYVCYDLCHYFLHHSKMPPPLRKLKKYHLEHHYKNYQLGYGVT 362

Query: 358 SWFWDKVFGTYLGSDAPLSKMKYE 381
           SW+WDK+FGTYL  D+P+SKMKYE
Sbjct: 363 SWYWDKIFGTYLSPDSPMSKMKYE 386

>CAGL0F03399g Chr6 complement(333955..335097) [1143 bp, 380 aa] {ON}
           highly similar to uniprot|Q03529 Saccharomyces
           cerevisiae YMR272c SCS7 required for hydroxylation of
           ceramide
          Length = 380

 Score =  494 bits (1273), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 240/381 (62%), Positives = 280/381 (73%), Gaps = 7/381 (1%)

Query: 2   SESKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPG-GDQYILDHAGEDITE 60
             SKTL L  ++ L++HN+K+DCWVS + RK+Y+V+ +L++HP   D       G+  T+
Sbjct: 6   DSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTD 65

Query: 61  IMKDKLVHEHSESAYEIMNDMYLVGYLAXXXXXXXXXXXXDHTVEVKLNESTQFDSTTFV 120
           I + +L      +  + + D YLVGYLA             H VEVKLN    FDSTTFV
Sbjct: 66  ISQMEL------TTLKFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNTFDSTTFV 119

Query: 121 KELPTEDKLSIATDYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGKGSA 180
           K+LPTEDKLSI TDY  DYKKHKFLDL+KPLL Q++FGNFTKDFYLDQ+HRPRHYGKGSA
Sbjct: 120 KDLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGKGSA 179

Query: 181 PLFGNFLEPLSKTPWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIEYCL 240
           PLFGNFLE  +KT W+ +P  W PVV Y +  AL NMN P ALFLF LG+FVWTLIEYCL
Sbjct: 180 PLFGNFLEAFTKTAWWVVPTVWGPVVLYFITTALMNMNNPLALFLFGLGIFVWTLIEYCL 239

Query: 241 HRFLFHLDQYLPERQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVFSLL 300
           HRFLFH D++LPE  + F +HFLLHG HHYLPMD YRLV+PP LFV+LC P YKLVF+ L
Sbjct: 240 HRFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVFAAL 299

Query: 301 PYYWACAGFAGGMLGYTCYDLTHYFLHHAKLPPYMRXXXXXXXXXXXXXXXXGFGVTSWF 360
           PYYWACAGFAGGMLGY CYDL HYFLHH+K+PP+MR                GFGVTSWF
Sbjct: 300 PYYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRKLKKYHLEHHYKNYQLGFGVTSWF 359

Query: 361 WDKVFGTYLGSDAPLSKMKYE 381
           WDKVFGTYLG DAPLSKMKYE
Sbjct: 360 WDKVFGTYLGPDAPLSKMKYE 380

>Ecym_2712 Chr2 (1378070..1379215) [1146 bp, 381 aa] {ON} similar to
           Ashbya gossypii AAL183W
          Length = 381

 Score =  491 bits (1263), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 232/380 (61%), Positives = 283/380 (74%), Gaps = 1/380 (0%)

Query: 2   SESKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEI 61
           S  KTLPL SK++  +H     CWVS+  RK+YNV+ FL+E+P G QY+LDHAG+D+T++
Sbjct: 3   SSCKTLPLYSKSEFEKHVKPNQCWVSIDQRKIYNVSKFLDENPEGYQYVLDHAGQDVTQL 62

Query: 62  MKDKLVHEHSESAYEIMNDMYLVGYLAXXXXXXXXXXXXDHTVEVKLNESTQFDSTTFVK 121
           +KD    E ++ A+++++D YL+GYLA            +H VEVK     + DS  FVK
Sbjct: 63  LKDMQTDEPTDLAHQLLSDAYLIGYLATSEEERKLLTNANHVVEVKPANGNRVDSG-FVK 121

Query: 122 ELPTEDKLSIATDYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGKGSAP 181
           +LPTE+KL+IATD+ +DY+KH FLDLDKPL  QV+FGNFTK+FY+DQVHRPRHYGK SAP
Sbjct: 122 KLPTEEKLAIATDFKTDYEKHHFLDLDKPLFMQVLFGNFTKEFYIDQVHRPRHYGKESAP 181

Query: 182 LFGNFLEPLSKTPWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIEYCLH 241
           LFGNFLEPLSKT W+ IPI W P V Y++  AL N++ P ALFLF +GVFVWTLIEY LH
Sbjct: 182 LFGNFLEPLSKTSWWVIPIVWYPCVIYYIRTALLNISTPLALFLFGVGVFVWTLIEYGLH 241

Query: 242 RFLFHLDQYLPERQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVFSLLP 301
           RFLFH D  +PE  + F LHFLLHG+HHYLPMD+YRLVMPP LF+ LC PFYKLVFS+LP
Sbjct: 242 RFLFHFDDRMPESNIVFTLHFLLHGIHHYLPMDKYRLVMPPALFLALCYPFYKLVFSILP 301

Query: 302 YYWACAGFAGGMLGYTCYDLTHYFLHHAKLPPYMRXXXXXXXXXXXXXXXXGFGVTSWFW 361
           YY ACAGFAGG+ GY  YD+THYFLHH KLPP+MR                GFGVTSW+W
Sbjct: 302 YYCACAGFAGGLFGYVGYDVTHYFLHHRKLPPFMRKLKKYHLEHHYKNYELGFGVTSWYW 361

Query: 362 DKVFGTYLGSDAPLSKMKYE 381
           DKVF TYL   APLS+ KY+
Sbjct: 362 DKVFNTYLSPTAPLSRAKYD 381

>Kpol_541.9 s541 complement(23399..24523) [1125 bp, 374 aa] {ON}
           complement(23399..24523) [1125 nt, 375 aa]
          Length = 374

 Score =  484 bits (1246), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 228/380 (60%), Positives = 285/380 (75%), Gaps = 9/380 (2%)

Query: 2   SESKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEI 61
            +SKTL L +K++  +HNT+ DCWVS+  R +Y+V+++L+++   D  IL+HAG+DIT++
Sbjct: 4   KDSKTLELFAKSRFEEHNTEADCWVSVKERLIYDVSSYLKDNADADSSILEHAGKDITKL 63

Query: 62  MKDKLVHEHSESAYEIMNDMYLVGYLAXXXXXXXXXXXXDHTVEVKLNESTQFDSTTFVK 121
            K +         ++ ++D YLVGYLA            DH VEV L + T +DST FVK
Sbjct: 64  TKTR--------EFKFISDEYLVGYLATEEEEVRLLTNKDHKVEVNLQDGT-YDSTVFVK 114

Query: 122 ELPTEDKLSIATDYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGKGSAP 181
           ELP E+K ++ATD   D++ H FLDL+KP+LWQV+FGNFT+DFY+DQVHRPRHYGKGSAP
Sbjct: 115 ELPAEEKFTVATDLGKDFQDHHFLDLNKPMLWQVLFGNFTRDFYIDQVHRPRHYGKGSAP 174

Query: 182 LFGNFLEPLSKTPWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIEYCLH 241
           LFGNFLEP+S TPW+ IPI W PVV YHL VAL NMN  FA FLF LG+FVWTLIEYCLH
Sbjct: 175 LFGNFLEPISLTPWWLIPIIWGPVVVYHLSVALNNMNNIFAGFLFCLGIFVWTLIEYCLH 234

Query: 242 RFLFHLDQYLPERQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVFSLLP 301
           RFLFHLD ++P+  + + LHFLLHGVHHYLPMD+YRLV+PP LF++LCTP YKLVF LLP
Sbjct: 235 RFLFHLDDWVPQHNIFYTLHFLLHGVHHYLPMDQYRLVVPPALFLVLCTPIYKLVFGLLP 294

Query: 302 YYWACAGFAGGMLGYTCYDLTHYFLHHAKLPPYMRXXXXXXXXXXXXXXXXGFGVTSWFW 361
            YWA AGFAGG+LGY CYDLTHYF+HH KLP +MR                GFGV+++FW
Sbjct: 295 LYWAYAGFAGGLLGYICYDLTHYFIHHVKLPKFMRKVKKHHLEHHYKNYQLGFGVSNYFW 354

Query: 362 DKVFGTYLGSDAPLSKMKYE 381
           DKVFGTYLG D+P S M+Y+
Sbjct: 355 DKVFGTYLGPDSPASIMRYK 374

>KNAG0J00320 Chr10 (50267..51388) [1122 bp, 373 aa] {ON} Anc_8.829
           YMR272C
          Length = 373

 Score =  468 bits (1205), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 228/380 (60%), Positives = 274/380 (72%), Gaps = 9/380 (2%)

Query: 2   SESKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEI 61
           S S+TL L+SK  ++ HN K D WV +  RKV +++A++ E P  ++ +L  AG+DIT+ 
Sbjct: 3   SNSRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITD- 61

Query: 62  MKDKLVHEHSESAYEIMNDMYLVGYLAXXXXXXXXXXXXDHTVEVKLNESTQFDSTTFVK 121
                    S     +  D +LVGYLA            DH VEVKL     FDS+TFVK
Sbjct: 62  --------RSHEFPGLNADDHLVGYLATDLEEKELLSNKDHKVEVKLEGGETFDSSTFVK 113

Query: 122 ELPTEDKLSIATDYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGKGSAP 181
           +LPTEDKLSIATD   DY+KH FLDL+KPL+ QV+FG+FTKDFY+DQ+HRPRHYGKGSAP
Sbjct: 114 DLPTEDKLSIATDTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHYGKGSAP 173

Query: 182 LFGNFLEPLSKTPWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIEYCLH 241
           LFGNFLEP+SKT WY +PI W PVV Y L  +L  ++  FAL LF+LG FVWTLIEYC+H
Sbjct: 174 LFGNFLEPISKTAWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTLIEYCMH 233

Query: 242 RFLFHLDQYLPERQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVFSLLP 301
           RFLFH D +LPE  +AF +HFLLHGVHHYLPMD YRLV+PP LFV+LCTPFYKLVF LLP
Sbjct: 234 RFLFHFDDWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKLVFKLLP 293

Query: 302 YYWACAGFAGGMLGYTCYDLTHYFLHHAKLPPYMRXXXXXXXXXXXXXXXXGFGVTSWFW 361
           +Y ACAGFAGGM GY CYDL HYFLHH+K+P +MR                GFGV++WFW
Sbjct: 294 HYVACAGFAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFGVSNWFW 353

Query: 362 DKVFGTYLGSDAPLSKMKYE 381
           DKVF TYLG DAP+S MKY+
Sbjct: 354 DKVFDTYLGKDAPISPMKYD 373

>KAFR0B03850 Chr2 complement(796399..797532) [1134 bp, 377 aa] {ON}
           Anc_8.829 YMR272C
          Length = 377

 Score =  465 bits (1197), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 226/383 (59%), Positives = 279/383 (72%), Gaps = 8/383 (2%)

Query: 1   MSESKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITE 60
           M+ +KTL L SK +++ H  +EDCWV++++RK+Y+VT FL+E+   D  +LD+AG DIT 
Sbjct: 1   MTTAKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDIT- 59

Query: 61  IMKDKLVHEHSESAYEIM-NDMYLVGYLAXXXXXXXXXXXXDHTVEVKLNESTQFDSTTF 119
              D+LV+   +  Y+ + ND YLVGY+A            DH VEV L +   FD  T 
Sbjct: 60  ---DELVNGKLDEKYKALDNDNYLVGYVATADEEQKLLTNKDHKVEVTLEQD--FDLATL 114

Query: 120 VKELPTEDKLSIATDYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGKGS 179
           V ELP E+KL+IAT+Y  D+KKHKFLDL+KPLL Q++ G FT++FY+DQ++RPRHYG+ S
Sbjct: 115 VVELPPEEKLTIATNYDRDFKKHKFLDLNKPLLPQILKGKFTREFYVDQINRPRHYGQKS 174

Query: 180 APLFGN-FLEPLSKTPWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIEY 238
           APLFGN FLEP SKT W+ +P  WLPVVF+   VAL NMN P ALFLF +GVFVWTL+EY
Sbjct: 175 APLFGNAFLEPFSKTAWWVVPTFWLPVVFHFFRVALKNMNNPLALFLFCVGVFVWTLLEY 234

Query: 239 CLHRFLFHLDQYLPERQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVFS 298
           CLHRFLFH D YLPE  +AFALHFLLHG HHYLPMD YRLV+PP LF++LC P YK VF 
Sbjct: 235 CLHRFLFHFDNYLPENNIAFALHFLLHGFHHYLPMDPYRLVVPPALFIILCAPIYKTVFL 294

Query: 299 LLPYYWACAGFAGGMLGYTCYDLTHYFLHHAKLPPYMRXXXXXXXXXXXXXXXXGFGVTS 358
           LLPYYWACAGFAGG+ GY  YD+ HY LHH+KLPP+MR                G+G+TS
Sbjct: 295 LLPYYWACAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGITS 354

Query: 359 WFWDKVFGTYLGSDAPLSKMKYE 381
           WFWDKVFGTYL  DAP S MK++
Sbjct: 355 WFWDKVFGTYLSKDAPASVMKFD 377

>TBLA0D03180 Chr4 complement(774883..776085) [1203 bp, 400 aa] {ON}
           Anc_8.829 YMR272C
          Length = 400

 Score =  451 bits (1160), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 218/383 (56%), Positives = 269/383 (70%), Gaps = 3/383 (0%)

Query: 2   SESKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEI 61
           S   T  L S   + +HNTK+DCWV   NRK+Y+V+ +L ++P G+  I+D AG+DIT  
Sbjct: 18  SSPLTKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSS 77

Query: 62  MKDKLVHEHSESAYEIM--NDMYLVGYLAXXXXXXXXXXXXDHTVEVKLNES-TQFDSTT 118
            K++  + H    Y+ M  ND YLVGYLA             H VEVKL E  + +DSTT
Sbjct: 78  FKNQERYNHDPETYDFMSHNDKYLVGYLANEEEAYKLLSNPSHKVEVKLTEQPSTYDSTT 137

Query: 119 FVKELPTEDKLSIATDYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGKG 178
           FVKELP+ED   IATDY  D+ +H FLDL+KPL+ Q+    F + FY+DQ+HRPRH+G  
Sbjct: 138 FVKELPSEDHFVIATDYKKDFNEHHFLDLEKPLIPQLWRAKFNRAFYIDQIHRPRHFGNK 197

Query: 179 SAPLFGNFLEPLSKTPWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIEY 238
           SAPLFGNFLEPL+KT W+ IP+ WLPVVFYHL VA  NMN  FA FLF +GVFVWTLIEY
Sbjct: 198 SAPLFGNFLEPLTKTAWWVIPVVWLPVVFYHLKVAFHNMNNIFATFLFCVGVFVWTLIEY 257

Query: 239 CLHRFLFHLDQYLPERQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVFS 298
            LHRFLFH+D  +P+  + + LHF +HG HHYLPMD YRLVMPPTLF++LCTPFYKLVFS
Sbjct: 258 SLHRFLFHMDNRIPDHPMFYVLHFTIHGCHHYLPMDPYRLVMPPTLFLILCTPFYKLVFS 317

Query: 299 LLPYYWACAGFAGGMLGYTCYDLTHYFLHHAKLPPYMRXXXXXXXXXXXXXXXXGFGVTS 358
           +LP YWA AGFAGG+ GY CYD  HY+LHH+++P +MR                 FGV++
Sbjct: 318 VLPLYWAYAGFAGGLFGYVCYDEVHYWLHHSRVPKFMRLLKKLHLEHHYKNYQLAFGVSN 377

Query: 359 WFWDKVFGTYLGSDAPLSKMKYE 381
           +FWDKVFGTYL  D+PLS MKYE
Sbjct: 378 YFWDKVFGTYLYPDSPLSPMKYE 400

>TPHA0C04710 Chr3 complement(1015392..1016525) [1134 bp, 377 aa]
           {ON} Anc_8.829 YMR272C
          Length = 377

 Score =  421 bits (1082), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 206/379 (54%), Positives = 267/379 (70%), Gaps = 13/379 (3%)

Query: 4   SKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEH---PGGDQYILDHAGEDITE 60
           SKTL L S  +   HNT++DCWVS+ +R +Y+V+ F++E+   P  D  +L  AG+DI++
Sbjct: 7   SKTLELFSSEKFQSHNTEDDCWVSVKDRLIYDVSKFVQENKDVPVEDA-VLKRAGKDISD 65

Query: 61  IMKDKLVHEHSESAYEIMNDMYLVGYLAXXXXXXXXXXXXDHTVEVKLNESTQFDSTTFV 120
           +++ K        +++ ++D YLVGYLA            DH VEV L + T +DST FV
Sbjct: 66  LLETK--------SFKFVDDKYLVGYLANSTEEARLLTNKDHKVEVNLKDGT-YDSTVFV 116

Query: 121 KELPTEDKLSIATDYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGKGSA 180
           KELP+E+  +I+TDY  D+  H FLDL+KPLL Q++ GNFT++FY+DQ+HRPRHYGKGSA
Sbjct: 117 KELPSEEHFTISTDYKKDFVDHHFLDLEKPLLMQMLTGNFTREFYIDQIHRPRHYGKGSA 176

Query: 181 PLFGNFLEPLSKTPWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIEYCL 240
            LFGN+LEP+S TPW+ IPI W PVV YH YV   +M+   A+F + LG+FVWT IEYCL
Sbjct: 177 KLFGNWLEPISLTPWWLIPIIWGPVVVYHFYVGAQHMHPLSAVFFYFLGIFVWTFIEYCL 236

Query: 241 HRFLFHLDQYLPERQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVFSLL 300
           HRFLFHLD ++P+    + +HFLLHGVHHYLPMD+YRLV+PP LFV+LCTPFYK VF+LL
Sbjct: 237 HRFLFHLDDWVPQHNFFYTIHFLLHGVHHYLPMDQYRLVVPPALFVVLCTPFYKAVFALL 296

Query: 301 PYYWACAGFAGGMLGYTCYDLTHYFLHHAKLPPYMRXXXXXXXXXXXXXXXXGFGVTSWF 360
           P Y A  GFAGG+ GY  YDLTHYF+HH KLP   R                GFGV+++F
Sbjct: 297 PLYVAYVGFAGGLTGYIIYDLTHYFIHHVKLPRVFRKIKKHHLEHHYKNYQLGFGVSNYF 356

Query: 361 WDKVFGTYLGSDAPLSKMK 379
           WD VFGTYLG D+P S M+
Sbjct: 357 WDLVFGTYLGPDSPASIMR 375

>Kpol_1069.4 s1069 (6163..6996) [834 bp, 277 aa] {ON} (6163..6996)
           [834 nt, 278 aa]
          Length = 277

 Score =  329 bits (843), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 149/245 (60%), Positives = 186/245 (75%)

Query: 125 TEDKLSIATDYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGKGSAPLFG 184
           TE+KL + TDY+ D+ ++ FL LD+PL WQ++  NFT+DFY+DQVH+PRHYG  SAP+FG
Sbjct: 19  TEEKLKVTTDYNKDFNENGFLKLDEPLFWQLLSSNFTRDFYIDQVHKPRHYGIESAPIFG 78

Query: 185 NFLEPLSKTPWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIEYCLHRFL 244
           NFLEP +KT W+ +P+ W PVV Y+  V+L  ++   A+ LFS+GVFVWTLIEYC+HR+L
Sbjct: 79  NFLEPFTKTHWFMVPLIWGPVVLYNFIVSLREISIILAITLFSIGVFVWTLIEYCMHRYL 138

Query: 245 FHLDQYLPERQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVFSLLPYYW 304
           FHLD  +PE +L F LHFLLHG+HHYLPMD+YRLVMPP LF +LC PFY L F++ P YW
Sbjct: 139 FHLDDSVPETRLFFVLHFLLHGIHHYLPMDKYRLVMPPALFSILCYPFYLLTFAIFPRYW 198

Query: 305 ACAGFAGGMLGYTCYDLTHYFLHHAKLPPYMRXXXXXXXXXXXXXXXXGFGVTSWFWDKV 364
           A AGFAGG+ GY CYD+THYFLHH K+P +MR                GFGVTS FWD+V
Sbjct: 199 AHAGFAGGLFGYVCYDVTHYFLHHKKMPSFMRKVKKYHLEHHYKNFQLGFGVTSSFWDRV 258

Query: 365 FGTYL 369
           FGTYL
Sbjct: 259 FGTYL 263

>Kpol_505.14 s505 (37085..37456) [372 bp, 123 aa] {ON}
          (37085..37456) [372 nt, 124 aa]
          Length = 123

 Score = 71.2 bits (173), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 32/70 (45%), Positives = 49/70 (70%), Gaps = 4/70 (5%)

Query: 14 QLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKLVHEHSES 73
          ++++HNT E CW+ + + KVY+ T FL+EHPGGD+ ILD AG+D TE  +D     HS+ 
Sbjct: 9  EIAEHNTTESCWIVI-DGKVYDTTKFLDEHPGGDEIILDLAGQDATESFEDI---GHSDE 64

Query: 74 AYEIMNDMYL 83
          A +I+  +Y+
Sbjct: 65 ALKILKKLYI 74

>TDEL0F01210 Chr6 complement(216322..216702) [381 bp, 126 aa] {ON}
          Anc_2.166 YNL111C
          Length = 126

 Score = 71.2 bits (173), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 50/71 (70%), Gaps = 4/71 (5%)

Query: 11 SKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKLVHEH 70
          S  Q+++HN+ ED W+ + + KVY+VT F++EHPGGD+ ILD AG+D +E  +D     H
Sbjct: 6  SYQQIAEHNSAEDIWI-VVDGKVYDVTKFMDEHPGGDEIILDLAGQDASEPFRDI---GH 61

Query: 71 SESAYEIMNDM 81
          SE A +I+N +
Sbjct: 62 SEEALKILNTL 72

>ZYRO0B09812g Chr2 (765874..766425) [552 bp, 183 aa] {ON} similar to
           uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
           Cytochrome b5 involved in the sterol and lipid
           biosynthesis pathways required for sterol C5-6 and fatty
           acid desaturation
          Length = 183

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/74 (48%), Positives = 51/74 (68%), Gaps = 5/74 (6%)

Query: 14  QLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKLVHEHSES 73
           Q+++HNT ED W+ + + KVY+VT F+E+HPGGD+ ILD AG+D TE   D     HSE 
Sbjct: 65  QVAEHNTPEDAWL-IVDGKVYDVTKFVEDHPGGDEIILDLAGQDGTEAFNDI---GHSED 120

Query: 74  AYEIMNDMYLVGYL 87
           A  ++ D ++VG L
Sbjct: 121 AVNMLKD-FIVGSL 133

>Skud_14.221 Chr14 complement(407119..407481) [363 bp, 120 aa]
          {ON} YNL111C (REAL)
          Length = 120

 Score = 65.9 bits (159), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 29/73 (39%), Positives = 48/73 (65%), Gaps = 4/73 (5%)

Query: 11 SKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKLVHEH 70
          S  ++++HN  E+CW+ + + KVY+V+ F +EHPGGD+ I+D  G+D TE   D     H
Sbjct: 6  SYQEVAEHNGPENCWI-IIDDKVYDVSQFKDEHPGGDEIIMDLGGQDATESFVDI---GH 61

Query: 71 SESAYEIMNDMYL 83
          S+ A  ++ D+Y+
Sbjct: 62 SDEALRLLKDLYI 74

>TPHA0F01790 Chr6 (412270..412818) [549 bp, 182 aa] {ON} Anc_2.166
           YNL111C
          Length = 182

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 46/70 (65%), Gaps = 4/70 (5%)

Query: 14  QLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKLVHEHSES 73
           ++++HNT E  W+ +   KVYNVT FL+EHPGGD+ I D AG D TE  +D     HS+ 
Sbjct: 67  EIAEHNTTESSWIVI-EGKVYNVTKFLDEHPGGDEIIFDLAGTDATENFEDI---GHSDQ 122

Query: 74  AYEIMNDMYL 83
           A +++  +Y+
Sbjct: 123 ALKVLKTLYI 132

>Suva_14.228 Chr14 complement(413753..414115) [363 bp, 120 aa]
          {ON} YNL111C (REAL)
          Length = 120

 Score = 61.2 bits (147), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 27/73 (36%), Positives = 48/73 (65%), Gaps = 4/73 (5%)

Query: 11 SKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKLVHEH 70
          S  ++++HN  E+CW+ + + KVY+V+ F +EHPGGD+ I+D  G+D T+   D     H
Sbjct: 6  SYQEVAEHNGPENCWI-IIDDKVYDVSQFKDEHPGGDEIIMDLGGQDATDSFVDI---GH 61

Query: 71 SESAYEIMNDMYL 83
          S+ A +++  +Y+
Sbjct: 62 SDEALKLLKTLYI 74

>NDAI0F02730 Chr6 (669821..670186) [366 bp, 121 aa] {ON} Anc_2.166
          Length = 121

 Score = 61.2 bits (147), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 47/70 (67%), Gaps = 4/70 (5%)

Query: 14 QLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKLVHEHSES 73
          ++++HN+ +D W+ +   KVY+V+ FL+EHPGG++ I + AG D TE  +D     HS+ 
Sbjct: 9  EIAKHNSPDDTWIVIEG-KVYDVSKFLDEHPGGEEIIFELAGTDATENFEDI---GHSDD 64

Query: 74 AYEIMNDMYL 83
          A +I+  MY+
Sbjct: 65 ALKILKKMYI 74

>TBLA0B01310 Chr2 (276173..276544) [372 bp, 123 aa] {ON} Anc_2.166
          YNL111C
          Length = 123

 Score = 60.8 bits (146), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 47/75 (62%), Gaps = 4/75 (5%)

Query: 9  LLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKLVH 68
          L S  +++ HNT E  W+ + + KVY+VT FL+ HPGGD+ IL+ AG+D T+  +D    
Sbjct: 4  LYSYEEIAAHNTTESAWIIIKD-KVYDVTKFLDSHPGGDEIILELAGQDATQDFEDI--- 59

Query: 69 EHSESAYEIMNDMYL 83
           HS  A E ++ + L
Sbjct: 60 GHSNDALEFLDALLL 74

>KLTH0D09284g Chr4 (770560..770931) [372 bp, 123 aa] {ON} similar
          to uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
          Cytochrome b5 involved in the sterol and lipid
          biosynthesis pathways required for sterol C5-6 and
          fatty acid desaturation
          Length = 123

 Score = 60.8 bits (146), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 49/75 (65%), Gaps = 4/75 (5%)

Query: 9  LLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKLVH 68
          L S  ++++HNT+ D W+ + + KVY+ T F++EHPGG++ +LD  G+D T    D    
Sbjct: 4  LYSYKEIAEHNTENDLWM-IIDGKVYDCTKFMDEHPGGEEVLLDLGGQDATGPFADI--- 59

Query: 69 EHSESAYEIMNDMYL 83
           HS+ A +++ D+Y+
Sbjct: 60 GHSDDAVKMLEDLYV 74

>KNAG0I02040 Chr9 (397527..397886) [360 bp, 119 aa] {ON} Anc_2.166
          YNL111C
          Length = 119

 Score = 60.5 bits (145), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 44/69 (63%), Gaps = 4/69 (5%)

Query: 15 LSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKLVHEHSESA 74
          ++QH+T ED W+ + NR VY VT FL+EHPGG++ +L+ AG D T    D     HS+ A
Sbjct: 10 VAQHSTSEDAWIVIDNR-VYEVTKFLDEHPGGEEILLEMAGADATTNFLDI---GHSDDA 65

Query: 75 YEIMNDMYL 83
           +I+   Y+
Sbjct: 66 MKILKTRYI 74

>CAGL0L03828g Chr12 (442660..443025) [366 bp, 121 aa] {ON} similar
          to uniprot|P40312 Saccharomyces cerevisiae YNL111c CYB5
          Length = 121

 Score = 60.5 bits (145), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 43/68 (63%), Gaps = 4/68 (5%)

Query: 14 QLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKLVHEHSES 73
          Q+S+HN + DCW+ + +  VY+V+ FL+EHPGGD+ I +H G D T    D     HS+ 
Sbjct: 9  QVSEHNKEGDCWI-IIDGSVYDVSKFLDEHPGGDEIIFEHRGTDATGDFVDI---GHSDD 64

Query: 74 AYEIMNDM 81
          A +I+  +
Sbjct: 65 ALKILKTL 72

>NCAS0G02570 Chr7 complement(460218..460583) [366 bp, 121 aa] {ON}
          Anc_2.536 YMR073C
          Length = 121

 Score = 60.5 bits (145), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 29/71 (40%), Positives = 45/71 (63%), Gaps = 4/71 (5%)

Query: 11 SKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKLVHEH 70
          S  Q+++HN  +D W+ +   KVY+V+ FL+EHPGGD+ I + AG+D TE   D     H
Sbjct: 6  SYQQIAEHNKPDDAWI-IIEGKVYDVSKFLDEHPGGDEIIFELAGQDATEHFLDI---GH 61

Query: 71 SESAYEIMNDM 81
          S+ A +I+  +
Sbjct: 62 SDDALQILRKL 72

>AFL223W Chr6 (19601..20098) [498 bp, 165 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YNL111C (CYB5)
          Length = 165

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 52/79 (65%), Gaps = 5/79 (6%)

Query: 6   TLP-LLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKD 64
           T+P L +  ++++HN++ D W+ + N KVY+ T F EEHPGGD+ ++D AG+D TE   D
Sbjct: 39  TMPKLYTYQEIAEHNSENDLWL-IINGKVYDCTKFAEEHPGGDEVLIDLAGQDATEPFAD 97

Query: 65  KLVHEHSESAYEIMNDMYL 83
                HS+ A +++  +Y+
Sbjct: 98  I---GHSDDAVKMLEGLYV 113

>Kwal_26.8461 s26 (794482..794853) [372 bp, 123 aa] {ON} YNL111C
          (CYB5) - 1:1 [contig 61] FULL
          Length = 123

 Score = 60.1 bits (144), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 50/75 (66%), Gaps = 4/75 (5%)

Query: 9  LLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKLVH 68
          L S  ++++HNT++D W+ + + KVY+ T F++EHPGG++ ++D  G+D T    D    
Sbjct: 4  LYSYKEIAEHNTEKDLWM-IIDGKVYDCTKFMDEHPGGEEVLVDLGGQDATGPFADI--- 59

Query: 69 EHSESAYEIMNDMYL 83
           HS+ A +++ D+Y+
Sbjct: 60 GHSDDAVKMLADLYV 74

>TDEL0D00190 Chr4 (29971..31629) [1659 bp, 552 aa] {ON} 
          Length = 552

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 52/79 (65%), Gaps = 6/79 (7%)

Query: 10  LSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKLVHE 69
           +S ++L +HNT  DCW++L N +VY+VTAFL+ HPGG   +++ AG D TE    K    
Sbjct: 75  ISASELRKHNTVHDCWIAL-NGEVYDVTAFLQMHPGGVARLMEVAGGDATE----KFYQI 129

Query: 70  HSESAYEIMNDMYL-VGYL 87
           HS+S +E M + ++ +G L
Sbjct: 130 HSDSVFEKMKNNFIYIGKL 148

>KLLA0F23672g Chr6 (2212223..2212594) [372 bp, 123 aa] {ON}
          similar to uniprot|P40312 Saccharomyces cerevisiae
          YNL111C CYB5 Cytochrome b5 involved in the sterol and
          lipid biosynthesis pathways required for sterol C5-6
          and fatty acid desaturation
          Length = 123

 Score = 58.5 bits (140), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 49/75 (65%), Gaps = 4/75 (5%)

Query: 9  LLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKLVH 68
          LL+  ++S+H T +D W+ + + KVY+ T F++EHPGGD+ ++D  G+D T   +D    
Sbjct: 4  LLTYKEVSEHKTVDDLWM-IIDGKVYDCTKFVDEHPGGDEILVDLGGQDATGPFEDI--- 59

Query: 69 EHSESAYEIMNDMYL 83
           HS+ A +++  MY+
Sbjct: 60 GHSDDAIKLLEPMYV 74

>KAFR0B04550 Chr2 (946561..946941) [381 bp, 126 aa] {ON} Anc_2.166
          YNL111C
          Length = 126

 Score = 58.2 bits (139), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 28/67 (41%), Positives = 44/67 (65%), Gaps = 4/67 (5%)

Query: 15 LSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKLVHEHSESA 74
          +++H   +DCW+++ + KVYNV+ FL+EHPGGD+ I + AG D TE   D     HS+ A
Sbjct: 10 VAEHVLPDDCWIAI-DGKVYNVSKFLDEHPGGDEIIYELAGSDATEYFLDI---GHSDDA 65

Query: 75 YEIMNDM 81
           +I+  +
Sbjct: 66 LKILKTL 72

>YNL111C Chr14 complement(416940..417302) [363 bp, 120 aa] {ON}
          CYB5Cytochrome b5, involved in the sterol and lipid
          biosynthesis pathways; acts as an electron donor to
          support sterol C5-6 desaturation
          Length = 120

 Score = 58.2 bits (139), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 27/73 (36%), Positives = 46/73 (63%), Gaps = 4/73 (5%)

Query: 11 SKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKLVHEH 70
          S  ++++HN  E+ W+ + + KVY+V+ F +EHPGGD+ I+D  G+D TE   D     H
Sbjct: 6  SYQEVAEHNGPENFWI-IIDDKVYDVSQFKDEHPGGDEIIMDLGGQDATESFVDI---GH 61

Query: 71 SESAYEIMNDMYL 83
          S+ A  ++  +Y+
Sbjct: 62 SDEALRLLKGLYI 74

>Smik_14.216 Chr14 complement(396585..396947) [363 bp, 120 aa]
          {ON} YNL111C (REAL)
          Length = 120

 Score = 57.8 bits (138), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 27/73 (36%), Positives = 46/73 (63%), Gaps = 4/73 (5%)

Query: 11 SKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKLVHEH 70
          S  ++++HN  E+ W+ + + KVY+V+ F +EHPGGD+ I+D  G+D TE   D     H
Sbjct: 6  SYQEVAEHNGPENFWI-IIDDKVYDVSKFKDEHPGGDEIIMDLGGQDATESFVDI---GH 61

Query: 71 SESAYEIMNDMYL 83
          S+ A  ++  +Y+
Sbjct: 62 SDEALRLLKGLYI 74

>KLLA0F27577g Chr6 (2556662..2557180) [519 bp, 172 aa] {ON} some
          similarities with uniprot|P40312 Saccharomyces
          cerevisiae YNL111C CYB5 Cytochrome b5
          Length = 172

 Score = 59.3 bits (142), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 48/70 (68%), Gaps = 2/70 (2%)

Query: 8  PLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKLV 67
          PL++  ++++H+++ DCW  ++  KVY++T+FL +HPGG Q +L +AG+D T +  D + 
Sbjct: 4  PLITMDEVARHSSRSDCWTVIHG-KVYDITSFLHKHPGGAQVLLKYAGKDST-LQFDDIG 61

Query: 68 HEHSESAYEI 77
          H     AY++
Sbjct: 62 HSMESLAYDL 71

>SAKL0E10626g Chr5 (885272..885643) [372 bp, 123 aa] {ON} similar
          to uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
          Cytochrome b5 involved in the sterol and lipid
          biosynthesis pathways required for sterol C5-6 and
          fatty acid desaturation
          Length = 123

 Score = 56.2 bits (134), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 25/75 (33%), Positives = 48/75 (64%), Gaps = 4/75 (5%)

Query: 9  LLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKLVH 68
          L +  ++++HNT+ D W+ + + KVY+ T F++EHPGG++ ++D  G+D T    D    
Sbjct: 4  LFTYQEIAEHNTEGDLWM-IIDGKVYDCTKFIDEHPGGEEVLVDLGGQDATGPFADI--- 59

Query: 69 EHSESAYEIMNDMYL 83
           HS+ A +++  +Y+
Sbjct: 60 GHSDDAIKLLEPLYI 74

>TDEL0H02180 Chr8 (369539..370150) [612 bp, 203 aa] {ON} 
          Length = 203

 Score = 57.8 bits (138), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 38/57 (66%), Gaps = 1/57 (1%)

Query: 3  ESKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDIT 59
          E + LP +   ++ +HNT  DCW++++ R VY+VT  L +HPGG Q +L +AG D T
Sbjct: 18 EDRNLPKIRLAEVREHNTAHDCWMAIHGR-VYDVTPILSKHPGGCQILLKYAGMDAT 73

>Kwal_47.18167 s47 complement(716570..717253) [684 bp, 227 aa]
          {ON} YNL111C (CYB5) - cytochrome b5 [contig 197] FULL
          Length = 227

 Score = 57.8 bits (138), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 39/56 (69%), Gaps = 1/56 (1%)

Query: 4  SKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDIT 59
          S  LP +S  +++ H   +DCW+S++  KVY+V+++L +HPGG Q +L  AG+D T
Sbjct: 28 SSQLPFISSDEVATHTDADDCWISIHG-KVYDVSSYLPQHPGGAQVMLKLAGKDAT 82

>NDAI0D04700 Chr4 (1103670..1105547) [1878 bp, 625 aa] {ON} 
          Length = 625

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 40/59 (67%), Gaps = 6/59 (10%)

Query: 8   PLLSKT-----QLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEI 61
           P+ SKT     +L +HNT EDCWV + N +VY++T F++ HPGG   I  +AG+D+T I
Sbjct: 98  PVKSKTPITPNELMKHNTPEDCWV-VINNQVYDLTTFIQVHPGGPNIIRSNAGKDVTAI 155

>Kpol_1014.5 s1014 complement(3107..4897) [1791 bp, 596 aa] {ON}
           complement(3107..4897) [1791 nt, 597 aa]
          Length = 596

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 43/57 (75%), Gaps = 1/57 (1%)

Query: 5   KTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEI 61
           K+L +++  ++ +HN+K+DCWV + N  VY++T F+++HPGG   I+ +AG+D++ I
Sbjct: 86  KSLKIITPQEVIKHNSKDDCWV-VINDIVYDLTFFIKKHPGGQDVIVGNAGKDVSNI 141

>Ecym_5420 Chr5 (865505..865942) [438 bp, 145 aa] {ON} similar to
          Ashbya gossypii AFL223W
          Length = 145

 Score = 54.3 bits (129), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 46/70 (65%), Gaps = 4/70 (5%)

Query: 14 QLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKLVHEHSES 73
          +++ HN+++D W+ + N KVY+ + F +EHPGGD+ +LD  G+D T    D     H++ 
Sbjct: 9  EIADHNSEQDLWL-IINGKVYDCSKFADEHPGGDEVLLDLGGQDATIPFLDI---GHTDD 64

Query: 74 AYEIMNDMYL 83
          A ++++ MY+
Sbjct: 65 AVKLLDHMYI 74

>KLTH0A04026g Chr1 complement(337200..337901) [702 bp, 233 aa]
          {ON} weakly similar to uniprot|P40312 Saccharomyces
          cerevisiae YNL111C CYB5 Cytochrome b5, involved in the
          sterol and lipid biosynthesis pathways
          Length = 233

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 39/57 (68%), Gaps = 1/57 (1%)

Query: 8  PLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKD 64
          P++S+ +L+ H + EDCW++++   VY+V+ +L +HPGG Q +L  AG+D T    D
Sbjct: 32 PVISREELATHTSAEDCWLAIHG-AVYDVSRYLTQHPGGAQVMLKLAGKDATAQFDD 87

>TPHA0B01820 Chr2 complement(406416..408146) [1731 bp, 576 aa] {ON}
           Anc_4.304 YML054C
          Length = 576

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 41/57 (71%), Gaps = 1/57 (1%)

Query: 5   KTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEI 61
           K   +++  ++++HN ++DCWV + N  VYN+T F++ HPGG   I+ ++G+D+T++
Sbjct: 68  KNSKVITPEEVARHNKRDDCWV-VINDSVYNLTDFIDSHPGGKNVIVANSGKDVTKL 123

>KLTH0C11858g Chr3 (979073..980740) [1668 bp, 555 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 555

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 46/76 (60%), Gaps = 6/76 (7%)

Query: 13  TQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKLVHEHSE 72
           +++ QHN  +DCW+ L N +VY+VT+FL+ HPGG   I++ AG D T     K    HS+
Sbjct: 79  SEVMQHNKPDDCWIVL-NGEVYDVTSFLQMHPGGAARIMEVAGNDATR----KFYSIHSD 133

Query: 73  SAYEIMNDMYL-VGYL 87
           S  E M +  + +G L
Sbjct: 134 STLEKMKEQLVYIGKL 149

>NDAI0D04710 Chr4 (1106280..1108130) [1851 bp, 616 aa] {ON}
           Anc_4.304
          Length = 616

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 40/54 (74%), Gaps = 1/54 (1%)

Query: 8   PLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEI 61
           PL+S  ++++H+T  DCWV +++ KVY++T+F+  HPGG   I  +AG+D+T I
Sbjct: 94  PLISPDEVAKHHTPADCWVVIHD-KVYDLTSFIPIHPGGPDIIKSNAGKDVTNI 146

>KLLA0D02640g Chr4 complement(225482..227251) [1770 bp, 589 aa] {ON}
           similar to uniprot|P00175 Saccharomyces cerevisiae
           YML054C CYB2 Cytochrome b2 (L-lactate cytochrome-c
           oxidoreductase) component of the mitochondrial
           intermembrane space required for lactate utilization
           expression is repressed by glucose and anaerobic
           conditions
          Length = 589

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 40/56 (71%), Gaps = 1/56 (1%)

Query: 6   TLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEI 61
           T P +S T++++H++ +DCWV +    VYN+T F+  HPGG   I ++AG+D+T+I
Sbjct: 86  TKPKVSPTEVAKHSSPKDCWVVIEGY-VYNLTDFISAHPGGPAIIENNAGKDVTKI 140

>SAKL0F08316g Chr6 complement(634949..635485) [537 bp, 178 aa]
          {ON} some similarities with uniprot|P00175
          Saccharomyces cerevisiae YML054C CYB2 Cytochrome b2
          (L-lactate cytochrome-c oxidoreductase), component of
          the mitochondrial intermembrane space, required for
          lactate utilization; expression is repressed by glucose
          and anaerobic conditions
          Length = 178

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 37/52 (71%), Gaps = 1/52 (1%)

Query: 9  LLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITE 60
          ++S +++ +HN  +DCW+ ++  KVYN+T+FL +HPGG   IL + G D T+
Sbjct: 3  VISPSEVVKHNRPDDCWMIIHG-KVYNLTSFLSQHPGGAHVILQYGGRDATK 53

>KLTH0D06930g Chr4 complement(604805..605419) [615 bp, 204 aa] {ON}
           weakly similar to uniprot|Q04772 Saccharomyces
           cerevisiae YMR073C Hypothetical ORF
          Length = 204

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 46/77 (59%), Gaps = 6/77 (7%)

Query: 10  LSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYIL-DHAGEDITEIMKDKLVH 68
           ++K QL +HNT EDCW  L N++VY V+++L+ HPGG + +L   AG+D T +       
Sbjct: 129 VTKAQLQKHNTAEDCWCVL-NQRVYCVSSYLDFHPGGAEILLRTAAGKDATALFNK---- 183

Query: 69  EHSESAYEIMNDMYLVG 85
            H    YE + +  LVG
Sbjct: 184 YHRWVNYERLLETCLVG 200

>ADL085C Chr4 complement(535293..536114) [822 bp, 273 aa] {ON}
           NOHBY406; No homolog in Saccharomyces cerevisiae
          Length = 273

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 36/53 (67%), Gaps = 1/53 (1%)

Query: 7   LPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDIT 59
           L  +S  ++SQH +++DCW  ++ R VY++T  LE HPGG + +L +AG D T
Sbjct: 90  LRKISIEEVSQHTSRDDCWFIIHGR-VYDITGLLENHPGGTKILLKYAGRDAT 141

>KLTH0C11770g Chr3 (970979..972835) [1857 bp, 618 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 618

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 39/52 (75%), Gaps = 1/52 (1%)

Query: 10  LSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEI 61
           +S T++ +HN ++DCWV + +  VY+VTAF+++HPGG   I  +AG+D++ +
Sbjct: 119 VSATEVIRHNKEDDCWV-VIDGYVYDVTAFIDQHPGGSAVIRGNAGKDVSAL 169

>KNAG0E03860 Chr5 (763388..765202) [1815 bp, 604 aa] {ON} Anc_4.304
           YML054C
          Length = 604

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 37/54 (68%), Gaps = 1/54 (1%)

Query: 10  LSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMK 63
           +S +++++HNT +DCWV +    VYN+T F+  HPGG   I  +AG+D+T I K
Sbjct: 92  ISPSEVAKHNTPDDCWVVIEGY-VYNLTEFIPTHPGGPMVIKSNAGKDVTAIFK 144

>NCAS0A02780 Chr1 (531072..532880) [1809 bp, 602 aa] {ON} Anc_4.304
          Length = 602

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 42/63 (66%), Gaps = 3/63 (4%)

Query: 1   MSESKTLP--LLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDI 58
            +ESK  P  ++  +++++HNT  DCW+ + N  VY++T+F+  HPGG   I  +AG+D+
Sbjct: 78  QNESKLAPKRVIDPSEVARHNTPADCWI-VINGVVYDLTSFIPVHPGGADIIKSNAGKDV 136

Query: 59  TEI 61
           T I
Sbjct: 137 TAI 139

>Kwal_23.2823 s23 (29032..30714) [1683 bp, 560 aa] {ON} YML054C
           (CYB2) - Cytochrome b2 [L--lactate cytochrome-c
           oxidoreductase] [contig 246] FULL
          Length = 560

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 39/64 (60%), Gaps = 8/64 (12%)

Query: 18  HNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKLVHEHSESAYEI 77
           HN   DCW+ L N +VY+VT+F+  HPGG Q IL+ AG D TE    K    HSE   ++
Sbjct: 89  HNKLNDCWIVL-NDEVYDVTSFIAAHPGGVQRILEVAGSDATE----KFYQIHSE---DV 140

Query: 78  MNDM 81
           +N M
Sbjct: 141 LNKM 144

>NCAS0A02770 Chr1 (528814..530643) [1830 bp, 609 aa] {ON} 
          Length = 609

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 40/58 (68%), Gaps = 1/58 (1%)

Query: 4   SKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEI 61
           S T   +S  ++++HN++ DCW+ + N +VY++T+F+  HPGG   I  +AG+D++ I
Sbjct: 89  SSTKSPISTDEVTKHNSENDCWI-VINGQVYDLTSFMSIHPGGSDIIKLNAGKDVSAI 145

>CAGL0K10736g Chr11 (1046127..1047908) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P00175 Saccharomyces cerevisiae
           YML054c CYB2 lactate dehydrogenase cytochrome b2
          Length = 593

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 37/54 (68%), Gaps = 1/54 (1%)

Query: 8   PLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEI 61
           P +S +++ +HNT EDCWV + +  VY++T F+  HPGG   I  +AG+D+T I
Sbjct: 88  PKISPSEVIKHNTPEDCWV-VIDGYVYDLTNFIALHPGGPDIIKTNAGKDVTAI 140

>ZYRO0D16654g Chr4 complement(1380316..1380888) [573 bp, 190 aa]
          {ON} conserved hypothetical protein
          Length = 190

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 3  ESKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDIT 59
          + + LP LS  ++ +H T  DCW+ ++ R VYNV   L  HPGG Q +L + G D T
Sbjct: 23 DDEDLPSLSWDEIRKHMTPPDCWMVIHGR-VYNVAPVLASHPGGSQILLHYVGRDAT 78

>KLLA0B14795g Chr2 (1299429..1301099) [1671 bp, 556 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 556

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 41/71 (57%), Gaps = 5/71 (7%)

Query: 10  LSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKLVHE 69
           +S  ++  HN  +DCW+ + N +VY++T FL +HPGG   +++ AG D TE    +    
Sbjct: 81  VSVKEVKMHNRIDDCWIVIDN-EVYDITKFLSQHPGGVARLMEFAGRDATE----RFYQM 135

Query: 70  HSESAYEIMND 80
           HS +  E M +
Sbjct: 136 HSSATLEKMKE 146

>Kwal_26.8046 s26 complement(621715..622311) [597 bp, 198 aa] {ON}
           YMR073C - Hypothetical ORF [contig 55] FULL
          Length = 198

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 36/53 (67%), Gaps = 2/53 (3%)

Query: 10  LSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGG-DQYILDHAGEDITEI 61
           ++K QL+QH   EDCW  + N+KVY ++++L+ HPGG D  +   AG+D T +
Sbjct: 123 INKAQLAQHKAPEDCWC-VINQKVYCISSYLDFHPGGVDILMKGAAGKDCTSM 174

>KAFR0I00520 Chr9 complement(107239..108999) [1761 bp, 586 aa] {ON}
           Anc_4.304 YML054C
          Length = 586

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 40/60 (66%), Gaps = 1/60 (1%)

Query: 2   SESKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEI 61
           +E+ T  L+   ++++H T +DCWV + N  VY++T+F+  HPGG   +  +AG+D+T I
Sbjct: 75  NEAITTRLILPEEVAKHKTPDDCWV-VINGYVYDITSFIMSHPGGPDVLETNAGKDVTAI 133

>CAGL0K03069g Chr11 complement(285190..285774) [585 bp, 194 aa] {ON}
           weakly similar to uniprot|Q04772 Saccharomyces
           cerevisiae YMR073c
          Length = 194

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 36/47 (76%), Gaps = 2/47 (4%)

Query: 14  QLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDH-AGEDIT 59
           +L++HNT EDCW ++ N KVY+++++L  HPGG + ++D  +G+D T
Sbjct: 123 ELARHNTAEDCW-TVINGKVYSISSYLSFHPGGAKILIDKSSGQDST 168

>YML054C Chr13 complement(165533..167308) [1776 bp, 591 aa] {ON}
           CYB2Cytochrome b2 (L-lactate cytochrome-c
           oxidoreductase), component of the mitochondrial
           intermembrane space, required for lactate utilization;
           expression is repressed by glucose and anaerobic
           conditions
          Length = 591

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 35/52 (67%), Gaps = 1/52 (1%)

Query: 10  LSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEI 61
           +S  ++++HN  +DCWV + N  VY++T FL  HPGG   I  +AG+D+T I
Sbjct: 91  ISPAEVAKHNKPDDCWV-VINGYVYDLTRFLPNHPGGQDVIKFNAGKDVTAI 141

>Smik_13.92 Chr13 complement(163135..164910) [1776 bp, 591 aa] {ON}
           YML054C (REAL)
          Length = 591

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 35/52 (67%), Gaps = 1/52 (1%)

Query: 10  LSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEI 61
           +S  ++++HN  +DCWV + N  VY++T FL  HPGG   I  +AG+D+T I
Sbjct: 91  ISPAEVAKHNKPDDCWV-VINGYVYDLTRFLPNHPGGQDVIKFNAGKDVTAI 141

>Suva_13.105 Chr13 complement(168279..170054) [1776 bp, 591 aa] {ON}
           YML054C (REAL)
          Length = 591

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 35/52 (67%), Gaps = 1/52 (1%)

Query: 10  LSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEI 61
           +S  ++++HN+ +DCWV + N  VY++T F+  HPGG   I  +AG D+T I
Sbjct: 91  ISPAEVAKHNSADDCWV-VINGYVYDLTRFVPNHPGGPDVIKYNAGRDVTAI 141

>Ecym_4346 Chr4 (739106..739735) [630 bp, 209 aa] {ON} similar to
          Ashbya gossypii ADL085C
          Length = 209

 Score = 48.5 bits (114), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 34/50 (68%), Gaps = 1/50 (2%)

Query: 10 LSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDIT 59
          +S +++ +H + +DCW  ++N KVY++T  L  HPGG + +L +AG D T
Sbjct: 6  ISLSEVRRHTSADDCWFIIHN-KVYDITNLLSTHPGGAKTLLKYAGRDAT 54

>Skud_13.92 Chr13 complement(163654..165429) [1776 bp, 591 aa] {ON}
           YML054C (REAL)
          Length = 591

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 34/52 (65%), Gaps = 1/52 (1%)

Query: 10  LSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEI 61
           +S  ++++HN  +DCWV + N  VY++T F+  HPGG   I  +AG D+T I
Sbjct: 91  ISPAEVAKHNKADDCWV-VINGYVYDLTRFMPNHPGGPDVIKFNAGRDVTAI 141

>ZYRO0C18524g Chr3 (1450641..1452305) [1665 bp, 554 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 554

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 41/71 (57%), Gaps = 6/71 (8%)

Query: 18  HNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKLVHEHSESAYEI 77
           HN   DCW+ L N ++Y+VT+F+ +HPGG   +L+ AG D T     K +  HS+   + 
Sbjct: 84  HNNVNDCWIVL-NGEIYDVTSFIGKHPGGAARLLEVAGRDATA----KFLQVHSQEVLDR 138

Query: 78  M-NDMYLVGYL 87
           M N +  +G L
Sbjct: 139 MKNHLIYIGKL 149

>ZYRO0B13728g Chr2 (1110636..1112432) [1797 bp, 598 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 598

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 36/54 (66%), Gaps = 1/54 (1%)

Query: 8   PLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEI 61
           P +S  ++++HN+ +DCWV + +  VY++T F   HPGG   I  +AG+D++ I
Sbjct: 82  PAISPDEVAKHNSPDDCWV-VIDGYVYDLTEFAPVHPGGPTVIKSNAGKDVSAI 134

>SAKL0F16610g Chr6 (1373674..1375368) [1695 bp, 564 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 564

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 41/71 (57%), Gaps = 6/71 (8%)

Query: 18  HNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKLVHEHSESAYEI 77
           HN  +DCW+ L N  VY++T F++ HPGG   +++ AG D TE    K    HS+   E 
Sbjct: 96  HNNIDDCWIVL-NGDVYDITEFIKIHPGGAARLMEVAGRDATE----KFHMIHSDEVLEK 150

Query: 78  MND-MYLVGYL 87
           M + + LVG L
Sbjct: 151 MKEYITLVGKL 161

>SAKL0G16852g Chr7 (1452894..1454636) [1743 bp, 580 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 580

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 33/47 (70%), Gaps = 1/47 (2%)

Query: 15  LSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEI 61
           +++HN  +DCWV + +  VY++T F+  HPGG   I ++AG+D+T I
Sbjct: 86  VAKHNDPKDCWV-VIDGYVYDLTEFIHSHPGGPTIIENNAGKDVTAI 131

>TPHA0G03550 Chr7 complement(755688..756344) [657 bp, 218 aa] {ON}
           Anc_2.536 YMR073C
          Length = 218

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 2/52 (3%)

Query: 10  LSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILD-HAGEDITE 60
           +S+  +++HNT +DCW  +   KVY +T + E HPGGD+ + +  +G D TE
Sbjct: 143 ISEKMVAEHNTVDDCWC-IIKGKVYCITNYFEYHPGGDKILKNFCSGVDATE 193

>KAFR0A04740 Chr1 (942850..944301) [1452 bp, 483 aa] {ON} Anc_6.106
           YGL055W
          Length = 483

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 7   LPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKL 66
           LP+ + ++  +   K +  +++    V++VT F+ EHPGG+  I +  G+D T +     
Sbjct: 381 LPVWNYSEFQRQIEKNERKLTIIGGVVHDVTDFINEHPGGEPLIKEALGKDATRVFSGG- 439

Query: 67  VHEHSESAYEIM 78
           V+ HS +AY I+
Sbjct: 440 VYSHSNAAYNIL 451

>TDEL0D01140 Chr4 complement(214858..216612) [1755 bp, 584 aa] {ON}
           Anc_4.304 YML054C
          Length = 584

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 32/48 (66%), Gaps = 1/48 (2%)

Query: 14  QLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEI 61
           ++ +HN  +DCWV + +  VY+++ F+  HPGG   I  +AG+D++ I
Sbjct: 82  EVEKHNAPDDCWV-VIDGYVYDLSDFIPSHPGGPAVIRANAGKDVSAI 128

>ZYRO0B02090g Chr2 complement(169589..170173) [585 bp, 194 aa] {ON}
           similar to gnl|GLV|KLLA0E18535g Kluyveromyces lactis
           KLLA0E18535g and weakly similar to YMR073C
           uniprot|Q04772 Saccharomyces cerevisiae YMR073C
           Hypothetical ORF
          Length = 194

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 10  LSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDH-AGEDITEIMKD 64
           + K  L +HNTK+DCW  +   KVY +T + + HPGG   +L + AG+D T++  +
Sbjct: 119 VDKELLRRHNTKDDCWCVIQG-KVYCLTNYFDFHPGGVDILLRYCAGKDATKMFNE 173

>NCAS0F00870 Chr6 (177678..178247) [570 bp, 189 aa] {ON} Anc_2.536
           YMR073C
          Length = 189

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 10  LSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDH-AGEDIT 59
           ++ + L +H ++ DCW ++Y  KVY V+ +LE HPGG   I  + AG+D T
Sbjct: 113 INNSILQRHTSRTDCW-TIYKGKVYCVSDYLEYHPGGPDIIFQNCAGKDST 162

>Kwal_14.807 s14 complement(57218..58954) [1737 bp, 578 aa] {ON}
           YML054C (CYB2) - Cytochrome b2 [L--lactate cytochrome-c
           oxidoreductase] [contig 245] FULL
          Length = 578

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 33/48 (68%), Gaps = 1/48 (2%)

Query: 14  QLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEI 61
           ++++H+  +DCWV + N  VY+++ F+  HPGG   I  +AG+D++ I
Sbjct: 83  EVAKHSKPDDCWV-VINGYVYDLSDFIAVHPGGPAIIKANAGKDVSAI 129

>SAKL0A09570g Chr1 complement(838406..839041) [636 bp, 211 aa] {ON}
           similar to gnl|GLV|CAGL0K03069g Candida glabrata
           CAGL0K03069g and weakly similar to YMR073C
           uniprot|Q04772 Saccharomyces cerevisiae YMR073C
           Hypothetical ORF
          Length = 211

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 10  LSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDH-AGEDIT 59
           + K +L +H T +DCW  L   KVY ++A+ + HPGG + +L+  AG D T
Sbjct: 136 IDKDELIKHKTVDDCWCVLKG-KVYCLSAYFDFHPGGVEILLNKCAGRDAT 185

>NDAI0I01620 Chr9 complement(382761..384086) [1326 bp, 441 aa] {ON}
           Anc_6.106
          Length = 441

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 45/79 (56%), Gaps = 2/79 (2%)

Query: 7   LPLLSKTQ-LSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDK 65
           LP+  K   +++ N+  +  + + +  +++VT + +EHPGG++ +    G+D T   +  
Sbjct: 338 LPIWDKNDFMNEVNSNNNRKLVIISGIIHDVTNYTKEHPGGEKLLNSAVGKDGTRAFQGG 397

Query: 66  LVHEHSESAYEIMNDMYLV 84
            V+ HS SA+ ++ DM + 
Sbjct: 398 -VYRHSNSAHNVLADMRIA 415

>Kpol_348.12 s348 complement(21978..22631) [654 bp, 217 aa] {ON}
           complement(21978..22631) [654 nt, 218 aa]
          Length = 217

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 35/53 (66%), Gaps = 2/53 (3%)

Query: 9   LLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDH-AGEDITE 60
           +++K  +++H   +DCW  +   KVY+++ + + HPGGD+ +++  +G D T+
Sbjct: 142 MITKKMVAKHKDIDDCWC-IIRGKVYSISNYFKFHPGGDKILINQCSGRDCTK 193

>KNAG0F03250 Chr6 complement(607667..609136) [1470 bp, 489 aa] {ON}
           Anc_6.106 YGL055W
          Length = 489

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 42/80 (52%), Gaps = 2/80 (2%)

Query: 5   KTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKD 64
             LP+  K +  + N  ++  + +    +++VT F+EEHPGG   + D  G+D T     
Sbjct: 387 NNLPVWDKAEF-ERNLSQNPNLVVIGGIIHDVTGFVEEHPGGAPLLNDALGKDATTAFTG 445

Query: 65  KLVHEHSESAYEIMNDMYLV 84
             V+ HS +A+ ++ +M + 
Sbjct: 446 G-VYRHSNAAHNVLANMRVA 464

>TBLA0I01530 Chr9 (334102..334767) [666 bp, 221 aa] {ON} Anc_2.536
           YMR073C
          Length = 221

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 36/60 (60%), Gaps = 4/60 (6%)

Query: 5   KTLPLLSKTQ--LSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHA-GEDITEI 61
           K  P+    Q  LS+H   +DCW  +  R VY+++ +++ HPGG Q +++   G+D++ +
Sbjct: 137 KIRPMFKINQKILSEHQEVDDCWCVIKGR-VYSISRYMDYHPGGKQILINTCLGKDVSNL 195

>NDAI0H01370 Chr8 (336807..337481) [675 bp, 224 aa] {ON} Anc_2.536
          Length = 224

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 15  LSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDH-AGEDITEIMKD 64
           L +H +++DCW +++N KVY +T +L  HPGG   +L+  AG+D T +  +
Sbjct: 152 LQKHVSEDDCW-TVHNGKVYCMTYYLHFHPGGADILLEEAAGKDCTRLFNE 201

>Skud_7.226 Chr7 (402118..403647) [1530 bp, 509 aa] {ON} YGL055W
           (REAL)
          Length = 509

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 2/78 (2%)

Query: 7   LPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKL 66
           LPL  K Q     +KE+  + + +  V++V+ ++ EHPGG+  I    G+D T+      
Sbjct: 408 LPLWDK-QTFLAKSKENKGLVIISGIVHDVSGYISEHPGGETLIKTALGKDATKAFSGG- 465

Query: 67  VHEHSESAYEIMNDMYLV 84
           V+ HS +A  ++ DM + 
Sbjct: 466 VYRHSNAAQNVLADMRVA 483

>KLLA0E18459g Chr5 (1641507..1641953) [447 bp, 148 aa] {ON} similar
           to uniprot|Q59TA9 Candida albicans CaO19 Potential
           heme/steroid binding protein and some similarites with
           YMR073C uniprot|Q04772 Saccharomyces cerevisiae YMR073C
           Hypothetical ORF
          Length = 148

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 5   KTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEI 61
           +  P L   + +    K++ W  + NRKVY + A+L  HPGG+  +   AG+D+T +
Sbjct: 65  RIQPPLRVNKEALKANKDNFWC-VINRKVYCIKAYLSYHPGGEVILKQCAGKDVTSL 120

>Kpol_478.17 s478 (61375..62829) [1455 bp, 484 aa] {ON}
           (61375..62829) [1455 nt, 485 aa]
          Length = 484

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 38/74 (51%), Gaps = 2/74 (2%)

Query: 7   LPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKL 66
           LP+ SK Q  + N K D  + + +  V+NV  ++ +HPGG   I    G+D T       
Sbjct: 382 LPVWSKDQFLE-NLKSDPELVVISGVVHNVKNYINDHPGGKTLIKSALGKDATSAFNGG- 439

Query: 67  VHEHSESAYEIMND 80
           V+ HS +A  ++ D
Sbjct: 440 VYRHSNAAQNVLAD 453

>YGL055W Chr7 (398628..400160) [1533 bp, 510 aa] {ON}  OLE1Delta(9)
           fatty acid desaturase, required for monounsaturated
           fatty acid synthesis and for normal distribution of
           mitochondria
          Length = 510

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 42/78 (53%), Gaps = 2/78 (2%)

Query: 7   LPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKL 66
           LP+  K Q     +KE+  + + +  V++V+ ++ EHPGG+  I    G+D T+      
Sbjct: 409 LPMWDK-QTFLAKSKENKGLVIISGIVHDVSGYISEHPGGETLIKTALGKDATKAFSGG- 466

Query: 67  VHEHSESAYEIMNDMYLV 84
           V+ HS +A  ++ DM + 
Sbjct: 467 VYRHSNAAQNVLADMRVA 484

>CAGL0I00418g Chr9 (30058..31530) [1473 bp, 490 aa] {ON} highly
           similar to uniprot|P21147 Saccharomyces cerevisiae
           YGL055w OLE1 stearoyl-CoA desaturase
          Length = 490

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 42/78 (53%), Gaps = 2/78 (2%)

Query: 7   LPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKL 66
           LP  +K +  + N + D  V +    V++V+ ++ EHPGG++ + +  G+D T+      
Sbjct: 386 LPAWTKEEFLEKNRENDGLV-IVGGIVHDVSGYITEHPGGEKLLKNALGKDATKAFSGG- 443

Query: 67  VHEHSESAYEIMNDMYLV 84
           V+ HS +A+  +  M + 
Sbjct: 444 VYRHSNAAHNTLATMRVA 461

>Smik_7.225 Chr7 (393200..394732) [1533 bp, 510 aa] {ON} YGL055W
           (REAL)
          Length = 510

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 42/78 (53%), Gaps = 2/78 (2%)

Query: 7   LPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKL 66
           LP+  K Q     +KE+  + + +  V++V+ ++ EHPGG+  I    G+D T+      
Sbjct: 409 LPVWDK-QTFLAKSKENKGLVIISGIVHDVSGYISEHPGGETLIKTALGKDATKAFSGG- 466

Query: 67  VHEHSESAYEIMNDMYLV 84
           V+ HS +A  ++ DM + 
Sbjct: 467 VYRHSNAAQNVLADMRVA 484

>KAFR0A01890 Chr1 complement(392001..392486) [486 bp, 161 aa] {ON}
           Anc_2.536 YMR073C
          Length = 161

 Score = 38.1 bits (87), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 34/50 (68%), Gaps = 2/50 (4%)

Query: 10  LSKTQLSQHN-TKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDI 58
           ++K  L +H  +KED W  +Y  KVY+++ +LE HPGG + IL++  +++
Sbjct: 84  INKKILQRHQISKEDFW-GVYKGKVYSLSRYLEYHPGGIEIILNNCKKNV 132

>Ecym_3080 Chr3 (149461..150900) [1440 bp, 479 aa] {ON} similar to
           Ashbya gossypii AAR153C
          Length = 479

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 42/78 (53%), Gaps = 2/78 (2%)

Query: 7   LPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKL 66
           LP+  K +  +  TK +  + + +  V++VT ++ EHPGG+  I    G+D T+      
Sbjct: 379 LPVWDKAEFMKE-TKANPGLVVISGIVHDVTGYITEHPGGETLIRASLGKDATKAFNGG- 436

Query: 67  VHEHSESAYEIMNDMYLV 84
           V+ HS +A+ I+  M + 
Sbjct: 437 VYLHSNAAHNILATMRVA 454

>AAR153C Chr1 complement(619953..621389) [1437 bp, 478 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL055W
           (OLE1)
          Length = 478

 Score = 38.1 bits (87), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 7   LPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKL 66
           LP+  +++  +  ++E+  + + +  V++V+ ++ EHPGG+  I    G+D T       
Sbjct: 378 LPVWDRSEFVR-ASRENSGLVVISGIVHDVSGYITEHPGGETLIQAALGKDATRAFNGG- 435

Query: 67  VHEHSESAYEIMNDMYLV 84
           V+ HS +A+ I+  M + 
Sbjct: 436 VYMHSNAAHNILATMRVA 453

>KLTH0H06798g Chr8 (596966..598432) [1467 bp, 488 aa] {ON}
           uniprot|P79047 Delta 9-fatty acid desaturase
          Length = 488

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 42/78 (53%), Gaps = 2/78 (2%)

Query: 7   LPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKL 66
           LP+  K Q  + N K +  + + +  V++V+ ++ EHPGG+  I    G+D T+      
Sbjct: 387 LPVWDKQQFME-NIKTNPGLVIISGIVHDVSNYITEHPGGETLIQAALGKDATKAFNGG- 444

Query: 67  VHEHSESAYEIMNDMYLV 84
           V+ HS +A+ ++  M + 
Sbjct: 445 VYLHSNAAHNVLATMRVA 462

>Suva_13.250 Chr13 complement(393510..394115) [606 bp, 201 aa] {ON}
           YMR073C (REAL)
          Length = 201

 Score = 36.6 bits (83), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 29/48 (60%)

Query: 10  LSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGED 57
           +++  + +H   ED +  + N KVY+++ +L+ HPGG + +L H   D
Sbjct: 125 INREIVKKHCKGEDEFWCVINGKVYDISGYLKFHPGGSKIVLRHRDSD 172

>SAKL0A07326g Chr1 (648420..649862) [1443 bp, 480 aa] {ON}
           uniprot|Q9HFB2 Saccharomyces kluyveri Sk Delta 9- fatty
           acid desaturase
          Length = 480

 Score = 37.4 bits (85), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 7   LPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKL 66
           LP+  K +  + + K +  + + +  V++V+ ++ EHPGG+  I   AG+D T+      
Sbjct: 379 LPVWDKEEFMK-SLKSNPGLVIVSGIVHDVSGYITEHPGGETLIQAAAGKDATKAFNGG- 436

Query: 67  VHEHSESAYEIMNDMYLV 84
           V+ HS +A+ ++  M + 
Sbjct: 437 VYLHSNAAHNVLATMRVA 454

>Smik_13.252 Chr13 complement(396365..396970) [606 bp, 201 aa] {ON}
           YMR073C (REAL)
          Length = 201

 Score = 36.6 bits (83), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 28/48 (58%)

Query: 10  LSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGED 57
           +++  + +H   ED    + N KVY+++++L+ HPGG   +L H   D
Sbjct: 125 INRAIVKKHCKDEDELWCVINNKVYDISSYLKFHPGGTDILLRHRNSD 172

>TBLA0C06220 Chr3 (1507690..1509174) [1485 bp, 494 aa] {ON} 
          Length = 494

 Score = 37.0 bits (84), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 33  VYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKLVHEHSESAYEIMNDMYLV 84
           V+++T +++ HPGG + I +  G+D T +     V+ HS +A  ++  M + 
Sbjct: 415 VHDITNYIDRHPGGQKLIKEARGKDATSVFNGG-VYNHSNAANNVLATMRVA 465

>Skud_13.229 Chr13 complement(386598..387203) [606 bp, 201 aa] {ON}
           YMR073C (REAL)
          Length = 201

 Score = 36.2 bits (82), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 30/48 (62%)

Query: 10  LSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGED 57
           ++K  + +H   ED    + N KVY+++++L+ HPGG + +L + G +
Sbjct: 125 INKEIVKRHCKGEDELWCVINSKVYDISSYLKFHPGGTKILLKNCGSE 172

>KNAG0C05780 Chr3 (1124591..1125133) [543 bp, 180 aa] {ON} Anc_2.536
           YMR073C
          Length = 180

 Score = 36.2 bits (82), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 28/42 (66%), Gaps = 1/42 (2%)

Query: 20  TKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEI 61
           +K D W ++Y  KVY ++ +L+ HPGG + I+DHA  D  +I
Sbjct: 112 SKHDFW-AVYKGKVYCLSYYLDFHPGGIEIIIDHATRDPPDI 152

>TDEL0A03110 Chr1 complement(554890..555492) [603 bp, 200 aa] {ON}
           Anc_2.536 YMR073C
          Length = 200

 Score = 36.2 bits (82), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 33/57 (57%), Gaps = 4/57 (7%)

Query: 8   PLLS--KTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGG-DQYILDHAGEDITEI 61
           PLL+  +  L +H T +DCW  +  R VY +T + + HPGG D      AG+D TE+
Sbjct: 121 PLLNIDRELLQKHKTLDDCWCVIKGR-VYCLTYYFDFHPGGVDILFKTCAGKDGTEM 176

>Ecym_7251 Chr7 (530372..530959) [588 bp, 195 aa] {ON} similar to
           Saccharomyces cerevisiae YMR073C
          Length = 195

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 5   KTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHA-GEDITEI 61
           +  P L   ++   +TKE+ W  L  R VY +T +L+ HPGG Q ++ +  G+D T +
Sbjct: 115 RIQPPLRVDKMVLESTKENDWCVLKGR-VYCITDYLDFHPGGVQILVKNCRGKDATRL 171

>KLLA0C05566g Chr3 complement(497877..499310) [1434 bp, 477 aa] {ON}
           similar to uniprot|P21147 Saccharomyces cerevisiae
           YGL055W OLE1 Fatty acid desaturase required for
           monounsaturated fatty acid synthesis and for normal
           distribution of mitochondria
          Length = 477

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 41/78 (52%), Gaps = 2/78 (2%)

Query: 7   LPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKL 66
           LP+  K +  +   K +  + + +  V++V+ ++ EHPGG+  I    G+D T+      
Sbjct: 379 LPVWDKDEFME-KLKSNNGLVVISGIVHDVSGYITEHPGGETLIQASLGKDATKAFNGG- 436

Query: 67  VHEHSESAYEIMNDMYLV 84
           V+ HS +A+ I+  M + 
Sbjct: 437 VYLHSNAAHNILATMRIA 454

>Kwal_14.1845 s14 (491597..492463) [867 bp, 288 aa] {ON} YGL055W
           (OLE1) - 1:1 [contig 236] PARTIAL
          Length = 288

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 41/78 (52%), Gaps = 2/78 (2%)

Query: 7   LPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKL 66
           LP+  K Q  + N K +  + + +  V++V+ ++ EHPGG+  I     +D T+      
Sbjct: 187 LPVWDKQQFME-NIKTNPGLVIISGIVHDVSNYITEHPGGETLIKAALNKDATKAFNGG- 244

Query: 67  VHEHSESAYEIMNDMYLV 84
           V+ HS +A+ ++  M + 
Sbjct: 245 VYLHSNAAHNVLATMRVA 262

>YMR073C Chr13 complement(412268..412873) [606 bp, 201 aa] {ON}
           IRC21Putative protein of unknown function; may be
           involved in resistance to carboplatin and cisplatin;
           null mutant displays increase in spontaneous Rad52p
           foci; contains a lipid-binding domain and binds
           cardiolipin in a large-scale study
          Length = 201

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 28/48 (58%)

Query: 10  LSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGED 57
           +++  + +H   ED    + N KVY+++++L+ HPGG   ++ H   D
Sbjct: 125 INRKIVKKHCKGEDELWCVINGKVYDISSYLKFHPGGTDILIKHRNSD 172

>ZYRO0C05016g Chr3 (394581..396032) [1452 bp, 483 aa] {ON} similar
           to uniprot|P21147 Saccharomyces cerevisiae YGL055W OLE1
           Fatty acid desaturase required for monounsaturated fatty
           acid synthesis and for normal distribution of
           mitochondria
          Length = 483

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 33  VYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKLVHEHSESAYEIMNDMYLV 84
           V++V+ +L EHPGG+  +    G+D T+      V+ HS +A+ ++  M + 
Sbjct: 407 VHDVSGYLTEHPGGETLLKAALGKDATKAFNGG-VYRHSNAAHNVLATMRVA 457

>TDEL0G03650 Chr7 (673347..674798) [1452 bp, 483 aa] {ON} Anc_6.106
           YGL055W
          Length = 483

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 33  VYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKLVHEHSESAYEIMNDMYLV 84
           V++V+ ++ EHPGG+  +    G+D T+      V+ HS +A+ ++  M + 
Sbjct: 407 VHDVSGYITEHPGGETLLQAALGKDATKAFNGG-VYRHSNAAHNVLATMRVA 457

>Kwal_23.5693 s23 (1277807..1279348) [1542 bp, 513 aa] {ON} YGL055W
           (OLE1) - delta-9-fatty acid desaturase [contig 11] FULL
          Length = 513

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 38/68 (55%), Gaps = 4/68 (5%)

Query: 17  QHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKLVHEHSESAYE 76
           QHN +   +V++    V++VT F+ +HPGG   +    G+D T+   +  V+ HS++A  
Sbjct: 397 QHNRR--AFVAIEG-VVHDVTPFIHDHPGGVALVETSIGKDATQAF-NGAVYSHSQAARN 452

Query: 77  IMNDMYLV 84
           ++  M + 
Sbjct: 453 LLATMRIA 460

>AAL078W Chr1 (209600..211378) [1779 bp, 592 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGL055W
          Length = 592

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 42/83 (50%), Gaps = 7/83 (8%)

Query: 7   LPLLSKTQLS-----QHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEI 61
           LP+++  Q +      +  KE   V++    +++VT F+ +HPGG   ++   G+D T  
Sbjct: 466 LPMITPEQFATVARKDYEEKEKALVAIEG-IIHDVTPFMHDHPGGMALVVASVGKDATPA 524

Query: 62  MKDKLVHEHSESAYEIMNDMYLV 84
             +  V+ HS +A  ++  M + 
Sbjct: 525 F-NGAVYAHSTAARNLLATMRVA 546

>NCAS0D03250 Chr4 (608476..609969) [1494 bp, 497 aa] {ON} Anc_6.106
          Length = 497

 Score = 34.3 bits (77), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 13/52 (25%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 33  VYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKLVHEHSESAYEIMNDMYLV 84
           +++++ ++ EHPGG+  I    G+D T   +   V+ HS +A  +++++ + 
Sbjct: 421 IHDISNYIPEHPGGESLIKQALGKDATRAFQGG-VYRHSTAAQNVLSELRVA 471

>KLTH0G06358g Chr7 complement(503325..504866) [1542 bp, 513 aa] {ON}
           weakly similar to uniprot|P21147 Saccharomyces
           cerevisiae YGL055W OLE1 Fatty acid desaturase required
           for monounsaturated fatty acid synthesis and for normal
           distribution of mitochondria
          Length = 513

 Score = 33.5 bits (75), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 33  VYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKLVHEHSESAYEIMNDMYLV 84
           V++VT F+ +HPGG   +    G+D T+   +  V+ HS++A  ++  M + 
Sbjct: 410 VHDVTPFIHDHPGGVALVETSIGKDATQAF-NGAVYLHSQAARNLLATMRIA 460

>TPHA0B02700 Chr2 (620423..621889) [1467 bp, 488 aa] {ON} Anc_6.106
           YGL055W
          Length = 488

 Score = 33.5 bits (75), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 38/79 (48%), Gaps = 2/79 (2%)

Query: 6   TLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDK 65
            LP   K Q  +  +K +  + + +  V++V  ++ EHPGG   I    G+D T      
Sbjct: 385 NLPKWDKAQFIEE-SKTNGNLIVISGIVHDVKGYITEHPGGQLLIKSALGKDATSAFNGG 443

Query: 66  LVHEHSESAYEIMNDMYLV 84
            V+ HS +A  ++ ++ + 
Sbjct: 444 -VYRHSNAATNVLANLRVA 461

>SAKL0G10274g Chr7 complement(874738..876306) [1569 bp, 522 aa] {ON}
           weakly similar to uniprot|P21147 Saccharomyces
           cerevisiae YGL055W OLE1 Fatty acid desaturase required
           for monounsaturated fatty acid synthesis and for normal
           distribution of mitochondria
          Length = 522

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 38/74 (51%), Gaps = 2/74 (2%)

Query: 11  SKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKLVHEH 70
           +K   S++ T +   V++    V++VT F+ +HPGG   +    G+D T    +  V+ H
Sbjct: 398 AKLAQSEYRTNKRALVAIEG-IVHDVTPFIYDHPGGVTLVETSIGKDATAAF-NGAVYSH 455

Query: 71  SESAYEIMNDMYLV 84
           S +A  ++  M + 
Sbjct: 456 SRAARNLLATMRIA 469

>TDEL0E03250 Chr5 complement(612008..613618) [1611 bp, 536 aa] {ON} 
          Length = 536

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 33  VYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKLVHEHSESAYEIMNDMYLV 84
           V++VT F+  HPGG   +    G+D T+   +  V+ HS++A  ++  M + 
Sbjct: 441 VHDVTPFIHSHPGGTALVKISIGKDATQAF-NGAVYLHSQAARNLLATMRIA 491

>KLLA0C10692g Chr3 complement(916718..918280) [1563 bp, 520 aa] {ON}
           weakly similar to uniprot|P21147 Saccharomyces
           cerevisiae YGL055W OLE1 Fatty acid desaturase required
           for monounsaturated fatty acid synthesis and for normal
           distribution of mitochondria
          Length = 520

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 33  VYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKLVHEHSESAYEIMNDMYLV 84
           V++VT F+ +HPGG   +    G+D T+   +  V+ HS +A  ++  M + 
Sbjct: 417 VHDVTPFIYDHPGGVTLVETSIGKDATQAF-NGAVYRHSNAARNLLATMRVA 467

>ZYRO0G16742g Chr7 (1373818..1375449) [1632 bp, 543 aa] {ON} weakly
           similar to uniprot|P21147 Saccharomyces cerevisiae
           YGL055W OLE1 Fatty acid desaturase required for
           monounsaturated fatty acid synthesis and for normal
           distribution of mitochondria
          Length = 543

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 33  VYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKLVHEHSESAYEIMNDMYLV 84
           V++VT F+ +HPGG   +    G+D T    +  V+ HS++A  ++  M + 
Sbjct: 448 VHDVTPFIHDHPGGTALVQLSVGKDATHAF-NGAVYFHSKAARNLLATMRIA 498

>Ecym_3180 Chr3 (344929..346794) [1866 bp, 621 aa] {ON} similar to
           Ashbya gossypii AAL078W
          Length = 621

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 42/83 (50%), Gaps = 5/83 (6%)

Query: 6   TLPLLSKTQLSQHNTK----EDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEI 61
           +LP++S  Q S+   K    +   + +    V++VT F+ +HPGG   ++   G+D T  
Sbjct: 493 SLPVMSPEQFSELAQKLYKQDRRALVVIEDIVHDVTPFIHDHPGGVALVVCAIGKDATPA 552

Query: 62  MKDKLVHEHSESAYEIMNDMYLV 84
             +  V+ HS +A  ++  M + 
Sbjct: 553 F-NGAVYAHSTAARNLLATMRIA 574

>KNAG0M02190 Chr13 complement(404364..405377) [1014 bp, 337 aa] {ON}
           Anc_2.576 YMR026C
          Length = 337

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 41/89 (46%), Gaps = 6/89 (6%)

Query: 151 LLWQVVF--GNFTKDFYLDQVHRPRHYGKGSAPLFGNFLEP----LSKTPWYAIPIAWLP 204
           LLW++ +  G+      LD + R R     ++      +EP    L ++ WY++   W  
Sbjct: 150 LLWKLRYLQGDPCSAGILDYLFRIRRTRLATSSADSGNMEPSSSRLPRSNWYSVAGQWAR 209

Query: 205 VVFYHLYVALTNMNKPFALFLFSLGVFVW 233
                   AL + ++ F LF+FSL V+ W
Sbjct: 210 GAGTVGNAALYSCSQLFPLFIFSLKVYQW 238

>Ecym_2214 Chr2 (422005..423600) [1596 bp, 531 aa] {ON} similar to
          Ashbya gossypii AFL079W
          Length = 531

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 9  LLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIM 62
          LLS++++ +   +    + +Y   V NV  +++ HPGGD+ I    G D T  M
Sbjct: 4  LLSRSEIEELIAQGRS-IVIYRNLVLNVDKWIKYHPGGDKAIFHMIGRDATAEM 56

>AFL079W Chr6 (290134..291750) [1617 bp, 538 aa] {ON} NOHBY604; No
          homolog in Saccharomyces cerevisiae
          Length = 538

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 7  LPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMK 63
          + +LSK+++ +     +  V +Y   V  +  +++ HPGGD+ I    G D T+ M 
Sbjct: 1  MAVLSKSEVEERIANGEVIV-IYKSAVLKLDKWIKYHPGGDKAIYHMVGRDATDEMN 56

>Suva_7.216 Chr7 (391750..393162) [1413 bp, 470 aa] {ON} YGL055W
           (REAL)
          Length = 470

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 2/66 (3%)

Query: 7   LPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMKDKL 66
           LP+  K Q     TK++  + + +  V++V+ ++ EHPGG+  I    G+D T+      
Sbjct: 405 LPVWDK-QTFLAKTKDNKGLVIISGIVHDVSGYISEHPGGETLIKTALGKDATKAFSGG- 462

Query: 67  VHEHSE 72
           V+ HS 
Sbjct: 463 VYRHSN 468

>KLTH0H04488g Chr8 (401548..403272) [1725 bp, 574 aa] {ON}
          conserved hypothetical protein
          Length = 574

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 9  LLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMK 63
          +L ++++ +   +    + +Y+  V  +  +++ HPGGD+ I    G D T+ MK
Sbjct: 4  ILERSEIEERICRGQA-IVIYDGNVLRLDKWIKYHPGGDKAIHHMIGRDATDEMK 57

>KAFR0B01560 Chr2 (295684..297534) [1851 bp, 616 aa] {ON} Anc_5.47
           YHR188C
          Length = 616

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 23/105 (21%), Positives = 46/105 (43%), Gaps = 5/105 (4%)

Query: 211 YVALTNMNKPFAL-FLFSLGVFVWTLIEYCLHRFLFHLDQYLPERQLAFALHFLLHGVHH 269
           Y    + N+P  L F+ ++  +    + Y   + L H  +YLP+    F +   +  V H
Sbjct: 471 YTPSIDRNRPTQLEFILTIPAYTSFSLSYQFDKALLHFSEYLPDANHGFEIESAVITVIH 530

Query: 270 YLPMDRYRLVMPPTLFVLLCTPFYKLVFSLLPYYWACAGFAGGML 314
            +   ++R     TL + + TP + + ++++       G   GML
Sbjct: 531 PVSY-QFRT---STLLLSIATPDFSMPYNVIIITSTVMGLIFGML 571

>KLLA0E19471g Chr5 complement(1730651..1732372) [1722 bp, 573 aa]
          {ON} conserved hypothetical protein
          Length = 573

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 1/55 (1%)

Query: 9  LLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMK 63
          +LS+  ++    K    + +Y   V N+  +++ HPGGD+ I    G D T+ M 
Sbjct: 4  VLSRRDIADRIAKGQT-IVIYEDSVLNLDKWIKFHPGGDKSIYHMIGRDATDEMN 57

>SAKL0A04774g Chr1 (435965..437671) [1707 bp, 568 aa] {ON}
          uniprot|Q8NKG9 Saccharomyces kluyveri Putative delta 8-
          sphingolipid desaturase
          Length = 568

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 9  LLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMK 63
          ++S+ ++     +    + +Y   V N+  +++ HPGGD+ I    G D T+ MK
Sbjct: 4  IISRGEIEDRIARGQA-IVIYEGLVLNLEKWIKFHPGGDKAIHHMIGRDATDEMK 57

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.141    0.462 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,044,598
Number of extensions: 1788390
Number of successful extensions: 5376
Number of sequences better than 10.0: 130
Number of HSP's gapped: 5384
Number of HSP's successfully gapped: 130
Length of query: 381
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 270
Effective length of database: 40,753,473
Effective search space: 11003437710
Effective search space used: 11003437710
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 67 (30.4 bits)