Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0D01716g8.831ON94294243410.0
TDEL0B006608.831ON95998512521e-156
KAFR0A027708.831ON8848389171e-108
KLTH0C04048g8.831ON9357619071e-106
Kwal_27.103188.831ON9257467441e-83
Skud_13.328.831ON9486336641e-72
AAL185W8.831ON10186616563e-71
YML109W (ZDS2)8.831ON9426196402e-69
Smik_13.258.831ON9496416358e-69
NCAS0B011108.831ON9934996263e-67
Smik_13.4868.831ON9235596065e-65
YMR273C (ZDS1)8.831ON9155795748e-61
Kpol_1069.28.831ON10014135697e-60
Skud_13.4458.831ON8985715651e-59
NDAI0E003508.831ON11631465254e-54
KLLA0D01683g8.831ON9441355172e-53
ZYRO0G13992g8.831ON12111535193e-53
Ecym_27108.831ON8961045012e-51
Suva_13.358.831ON9821354952e-50
Suva_13.4618.831ON9311864816e-49
KNAG0G033708.831ON10761864828e-49
CAGL0J06688g8.831ON8283904771e-48
TPHA0I002008.831ON1049994755e-48
Kpol_541.108.831ON1056984542e-45
CAGL0F03421g8.831ON8171734333e-43
KAFR0B038608.831ON8431114211e-41
TBLA0B032008.831ON10861094151e-40
TBLA0D031908.831ON1682964133e-40
TPHA0C047208.831ON1072953864e-37
Skud_14.8singletonON7474956e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0D01716g
         (942 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0D01716g Chr4 (135836..138664) [2829 bp, 942 aa] {ON} simila...  1676   0.0  
TDEL0B00660 Chr2 (124552..127431) [2880 bp, 959 aa] {ON} Anc_8.8...   486   e-156
KAFR0A02770 Chr1 complement(575572..578226) [2655 bp, 884 aa] {O...   357   e-108
KLTH0C04048g Chr3 (352955..355762) [2808 bp, 935 aa] {ON} simila...   353   e-106
Kwal_27.10318 s27 (284806..287583) [2778 bp, 925 aa] {ON} YMR273...   291   1e-83
Skud_13.32 Chr13 (51228..54074) [2847 bp, 948 aa] {ON} YML109W (...   260   1e-72
AAL185W Chr1 (9537..12593) [3057 bp, 1018 aa] {ON} Syntenic homo...   257   3e-71
YML109W Chr13 (51640..54468) [2829 bp, 942 aa] {ON}  ZDS2Protein...   251   2e-69
Smik_13.25 Chr13 (47889..50738) [2850 bp, 949 aa] {ON} YML109W (...   249   8e-69
NCAS0B01110 Chr2 complement(182537..185518) [2982 bp, 993 aa] {O...   245   3e-67
Smik_13.486 Chr13 complement(794245..797016) [2772 bp, 923 aa] {...   238   5e-65
YMR273C Chr13 complement(811233..813980) [2748 bp, 915 aa] {ON} ...   225   8e-61
Kpol_1069.2 s1069 (1560..4565) [3006 bp, 1001 aa] {ON} (1560..45...   223   7e-60
Skud_13.445 Chr13 complement(784651..787347) [2697 bp, 898 aa] {...   222   1e-59
NDAI0E00350 Chr5 (54073..57564) [3492 bp, 1163 aa] {ON} Anc_8.83...   206   4e-54
KLLA0D01683g Chr4 complement(148855..151689) [2835 bp, 944 aa] {...   203   2e-53
ZYRO0G13992g Chr7 complement(1112324..1115959) [3636 bp, 1211 aa...   204   3e-53
Ecym_2710 Chr2 (1373818..1376508) [2691 bp, 896 aa] {ON} similar...   197   2e-51
Suva_13.35 Chr13 (51377..54325) [2949 bp, 982 aa] {ON} YML109W (...   195   2e-50
Suva_13.461 Chr13 complement(793859..796654) [2796 bp, 931 aa] {...   189   6e-49
KNAG0G03370 Chr7 complement(724041..727271) [3231 bp, 1076 aa] {...   190   8e-49
CAGL0J06688g Chr10 complement(640041..642527) [2487 bp, 828 aa] ...   188   1e-48
TPHA0I00200 Chr9 complement(34713..37862) [3150 bp, 1049 aa] {ON...   187   5e-48
Kpol_541.10 s541 complement(26683..29853) [3171 bp, 1056 aa] {ON...   179   2e-45
CAGL0F03421g Chr6 complement(336157..338610) [2454 bp, 817 aa] {...   171   3e-43
KAFR0B03860 Chr2 complement(798642..801173) [2532 bp, 843 aa] {O...   166   1e-41
TBLA0B03200 Chr2 complement(743165..746425) [3261 bp, 1086 aa] {...   164   1e-40
TBLA0D03190 Chr4 complement(776722..781770) [5049 bp, 1682 aa] {...   163   3e-40
TPHA0C04720 Chr3 complement(1017585..1020803) [3219 bp, 1072 aa]...   153   4e-37
Skud_14.8 Chr14 (9768..9905,9909..9914,9918..9926,9930..9998) [2...    41   6e-04

>SAKL0D01716g Chr4 (135836..138664) [2829 bp, 942 aa] {ON} similar
           to uniprot|P54786 Saccharomyces cerevisiae YML109W ZDS2
           Protein that interacts with silencing proteins at the
           telomere involved in transcriptional silencing paralog
           of Zds1p
          Length = 942

 Score = 1676 bits (4341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 841/942 (89%), Positives = 841/942 (89%)

Query: 1   MKNAKLDDARIRGQQMDEEEYQASKIRNSPTSKEKRKSEVLIAAQSLDNELQNVKNLKRL 60
           MKNAKLDDARIRGQQMDEEEYQASKIRNSPTSKEKRKSEVLIAAQSLDNELQNVKNLKRL
Sbjct: 1   MKNAKLDDARIRGQQMDEEEYQASKIRNSPTSKEKRKSEVLIAAQSLDNELQNVKNLKRL 60

Query: 61  SIGSMDLLMDPEMEFRINXXXXXXXXXXXXXXXXXNDKEGYAXXXXXXXXXXXXXMDITK 120
           SIGSMDLLMDPEMEFRIN                 NDKEGYA             MDITK
Sbjct: 61  SIGSMDLLMDPEMEFRINSSLSSSPTKSLSSEEEENDKEGYAEEYDDDYSYSEDSMDITK 120

Query: 121 TEYLHDNSNDDYGEYNRGNRTGSVGVSEDAWKTTLEIADGTSPRRALSGTGSVRRGGVLS 180
           TEYLHDNSNDDYGEYNRGNRTGSVGVSEDAWKTTLEIADGTSPRRALSGTGSVRRGGVLS
Sbjct: 121 TEYLHDNSNDDYGEYNRGNRTGSVGVSEDAWKTTLEIADGTSPRRALSGTGSVRRGGVLS 180

Query: 181 NRSRLSGGKLNDPNDEEALTQNLLWVPANQHPSVKPENYLELVQDTLQNLQLENGVRDES 240
           NRSRLSGGKLNDPNDEEALTQNLLWVPANQHPSVKPENYLELVQDTLQNLQLENGVRDES
Sbjct: 181 NRSRLSGGKLNDPNDEEALTQNLLWVPANQHPSVKPENYLELVQDTLQNLQLENGVRDES 240

Query: 241 NKENTVKLIHGLNSNVSQLPIQQGKNSLVRRPSRLRKSYTEFEDTEEYNLPISGNXXXXX 300
           NKENTVKLIHGLNSNVSQLPIQQGKNSLVRRPSRLRKSYTEFEDTEEYNLPISGN     
Sbjct: 241 NKENTVKLIHGLNSNVSQLPIQQGKNSLVRRPSRLRKSYTEFEDTEEYNLPISGNSSSLP 300

Query: 301 XXXXXXXXXXXXEITDELTKVSNNAGLTDSDAITLARTLSMASTFYEGSNSEKENQSNTE 360
                       EITDELTKVSNNAGLTDSDAITLARTLSMASTFYEGSNSEKENQSNTE
Sbjct: 301 SSVPTPRSVSLREITDELTKVSNNAGLTDSDAITLARTLSMASTFYEGSNSEKENQSNTE 360

Query: 361 KAEEDEFASNMLNQNSLAIPARSSLRRSKFNTYRIRTPSGSSTNEFAQSNLKVSSTEENP 420
           KAEEDEFASNMLNQNSLAIPARSSLRRSKFNTYRIRTPSGSSTNEFAQSNLKVSSTEENP
Sbjct: 361 KAEEDEFASNMLNQNSLAIPARSSLRRSKFNTYRIRTPSGSSTNEFAQSNLKVSSTEENP 420

Query: 421 QPEIEVAVEETLPRVLEEHILNSPSTINDMQDIYDHYDTSSVEESLPPQNSNYSSAQQDG 480
           QPEIEVAVEETLPRVLEEHILNSPSTINDMQDIYDHYDTSSVEESLPPQNSNYSSAQQDG
Sbjct: 421 QPEIEVAVEETLPRVLEEHILNSPSTINDMQDIYDHYDTSSVEESLPPQNSNYSSAQQDG 480

Query: 481 DNLQXXXXXXXXXXXXXTANAILKSKQSIVQTKSDSIQKEFLSPVTESTTADVKRQKKKG 540
           DNLQ             TANAILKSKQSIVQTKSDSIQKEFLSPVTESTTADVKRQKKKG
Sbjct: 481 DNLQDSPDSSDFSTDSSTANAILKSKQSIVQTKSDSIQKEFLSPVTESTTADVKRQKKKG 540

Query: 541 GWSWFNKKSKKEPEEDNLKQSEQHTHRDSSDFFNVLSPSNGTSKHNLPSNRINHSRNRHH 600
           GWSWFNKKSKKEPEEDNLKQSEQHTHRDSSDFFNVLSPSNGTSKHNLPSNRINHSRNRHH
Sbjct: 541 GWSWFNKKSKKEPEEDNLKQSEQHTHRDSSDFFNVLSPSNGTSKHNLPSNRINHSRNRHH 600

Query: 601 SVVPASNDGSTSTATPTDMEMXXXXXXXXXXXXXXXXXXXXXHVSPDRKEKDNEISVRPE 660
           SVVPASNDGSTSTATPTDMEM                     HVSPDRKEKDNEISVRPE
Sbjct: 601 SVVPASNDGSTSTATPTDMEMEKLPQKKQKLEKKFIKLFKKKHVSPDRKEKDNEISVRPE 660

Query: 661 THSSKPVKELKNKASISSLSKICIGSNKVDENVDLTAKDRLKPRVSPGTKDVTNFQNESF 720
           THSSKPVKELKNKASISSLSKICIGSNKVDENVDLTAKDRLKPRVSPGTKDVTNFQNESF
Sbjct: 661 THSSKPVKELKNKASISSLSKICIGSNKVDENVDLTAKDRLKPRVSPGTKDVTNFQNESF 720

Query: 721 ESDGLEELPTLQPAVSVTSTKQSDGAIPGVLENKTVSKEYEQNQYNHVQQTLDXXXXXXX 780
           ESDGLEELPTLQPAVSVTSTKQSDGAIPGVLENKTVSKEYEQNQYNHVQQTLD       
Sbjct: 721 ESDGLEELPTLQPAVSVTSTKQSDGAIPGVLENKTVSKEYEQNQYNHVQQTLDQQQQQQQ 780

Query: 781 XXXXXXXXXXXXXSLKPPASPTNDPHRLPPRKLVFEDVKRPEYPNAPMKFTDSAFGFPLP 840
                        SLKPPASPTNDPHRLPPRKLVFEDVKRPEYPNAPMKFTDSAFGFPLP
Sbjct: 781 KQQKQQQQQQQQQSLKPPASPTNDPHRLPPRKLVFEDVKRPEYPNAPMKFTDSAFGFPLP 840

Query: 841 PLTVSTVIMFDHRLPINVERAIYRLSHLKLSDPKRELRQQVLLSNFMYAYLNLVNHSLYL 900
           PLTVSTVIMFDHRLPINVERAIYRLSHLKLSDPKRELRQQVLLSNFMYAYLNLVNHSLYL
Sbjct: 841 PLTVSTVIMFDHRLPINVERAIYRLSHLKLSDPKRELRQQVLLSNFMYAYLNLVNHSLYL 900

Query: 901 QQVEEENSMIVGDDSMNEYSVGTPATDPIQNDNNGIINIPEI 942
           QQVEEENSMIVGDDSMNEYSVGTPATDPIQNDNNGIINIPEI
Sbjct: 901 QQVEEENSMIVGDDSMNEYSVGTPATDPIQNDNNGIINIPEI 942

>TDEL0B00660 Chr2 (124552..127431) [2880 bp, 959 aa] {ON} Anc_8.831
           YMR273C
          Length = 959

 Score =  486 bits (1252), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 377/985 (38%), Positives = 502/985 (50%), Gaps = 129/985 (13%)

Query: 33  KEKRKSEVLIAAQSLDNELQNVKNLKRLSIGSMDLLMDPEMEFRINXXXXXXXXXXXXXX 92
           +EKRKSEVLIAAQS+DNE+QNVK+LKR+SIGS+DLLMDPE+E+R+N              
Sbjct: 29  REKRKSEVLIAAQSIDNEVQNVKSLKRISIGSIDLLMDPELEYRVNVNSPNTRKSWSSNS 88

Query: 93  XXXNDK--------EGYAXXXXXXXXXXXXXMDITKTEYLHDNSNDDYGEYNRGNRTGSV 144
               ++        +G                D T  +YL   +      ++  N   + 
Sbjct: 89  SSSEEEHDVAPCYDKGEDEGEASVSDGADDSFDTTGADYLQTTN------HSSANHQSTP 142

Query: 145 GVSEDAWKTTLEIADGTSPRRALSGTGSVRRGGVLSNRSRLSGGKLN---DPNDEEALTQ 201
            V      T+ +I    S +R L+G GS+RRGGV     +LS    N   D ++  ++T+
Sbjct: 143 NVK----PTSPQI----SVKRTLTGVGSLRRGGVNIPTRKLSSASDNGSEDGSNSSSITK 194

Query: 202 NLLWVPANQHPSVKPENYLELVQDTLQNLQLE------NGVRDESNKENTVKLIHGLNSN 255
            LLWVPA QHPSVKPEN+LELVQDTL N+QL+      +   DESNKEN           
Sbjct: 195 QLLWVPAAQHPSVKPENFLELVQDTLHNIQLDEKKETTDNDNDESNKENA--------KA 246

Query: 256 VSQLPIQ--QGKNSLVRRPSRLRKSYTEFEDTEEYNLPISGNXXXX-------------- 299
             +LPI   + ++SLVRRPSRLRKSYTEFE+ +E    + G+                  
Sbjct: 247 YDRLPIDITRKRDSLVRRPSRLRKSYTEFEEYDETE-SLEGSVAVGKESRNSFERSSIAP 305

Query: 300 XXXXXXXXXXXXXEITDELTKVSNNAGLTDSDAITLARTLSMASTFY-----EGSNSEKE 354
                        +IT+EL K+SNNAGLT SDAITLARTLSMA +F      E  ++ K 
Sbjct: 306 CSSGRSSRTVSLKDITEELNKISNNAGLTSSDAITLARTLSMAGSFASSEVNEDYDTSKR 365

Query: 355 N---------QSNTEKAEEDEFASNMLNQNSLAIPARSSLRRSKFNTYRIRTPSGSST-- 403
           N         Q+   K +++EFASNML ++ + IPARSSLRRSKFNTYR+R+   +S+  
Sbjct: 366 NGIHLDADDVQNEYNKEDDNEFASNMLMKHGVVIPARSSLRRSKFNTYRVRSSGSTSSLD 425

Query: 404 --NEFAQSNLKVSSTEENPQPEIEVAVEETL--PRVL-EEHILNSPSTINDMQDIYDHYD 458
             +  +++  K+SS  EN   E   + ++    P +     I++SPS+IND QDIYDHY 
Sbjct: 426 DEHHESETKRKLSSGLENVTAESSASQQDIYHSPSIKGNGSIMSSPSSINDFQDIYDHYR 485

Query: 459 TSSVEESLPPQNSNYSSAQQDGDNLQXXXXXXXXXXXXXTANAILKSKQSIVQ--TKSDS 516
             SV+     +    S     G+ L              T+  I  SK S +       S
Sbjct: 486 QPSVDWEKELKKGTESDDSNKGNQLD-----------FETSKEIASSKLSDLSQGNAKSS 534

Query: 517 IQKEFLSPVTESTTADVKRQKKKGGWSWFNKKSKKEPE-EDNLKQSEQH---THRDSSDF 572
           I+ + +   + +   ++K   K+ GWSW N    KE   E N+K + +     HR+ SD 
Sbjct: 535 IEAQDMEQASSTVVREMK--GKRSGWSWLNGMGSKETNTEKNVKDTARQEVPLHREPSDS 592

Query: 573 FNVLSPSNGTSKHNLPSNRINHSRNRHHSVVPAS-----NDGSTSTATPTDMEMXXXXXX 627
                    ++       R NHS+NRH  + PA+      D +   A  T M        
Sbjct: 593 HIDEDFEKTSTPVTTEIQRSNHSKNRHLPIFPANESSKRKDTTEEPAVSTKMGRSSSSDS 652

Query: 628 XXXXXXXXXXXXXXXHVSPDRKEKDNEISVRPETHSSKPVKELKNKASISSLSKICIGSN 687
                               +K+  +  + R  T +     ELK+K S  +LSK    S 
Sbjct: 653 SNLTRQMFEKKIANLFRRKGKKKLPDYGTSRDHTGA-----ELKSKRSSDNLSKFAKTSK 707

Query: 688 -----KVDENVDLTAKDRLKPRVSPGTKDVTNFQNESFESDG-LEELPTLQPAVSVTSTK 741
                + +  V+   ++ +   V P T  V     E   S    E+LP LQPAVSVTSTK
Sbjct: 708 TPVKLRSESRVEEHLRNSVSKDVVPDTAIVA---GEVIPSKSKAEDLPALQPAVSVTSTK 764

Query: 742 QSDGAIPGVLENKTVSKEYEQNQYNHV---QQTLDXXXXXXXXXXXXXXXXXXXXSLKPP 798
            +   +   +  ++V KE + +    V   Q                         +K P
Sbjct: 765 SAHVPLASSVVIESV-KELDGDDSQDVSMDQNAQTSIDISTETLSMKEQTSEVQTDVKQP 823

Query: 799 A-SPTNDPHRLPPRKLVFEDVKRPEYPNAPMKFTDSAFGFPLPPLTVSTVIMFDHRLPIN 857
           A  P++ P  +PPRKL F+DVKR E  NAPMKFTDSAFGFPLP LTVSTVIMFDHRLPIN
Sbjct: 824 ADGPSHQP--VPPRKLTFDDVKRSEQSNAPMKFTDSAFGFPLPMLTVSTVIMFDHRLPIN 881

Query: 858 VERAIYRLSHLKLSDPKRELRQQVLLSNFMYAYLNLVNHSLYLQQVEEENSMIVGDDSMN 917
           VERAIYRLSHLKLSDPKRELRQQV+LSNFMYAYLNLVNH+LY++QV +EN      D   
Sbjct: 882 VERAIYRLSHLKLSDPKRELRQQVVLSNFMYAYLNLVNHTLYMEQVAQEN------DLTT 935

Query: 918 EYSVGTPATDPIQNDNNGIINIPEI 942
           E S GT A     N  NG I IP++
Sbjct: 936 ETSGGT-AFKTEHNSANGSICIPDM 959

>KAFR0A02770 Chr1 complement(575572..578226) [2655 bp, 884 aa] {ON}
           Anc_8.831 YMR273C
          Length = 884

 Score =  357 bits (917), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 307/838 (36%), Positives = 394/838 (47%), Gaps = 189/838 (22%)

Query: 119 TKTEYLHDNSNDDYGEYNRGNRTGSVGVSEDAWKTTLEIADGTSPRRALSGTGSVRRGGV 178
           T+TEYLHD                         +TTL+        R LSG         
Sbjct: 141 TRTEYLHD-------------------------QTTLQSQRKLPKHRNLSGI-------- 167

Query: 179 LSNRSRLSGGKL-NDPND-EEALTQNLLWVPANQHPSVKPENYLELVQDTLQNLQLENGV 236
             N SR S  KL ND  D E+ L  NLLWVPA++HP+VKP+NY+ELVQDTLQ++ +++  
Sbjct: 168 --NSSRQSSRKLSNDRTDNEDKLKNNLLWVPASKHPNVKPQNYIELVQDTLQHIHIDDSK 225

Query: 237 ---RDESNKENTVKLIHGLNSNVSQLPIQQGKN-SLVRRPSRLRKSYTEFED---TEEYN 289
               D  NKEN                    KN SLVRRPSRLRKSYTE+E+    ++YN
Sbjct: 226 SNDNDNINKENDA---------------HSSKNGSLVRRPSRLRKSYTEYEEENYQDDYN 270

Query: 290 L--------PISGNXXXXXXXXXXXXXXXXXEITDELTKVSNNAGLTDSDAITLARTLSM 341
                    P  GN                 +IT+ELTK+SN AGLTDSDAITLARTLSM
Sbjct: 271 RNNSNDEENPNIGN----FRSSNKGRSVSLKDITEELTKISNKAGLTDSDAITLARTLSM 326

Query: 342 ASTFYEGSN---------SEKENQSNTEK---AEEDEFASNMLNQNSLAIPARSSLRRSK 389
             +F  G++          +++N  N ++     +DEFASNML +N L IP RSSLRRSK
Sbjct: 327 TGSFSNGTDDMELLSNYSDQQDNNFNNDEHYNKNDDEFASNMLMKNGLTIPQRSSLRRSK 386

Query: 390 FNTYRIRTPSGSST--NEFAQSNLKVSSTEENPQPEIEVAVEETLPRV--LEEHILNSPS 445
           FNTYR+R+ S  S   ++   SN+K   T + P        +  + R     E +  SP 
Sbjct: 387 FNTYRVRSSSAPSNIHSKPINSNIKEPKTFKYPYNSKTSIKKSPVNRSNNYTEPVTESPG 446

Query: 446 TINDMQDIYDHYDTSSVEESLPPQNSNYSSAQQDGDNLQXXXXXXXXXXXXXTANAILKS 505
           +I+D+   YDHY  SSV+E              +  NLQ             + +++L  
Sbjct: 447 SISDL---YDHYAYSSVDE-----------ETSNATNLQETSNDGSIDSNESSNDSVL-- 490

Query: 506 KQSIVQTKSDSIQKEFLSPVTESTTADVKRQKKKGGWSWFNKKSKKEPEEDNLKQSEQHT 565
              +  + S+S+  E    +   T  D        GWS  N       E  +  Q   + 
Sbjct: 491 ---VKPSHSESMIHENFDALASDTVTD--------GWSNVNN------ENAHFLQRNNNN 533

Query: 566 HRDSSDFFNVLSPSNGTSKHNLPSNRINHSRNRHHSVVPASNDGSTSTATPTDMEMXXXX 625
            R + +   ++S  N  S H     R NHS+NRH  +        TST TP         
Sbjct: 534 GRLNDE---LVSKGNQESTH-YNKTRSNHSKNRHKPLF-------TSTNTPMTA------ 576

Query: 626 XXXXXXXXXXXXXXXXXHVSPDRKEKDNEISVRPETHSSKPVKELKNKA---SISSLSKI 682
                                    K   +S + +T   K VK  K KA   + SS    
Sbjct: 577 -------------------------KTKNVSKKKQTLEEKIVKLFKRKAHRRTSSSSENQ 611

Query: 683 CIGSNKVDENVDLTAKDRLKPRVSPGTKDVTNFQNESFESDGLE----ELPTLQPAVSVT 738
             G   + E+V        +       +  +   +ESF+S   E    ELP+LQPAVSV 
Sbjct: 612 IFGQEPLKEDVLFEYTTERENSAGDNLEGHSIHSHESFKSSDSETSDKELPSLQPAVSVV 671

Query: 739 STKQSDGAIPGVLEN-------------KTVSKEYEQNQYNHVQQTLDXXXXXXXXXXXX 785
           STK+   A                    +TV  E +++Q +   + L             
Sbjct: 672 STKKESNASAPPSSASSSSLSSSSSTVIQTVELEGDESQ-DVSYEALKGEDFRNPELSSS 730

Query: 786 XXXXXXXXSLKPPASPTNDPHRLPPRKLVFEDVKRPEYPNAPMKFTDSAFGFPLPPLTVS 845
                    LK   S       LPPRKL F+DVKRPE PNAP+ F+DSAFGFPLP LT S
Sbjct: 731 ETTAEQEKELKSAISS------LPPRKLTFDDVKRPEKPNAPIHFSDSAFGFPLPMLTTS 784

Query: 846 TVIMFDHRLPINVERAIYRLSHLKLSDPKRELRQQVLLSNFMYAYLNLVNHSLYLQQV 903
           TVIMFDHRL INVERAIYRLSHLKLSDPKRELRQQVLLSNFMYAYLNLVNH+LY++Q 
Sbjct: 785 TVIMFDHRLGINVERAIYRLSHLKLSDPKRELRQQVLLSNFMYAYLNLVNHTLYMEQA 842

 Score = 78.6 bits (192), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 34/45 (75%), Positives = 44/45 (97%)

Query: 33 KEKRKSEVLIAAQSLDNELQNVKNLKRLSIGSMDLLMDPEMEFRI 77
          + KRKSEVLIAA+S+DNE++NVKNLKRLSIGSMDLL+DPE+E+++
Sbjct: 29 RNKRKSEVLIAARSIDNEVRNVKNLKRLSIGSMDLLIDPELEYKV 73

>KLTH0C04048g Chr3 (352955..355762) [2808 bp, 935 aa] {ON} similar
           to uniprot|P54786 Saccharomyces cerevisiae YML109W ZDS2
           Protein that interacts with silencing proteins at the
           telomere involved in transcriptional silencing paralog
           of Zds1p
          Length = 935

 Score =  353 bits (907), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 280/761 (36%), Positives = 376/761 (49%), Gaps = 91/761 (11%)

Query: 5   KLDDARIRGQQMDEEEYQASKIRNSPTSKEKRKSEVLIAAQSLDNELQNVKNLKRLSIGS 64
           K+ D + RG     E+         P   EKRKSEVLIAAQSLD+ELQ+VKNLKR+SIGS
Sbjct: 14  KVGDVQGRGSNKGSEQ---------PGRSEKRKSEVLIAAQSLDSELQHVKNLKRISIGS 64

Query: 65  MDLLMDPEMEFRINXXXXXXXXXXXXXXXXXNDKEGYAXXXXXXXXXXXXXMDITKTEYL 124
           MD+L+DPEMEFR++                                     +DIT TEYL
Sbjct: 65  MDMLIDPEMEFRVSPSPSQPAPTTDTSHDQQLYNSHSDHDSDDDLSYVNDSIDITSTEYL 124

Query: 125 HDNSNDDYGEYNRGNRTGSVGVSEDAWKTTLEIADGTSPRRALSGTGSVRRGGVLSNRSR 184
            ++          G    S+G S +         D    +R LSG   VRRGG LS ++R
Sbjct: 125 QES---------EGTGFESLGSSSN---------DADCGKRTLSG---VRRGG-LSGKTR 162

Query: 185 LSGGKLNDPNDEEALTQNLLWVPANQHPSVKPENYLELVQDTLQNLQLENGVRDESNKEN 244
           ++        DEE++T NLLWVPANQHP++KPENYLELVQDTL  L++E          N
Sbjct: 163 MNNNL--SAKDEESVTHNLLWVPANQHPNIKPENYLELVQDTLHTLKIEPDNEGSVEGGN 220

Query: 245 TVKLIHGLNSNVSQLP----IQQGKNSLVRRPSRLRKSYTEFEDT------------EEY 288
             K++H   +  + LP    ++ G NSLVRRPS LRKS+TE ED             E  
Sbjct: 221 DEKIVHAPAAASANLPPSNQLRSGLNSLVRRPSGLRKSFTELEDLLLQEAQDTSGGDENA 280

Query: 289 NLPISGNXXXXXXXXXXXXXXXXXEITDELTKVSNNAGLTDSDAITLARTLSMASTFYEG 348
            LP S +                 +IT+ELT++SN AG TD DA++LARTLSMAS++Y  
Sbjct: 281 ELP-SADKMPSVRPRIGSRSSSLKDITEELTRISNRAGFTDGDAVSLARTLSMASSYY-- 337

Query: 349 SNSEKENQSNTEKAEEDEFASNMLNQNSLAIPARSSLRRSKFNTYRIRTPSGSSTNEFAQ 408
           ++ + E+  + EK  E E+AS+ML +N LAIPARSSLRRSKFNTYRIR  SG ST   A 
Sbjct: 338 TDEDGESVGSPEKKPEKEYASSMLTKNGLAIPARSSLRRSKFNTYRIRNTSGGST---AP 394

Query: 409 SNLKVSSTEENPQPEIEVAVEETLPRVLEEHILNSPSTINDMQDIYDHYDTSSVEESLPP 468
           SNL+  S E N      + V++      +   L SP+++ND  +IYDHY  SS + SL  
Sbjct: 395 SNLRSPSAEHNELDRSPIRVDQ------KNAQLQSPTSVNDFNEIYDHYRQSSFDSSLGA 448

Query: 469 QNSNYSSAQQDGDNLQXXXXXXXXXXXXXTANAILKS--KQSIVQTKSDSIQKEFLSPVT 526
               + +A     N                + + L    K S+ +   D  Q  F   V 
Sbjct: 449 YPHEHQNAHT--SNFHSIASKRPKDDTLLDSESSLHDLHKGSLNKALDDEQQASFRGHV- 505

Query: 527 ESTTADVKRQ---------KKKGGWSWFNKKSKKEPEEDNLKQSEQHTHRDSSDFFNVLS 577
           E+T  D K           +KK GWSWF KKS K+ E      S +HT R SSDF  V S
Sbjct: 506 EATNNDEKDDHKHASSQAPRKKSGWSWFGKKSSKDQE-----SSPEHTQRVSSDFLGVSS 560

Query: 578 PSNGTSKHNLPSNRINHSRNRHHSVVPASNDGSTSTATPTDMEMXXXXXXXXXXXXXXXX 637
            +  T   N+P+ +INHSR+RH+S+   +N  + ST + T                    
Sbjct: 561 SAKPT---NVPTEKINHSRHRHYSIDDTANSSTESTTSNTVSSSQSPTKKQRKEKKFIQL 617

Query: 638 XXXXXHVSPDRKEKDNEISVRPETHSSKPVKELKNKASISSLSKICIGSNKVDENVDLTA 697
                  S + +EKD+  S+  +  SS  VK LK + S ++L K  +   K   + D   
Sbjct: 618 FKRNRTTSTNGREKDDGPSISEKLQSSNAVKVLKTRTSSTNLRKNRLSPKKTRLSGD--- 674

Query: 698 KDRLKPRVSPGTKDVTNFQNESFESDGLEELPTLQPAVSVT 738
                 R     +D  + Q+     +  E L  LQP+VS+T
Sbjct: 675 -----GRRESVKEDFGSTQDYKVVREEKEPLAKLQPSVSLT 710

 Score =  197 bits (502), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 99/118 (83%)

Query: 800 SPTNDPHRLPPRKLVFEDVKRPEYPNAPMKFTDSAFGFPLPPLTVSTVIMFDHRLPINVE 859
           +P    + LPPRKL F DV +PE PNAPMKF+DS+FGFPLPPLTVSTV+M DHRLPINVE
Sbjct: 812 APAAGGYVLPPRKLAFSDVIKPERPNAPMKFSDSSFGFPLPPLTVSTVVMIDHRLPINVE 871

Query: 860 RAIYRLSHLKLSDPKRELRQQVLLSNFMYAYLNLVNHSLYLQQVEEENSMIVGDDSMN 917
           RAIYRLSHLKL DPKRELRQQV+LSNFMYAYLNLVNHSLYLQQ++EE    V    M+
Sbjct: 872 RAIYRLSHLKLGDPKRELRQQVILSNFMYAYLNLVNHSLYLQQLDEEGPTGVDAAGMD 929

>Kwal_27.10318 s27 (284806..287583) [2778 bp, 925 aa] {ON} YMR273C
           (ZDS1) - peripheral plasma membrane protein [contig 36]
           FULL
          Length = 925

 Score =  291 bits (744), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 254/746 (34%), Positives = 365/746 (48%), Gaps = 83/746 (11%)

Query: 34  EKRKSEVLIAAQSLDNELQNVKNLKRLSIGSMDLLMDPEMEFRINXXXXXXXXXXXXXXX 93
           EKRKSEVLIAAQSLD+ELQ+VKNLKR+S GSMDL +DPEMEFR++               
Sbjct: 31  EKRKSEVLIAAQSLDSELQHVKNLKRMSFGSMDLPLDPEMEFRMSPSHSQRSSSSDAVSL 90

Query: 94  XXNDKE-GYAXXXXXXXXXXXXXMDITKTEYLHDNSNDDYGEYNRGNRTGSVGVSEDAWK 152
               +E                 +++T  EYL +   D   E +      SV  SED+  
Sbjct: 91  ESQAEEPNQDDDSDDNLSYLNDSIELTAHEYLEE-PRDFLVERS------SVSKSEDSHN 143

Query: 153 TTLEIADGTSPRRALSGTGSVRRGGVLSNRSRLSGGKLNDPNDEEALTQNLLWVPANQHP 212
                       R LSG   VRRGG+      LS G       ++ +TQNL WVPANQHP
Sbjct: 144 G-----------RNLSG---VRRGGMSKKPRELSNGG------DDNVTQNLFWVPANQHP 183

Query: 213 SVKPENYLELVQDTLQNLQLENGVRDESNK--ENTVKLIHGLNSNVS-QLPIQQGKNSLV 269
           +VKPENYLELVQDTL  L +++ V   ++K  E     +   N+  S    ++ G+NSLV
Sbjct: 184 NVKPENYLELVQDTLHTLSIDSEVEPPTDKTVEGNNPYLASANTKASPSSQLRSGQNSLV 243

Query: 270 RRPSRLRKSYTEFEDTEEYNLPISG----------NXXXXXXXXXXXXXXXXXEITDELT 319
           RRPS LRKSYTE ED  ++ +  S           N                 +IT+ELT
Sbjct: 244 RRPSGLRKSYTELEDLLQHEIQDSDENNENAQSELNNIIKNRPRATSSGSSLKDITEELT 303

Query: 320 KVSNNAGLTDSDAITLARTLSMASTFYEGSNSEKENQSNTEKAEEDEFASNMLNQNSLAI 379
           ++SN AG TD DA+ LARTLSMAS+ Y+G  S+    +NT+   + E+AS +L +N LAI
Sbjct: 304 RISNKAGFTDGDAVCLARTLSMASS-YDGEQSQANQSANTDHTPDSEYASTILTKNGLAI 362

Query: 380 PARSSLRRSKFNTYRIRTPSGSSTNEFAQSNLKVSSTEENPQPEIEVAVEETLPRVLEEH 439
           PARSSLRRSKFNTYRIRTP+GSS    +         EE   PE  +   +         
Sbjct: 363 PARSSLRRSKFNTYRIRTPNGSSVTS-SSLRSTSLPNEERKDPEGYIEKSDR-------- 413

Query: 440 ILNSPSTINDMQDIYDHYDTSSVEESLPPQ--NSNYSSAQQDGDNLQXXXXXXXXXXXXX 497
            L SP+++ND  +IYDHY   SV  +  P   +++ SSA     +L              
Sbjct: 414 -LRSPTSVNDFNEIYDHYRQGSVGSTSEPHAVDNDASSASPFNKSL----VHPSHHETHL 468

Query: 498 TANAILKSKQSIVQTKSDSIQKEF-----LSPVTESTTADVKRQKKKGGWSWFNKKSKKE 552
              +   SK S  +T +  ++K+       +   E+  +  +  +KK  W+WF KK+ K 
Sbjct: 469 NEESESSSKHSTDKTLNYPLEKDGKGNNSKAKNKENKPSGTQILRKKSSWNWFGKKTSK- 527

Query: 553 PEEDNLKQSEQHTHRDSSDFFNVLSPSNGTSKHNLPSNRINHSRNRHHSVVPASNDGSTS 612
            ++D     EQ+T      F + LS S       +P+ ++NHSR+RH+S+   S  GS +
Sbjct: 528 -DQDIANDDEQNT------FSDFLSVSGNAKTSYIPTEKVNHSRHRHYSIDSGSR-GSIA 579

Query: 613 TATPTDMEMXXXXXXXXXXXXXXXXXXXXXHVSPDRKEKDNEISVRPETHSSKPVKELKN 672
            A P+ + +                       S   ++K+++++    T S  P   LK 
Sbjct: 580 -ADPSKLAVSSSPKKQKREKKFIQLFKRSRTASTGSRDKEDKVNYLGGT-SGNPTDMLKT 637

Query: 673 KASISSLSKICIGSNKVDENVDLTAKDRLKPRVSPGTKDVTNFQNESFESDGLEE-LPTL 731
           KAS  ++SK  +       +V       +       + D ++    S    G+E+ +  L
Sbjct: 638 KASSRNVSKPTL-------DVQPAKIPTIGGERRSASLDESSLDKGSDLDQGMEKSVAKL 690

Query: 732 QPAVSVTSTKQSDGAIP-GVLENKTV 756
           QP+V +TS  +++ + P  V+EN  V
Sbjct: 691 QPSVCLTSKAKNEVSTPVHVVENPQV 716

 Score =  198 bits (503), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 106/140 (75%), Gaps = 17/140 (12%)

Query: 798 PASPTNDPHRLPPRKLVFEDVKRPEYPNAPMKFTDSAFGFPLPPLTVSTVIMFDHRLPIN 857
           P +P    + LPPRKL F DV +PE PN+PMKF+DS+FGFPLPPLT+STV+M DHRL IN
Sbjct: 801 PMAPAAGGYTLPPRKLTFSDVVKPERPNSPMKFSDSSFGFPLPPLTISTVVMIDHRLTIN 860

Query: 858 VERAIYRLSHLKLSDPKRELRQQVLLSNFMYAYLNLVNHSLYLQQVEEENSMIVGDDSMN 917
           VERAIYRLSHLKL DPKRELRQQV+LSNFMYAYLNLVNHSLYLQQ+EE+N          
Sbjct: 861 VERAIYRLSHLKLGDPKRELRQQVVLSNFMYAYLNLVNHSLYLQQLEEDN---------- 910

Query: 918 EYSVGTPATDPIQNDNNGII 937
                 PA D   NDN G++
Sbjct: 911 ------PA-DSASNDNQGVV 923

>Skud_13.32 Chr13 (51228..54074) [2847 bp, 948 aa] {ON} YML109W
           (REAL)
          Length = 948

 Score =  260 bits (664), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 218/633 (34%), Positives = 305/633 (48%), Gaps = 91/633 (14%)

Query: 22  QASKIRNSPTSK----EKRKSEVLIAAQSLDNELQNVKNLKRLSIGSMDLLMDPEMEFRI 77
           Q  ++R +  SK    EKRKS+VLIAA+SLD E+QNVKNLKRLSIGSMDL+ DPE+EF++
Sbjct: 35  QQGRMRKTQLSKKELFEKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVFDPELEFKL 94

Query: 78  -----------------NXXXXXXXXXXXXXXXXXNDKEGYAXXXXXXXXXXXXXMDITK 120
                            +                  D + Y              +DIT+
Sbjct: 95  SSRNSYSSDSSKESLQESLHGEEIKQLEQEIEERGQDDDVY---EEDDATNADDSIDITQ 151

Query: 121 TEYLHDNSNDDYGEYNRGNRTGSVGVSEDAWKTTLEIADGTSPRRALSGTGSVRRGGVLS 180
           TEYLHD   ++  E  R +R  S         +T   A  TS  R LSG  S     VL 
Sbjct: 152 TEYLHD---EETLEKERISRKAS---------STSFPARVTSRNRRLSGVKSFPHDEVLD 199

Query: 181 NRSRLSGGKLNDPNDEEA--LTQNLLWVPANQHPSVKPENYLELVQDTLQNLQLENGVRD 238
                    + D +D  A   TQNLLWVPANQHP+VKPENYLEL+QDTLQN+Q+     D
Sbjct: 200 ---------VVDSHDSNAVNFTQNLLWVPANQHPNVKPENYLELIQDTLQNIQIS---VD 247

Query: 239 ESNKENTVKLIHGLNSNVSQLPIQQGKNSLVRRPSRLRKSYTEFED-----TEEYNLPIS 293
           +   E+ ++L      N    P +Q   S+VR PSRL+ SY++F+D      +       
Sbjct: 248 QEFDESKLEL-----GNNHAFPNRQRSGSIVRNPSRLKTSYSKFDDEPSLAGQPQQEQEQ 302

Query: 294 GNXXXXXXXXXXXXXXXXXEITDELTKVSNNAGLTDSDAITLARTLSMASTFYEGSNSEK 353
                              EIT+ELTK+SNNAGLTDSDA+TLAR+LSM+ +F  G+    
Sbjct: 303 VERRIPSSEFKSMRSVSLKEITEELTKISNNAGLTDSDAVTLARSLSMSGSFTSGN---- 358

Query: 354 ENQSNTEKAEEDEFASNMLNQNSLAIPARSSLRRSKFNTYRIRTP-SGSSTNEFAQSNLK 412
            + SN     ++EFASNM N+    IP RSSLRRSKFNTY+IR   SG S      S + 
Sbjct: 359 LHLSNNNAENDNEFASNMFNEIGGGIPERSSLRRSKFNTYKIRLEGSGLSQASRPNSLMS 418

Query: 413 VSSTEENPQPEIEVAVEETLPRVLEEHILNSPSTINDMQDIYDHYDTSSVEESLP----P 468
           +  +E      +  +  + LP+           ++ND Q+I+DHY  +S E         
Sbjct: 419 IQISEGRRSASLPASYAQ-LPQ--------QQGSLNDFQEIFDHYRKTSTEWGTENTKYV 469

Query: 469 QNSNYSSAQQDGDNLQXXXXXXXXXXXXXTANAILKSKQSIVQTKSDSIQKEFLSPVTES 528
            N+NY S ++D  +               + N++L    +     S+ + ++ +S   E+
Sbjct: 470 DNTNYYSDEEDLTH-ASISQDSSFLSTDSSNNSVLMKPHNSGSMISERLDQDTISNENEN 528

Query: 529 TTADVKRQKKKGGWSWFNKKSKKEPEEDNL-------KQSEQHTHRDSSDFFNVLSPSNG 581
           T       +   GWSW N  ++     D++       + +E     + ++F N LS S  
Sbjct: 529 TGI----SEPNHGWSWLNSGNENSSNNDHIYEPLMDEQDAEDCLENEEANFVN-LSVSRR 583

Query: 582 TSKHNLPSNRINHSRNRHHSVVPASNDGSTSTA 614
                  S RINHS+NRH  ++   +DGS S  
Sbjct: 584 AKSTKRVSERINHSKNRHSPILQMPSDGSKSVV 616

 Score =  190 bits (483), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 111/143 (77%), Gaps = 9/143 (6%)

Query: 800 SPTNDPHRLPPRKLVFEDVKRPEYPNAPMKFTDSAFGFPLPPLTVSTVIMFDHRLPINVE 859
           SP      L PRKL+FEDV +PEYPNAP+KFTDSAFGFPLP +  STVIMFDHRL INVE
Sbjct: 815 SPAPQISTLLPRKLIFEDVIKPEYPNAPIKFTDSAFGFPLPMIANSTVIMFDHRLNINVE 874

Query: 860 RAIYRLSHLKLSDPKRELRQQVLLSNFMYAYLNLVNHSLYLQQVEEENSMIVGDDSMNEY 919
           RAIYRLSHLKLSDP RELRQQVLLSNFMY+YLNLVNH+LY++Q+  E+++   D ++   
Sbjct: 875 RAIYRLSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQMGSEDAVFNSDPALG-- 932

Query: 920 SVGTPATDPIQNDNNGIINIPEI 942
                 TD  +ND++G I IP+I
Sbjct: 933 -----MTD--KNDSDGAIVIPDI 948

>AAL185W Chr1 (9537..12593) [3057 bp, 1018 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YML109W (ZDS2) and YMR273C
           (ZDS1)
          Length = 1018

 Score =  257 bits (656), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 222/661 (33%), Positives = 319/661 (48%), Gaps = 103/661 (15%)

Query: 12  RGQQMDEEEYQASKIR---------------------NSPTSKEKRKSEVLIAAQSLDNE 50
           +G  M E+E+QA+++R                     ++  +KEKRKSEVLIAAQSLD E
Sbjct: 28  QGMSMSEDEFQAAQVRQRRSKSCAGPLEGVQERVLRAHTRQAKEKRKSEVLIAAQSLDYE 87

Query: 51  LQNVKNLKRLSIGSMDLLMDPEMEFRINXXXXXXXXXXXXXXXXXNDKEGYAXXXXXXXX 110
           LQNVKNLKR+SIGSMDLLMDPEMEFR+N                   +E           
Sbjct: 88  LQNVKNLKRISIGSMDLLMDPEMEFRMNGAAVSPSASPRNSLT----EESLEWFQLSAEQ 143

Query: 111 XXXXXMDITKTEYLHDNSNDDYGEYNRGNRTGSVGVSEDAWKTTLEIADGTSPRRALSGT 170
                +       LH  S D +        + + G S+ A    L  A    P   LS +
Sbjct: 144 EQGGELP------LHAESIDAH--------SSAGGSSDTARDELLTSASSVVPSEELSCS 189

Query: 171 ------GSVRRGGVLSNRSRLSGGKLNDPNDEEA----LTQNLLWVPANQHPSVKPENYL 220
                  + ++  ++S+RS+L     +  + ++A     + NLLWV A+QHP+VKPENYL
Sbjct: 190 HPLSPPAAAKKSTLMSSRSKLGRQHTDTTHTKQATGEPFSSNLLWVRADQHPNVKPENYL 249

Query: 221 ELVQDTLQNLQL--ENGVRDESNKENTVKLIHGLNSNVSQLPIQQGKNSLVRRPSRLRKS 278
           ELV DTL NL++   +G  D   +++   + +G +S  S         SLVR+ SRLRKS
Sbjct: 250 ELVHDTLNNLRIGARHGRGDSPVQQSNTPVANGESSTAS-------ARSLVRKQSRLRKS 302

Query: 279 YTEFEDTEEYNLPISGNXXXXXXXXXXXXXXXXXEITDELTKVSNNAGLTDSDAITLART 338
           +TE E  EE     + +                 EIT+ELT++SNNAGLTDSDAITLART
Sbjct: 303 FTEVEAIEESQF--TDSIGSEIPVGKRMRVSSLKEITEELTRISNNAGLTDSDAITLART 360

Query: 339 LSMASTFYEGSNSEKENQSNTE-----KAEEDEFASNMLNQNSLAIPARSSLRRSKFNTY 393
           L +      GS S  E+ + +E     +AEE+E+AS++L +N LAIPARSSLRRSKF TY
Sbjct: 361 LGI------GSQSADEHATFSECVPSAEAEENEYASSILAKNGLAIPARSSLRRSKFTTY 414

Query: 394 RIRTPSGSST---NEFAQSNLKVSSTEENPQ-PEIE-VAVEETLPRVLEEHILNSPSTIN 448
           RIR+    S+   N+   S+   ++ E N + P+++  A + + PR+  E+   +P + N
Sbjct: 415 RIRSAGSDSSPPENKSTSSSSLAAAYERNSRSPKMQKAAFKGSHPRLSGENTSLAPQSPN 474

Query: 449 DMQDIYDHYDTSSVEESLP---------------PQNSNYSSAQQDGDNLQXXXXXXXXX 493
            + DIYDHY+TS  ++  P                 + N +S +    N           
Sbjct: 475 SINDIYDHYNTSDTDDGSPELQGSPVTHTSDASFTSSPNIASGEHCARNAHKISPISVSQ 534

Query: 494 XXXXTANAILKSKQSIVQ-TKSDSI-QKEFLSPVT--ESTTADVKRQKKKGGWSWFNKKS 549
               ++++         + TKS +  QK  L  +T   ST       +KK GWSWF    
Sbjct: 535 LSATSSSSTSPGSSKSAESTKSWTFDQKSPLRSITLNSSTKGHKISAEKKKGWSWFGNSR 594

Query: 550 KKE------PEEDNLKQSEQHTHRDSSDFFNVLSPSNGTSKHNLPSNRINHSRNRHHSVV 603
           +        P  D+       +    S+ + +  P +  S       R NHSRNRH +  
Sbjct: 595 RPSSESVLLPGTDSEGCPMDESQPIQSEEYPLKHPISPVSDET--PRRGNHSRNRHQTSS 652

Query: 604 P 604
           P
Sbjct: 653 P 653

 Score =  202 bits (514), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 91/106 (85%), Positives = 96/106 (90%)

Query: 801 PTNDPHRLPPRKLVFEDVKRPEYPNAPMKFTDSAFGFPLPPLTVSTVIMFDHRLPINVER 860
           P    H LPPRKL F+DV RPE PN+PMKFT SAFGFPLPPLTVSTVIMFDHRLPI VER
Sbjct: 889 PGEIAHSLPPRKLRFDDVLRPEKPNSPMKFTPSAFGFPLPPLTVSTVIMFDHRLPIYVER 948

Query: 861 AIYRLSHLKLSDPKRELRQQVLLSNFMYAYLNLVNHSLYLQQVEEE 906
           AIYRLSHLKLSDPKRELRQQVLLSNFMY+YLNLVNHSLYLQQ+EE+
Sbjct: 949 AIYRLSHLKLSDPKRELRQQVLLSNFMYSYLNLVNHSLYLQQIEED 994

>YML109W Chr13 (51640..54468) [2829 bp, 942 aa] {ON}  ZDS2Protein
           with a role in regulating Swe1p-dependent polarized
           growth; involved in maintenance of Cdc55p in the
           cytoplasm where it promotes mitotic entry; interacts
           with silencing proteins at the telomere; implicated in
           the mitotic exit network through regulation of Cdc14p
           localization; paralog of Zds1p
          Length = 942

 Score =  251 bits (640), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 208/619 (33%), Positives = 299/619 (48%), Gaps = 92/619 (14%)

Query: 22  QASKIRNSPTSK----EKRKSEVLIAAQSLDNELQNVKNLKRLSIGSMDLLMDPEMEFRI 77
           Q  ++R +  SK    EKRKS+VLIAA+SLD E+QNVKNLKRLSIGSMDL++DPE+EF++
Sbjct: 30  QMRRMRKTQLSKKELFEKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFKV 89

Query: 78  NXXXXXXXX-----------------XXXXXXXXXNDKEGYAXXXXXXXXXXXXXMDITK 120
           N                                   D + Y              +DIT+
Sbjct: 90  NSRNSYSSDSSKESLQESLHEENIIRSEQKEEQGSEDNDAY---EEGDATNVDDSIDITQ 146

Query: 121 TEYLHDNSNDDYGEYNRGNRTGSVGVSEDAWKTTLEIADGTSPRRALSGTGSVRRGGVLS 180
           TEYLHD    +  +  R   + +   +    +            R LSG  ++    V  
Sbjct: 147 TEYLHDEETLEKEKIIRNASSSTSSSARVTSRN-----------RRLSGVKTLAHDVV-- 193

Query: 181 NRSRLSGGKLNDPNDEEA----LTQNLLWVPANQHPSVKPENYLELVQDTLQNLQLENGV 236
                    L+  ND ++    LTQNLLWVPA+QHP+VKPENYLEL+QDTLQN+Q+    
Sbjct: 194 ---------LDVENDHDSKMVDLTQNLLWVPADQHPNVKPENYLELIQDTLQNIQIST-- 242

Query: 237 RDESNKENTVKLIHGLNSNVSQLPIQQGKNSLVRRPSRLRKSYTEFEDT-----EEYNLP 291
            ++   EN ++L  G N  +S    ++   S+VRRPSRL+ SYT+F+D      +     
Sbjct: 243 -NQDIDENKLEL--GNNHVISN---RKRTGSVVRRPSRLKTSYTKFDDEPPLADKPQEGE 296

Query: 292 ISGNXXXXXXXXXXXXXXXXXEITDELTKVSNNAGLTDSDAITLARTLSMASTFYEGSNS 351
           I  +                 EIT+ELTK+SNNAGLTDSDA+TLAR+LSM+ +F   + S
Sbjct: 297 IQVDKRISSSDIKTIRSVSLKEITEELTKISNNAGLTDSDAVTLARSLSMSGSF--TNES 354

Query: 352 EKENQSNTEKAEEDEFASNMLNQNSLAIPARSSLRRSKFNTYRIRTPSGSSTNEFAQSNL 411
              N ++TE   ++EFASNM N+  L IP RSSLRRSKFNTY+IR    S       ++L
Sbjct: 355 LHLNGNHTEN--DNEFASNMFNETGLTIPERSSLRRSKFNTYKIRLEGSSLPQAVKLNSL 412

Query: 412 KVSSTEENPQPEIEVAVEETLPRVLEEHILNSPSTINDMQDIYDHYDTSSVEESLPPQ-- 469
               T +N +     A    +P+          +++ND  +I+DHY  +S + S   +  
Sbjct: 413 MNIQTNDNRRSASSPASYTQVPQ--------EQASLNDFHEIFDHYRRTSTDWSTENEKY 464

Query: 470 --NSNYSSAQQDGDNLQXXXXXXXXXXXXXTANAILKSKQSIVQTKSDSIQKEFLSPVTE 527
             ++NY S ++D  +                 + ++K   +        I ++    V+ 
Sbjct: 465 VDSTNYYSDEEDLTHASISQESSLLSTDSSNNSVLIKPHNT-----GSMISEKLDQHVSS 519

Query: 528 STTADVKRQKKKGGWSWFNKKSKK-EPEEDNLKQ------SEQHTHRDSSDFFNVLSPSN 580
           S  ++    +   GWSW N  +      E   +Q       E+    + +DF N LS S 
Sbjct: 520 SEKSNTNNSEANHGWSWLNSSNGSLNANEQTYQQLTDDEDDEECVDNEKADFVN-LSVSR 578

Query: 581 GTSKHNLPSNRINHSRNRH 599
                   S RINHS+NRH
Sbjct: 579 RAKSTKRASERINHSKNRH 597

 Score =  191 bits (485), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 90/135 (66%), Positives = 105/135 (77%), Gaps = 9/135 (6%)

Query: 808 LPPRKLVFEDVKRPEYPNAPMKFTDSAFGFPLPPLTVSTVIMFDHRLPINVERAIYRLSH 867
           LPPRKL FEDV +P+Y NAP+KFTDSAFGFPLP +T STVIMFDHRL INVERAIYRLSH
Sbjct: 817 LPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVERAIYRLSH 876

Query: 868 LKLSDPKRELRQQVLLSNFMYAYLNLVNHSLYLQQVEEENSMIVGDDSMNEYSVGTPATD 927
           LKLSDP RELRQQVLLSNFMY+YLNLVNH+LY++QV   +    GD ++           
Sbjct: 877 LKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQVGTGDIAFNGDSALGMMD------- 929

Query: 928 PIQNDNNGIINIPEI 942
             +ND++G I IP+I
Sbjct: 930 --KNDSDGTILIPDI 942

>Smik_13.25 Chr13 (47889..50738) [2850 bp, 949 aa] {ON} YML109W
           (REAL)
          Length = 949

 Score =  249 bits (635), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 215/641 (33%), Positives = 304/641 (47%), Gaps = 106/641 (16%)

Query: 22  QASKIRNSPTSK----EKRKSEVLIAAQSLDNELQNVKNLKRLSIGSMDLLMDPEMEFRI 77
           Q  ++R +  SK    EKRKS+V IAA+SLD E+QNVKNLKRLSIGSMDL++DPE+EF++
Sbjct: 31  QMRRMRKTQLSKKELLEKRKSDVFIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFKV 90

Query: 78  NXXXXXXXXX-----------------XXXXXXXXNDKEGYAXXXXXXXXXXXXXMDITK 120
           N                                   D + Y              +DIT+
Sbjct: 91  NSRNSYSSDSSKESLQESLCEEDVIQPKQEEEKRGEDNDAY---EEGEATNADDSIDITQ 147

Query: 121 TEYLHDNSNDDYGE--YNRGNRTGSVGVSEDAWKTTLEIADGTSPRRALSGTGSVRRGGV 178
           TEYLHD    +  +  YN  + T S  V              T   R LSG  ++    V
Sbjct: 148 TEYLHDEETLEKEKIFYNAPSSTSSARV--------------TCRNRRLSGVKALAHDAV 193

Query: 179 LSNRSRLSGGKLNDPNDEEA-LTQNLLWVPANQHPSVKPENYLELVQDTLQNLQLENGVR 237
           L          ++D   +    TQNLLWVPANQHP+VKPENYLEL+QDTLQN+Q+     
Sbjct: 194 LE--------AMDDHESKTVDFTQNLLWVPANQHPNVKPENYLELIQDTLQNIQIST--- 242

Query: 238 DESNKENTVKLIHGLNSNVSQLPIQQGKNSLVRRPSRLRKSYTEFED-TEEYNLPISG-- 294
           DE + E+T+++      N   +  ++   S+VRRPSRL+ SYT+F+D     + P  G  
Sbjct: 243 DEDSGESTLEV-----GNNHVILNRKSSGSIVRRPSRLKTSYTKFDDEISVADKPEVGQE 297

Query: 295 --NXXXXXXXXXXXXXXXXXEITDELTKVSNNAGLTDSDAITLARTLSMASTFYEGSNSE 352
             N                 EIT+ELTK+SNNAGLT S+A+TLAR+LSM+ +F   +   
Sbjct: 298 QVNKRIPSSEVRTIRSVSLKEITEELTKISNNAGLTGSNAVTLARSLSMSGSFTNENLLL 357

Query: 353 KENQSNTEKAEED-EFASNMLNQNSLAIPARSSLRRSKFNTYRIRTPSGSSTNEFAQSNL 411
           K N      AE D EFASNM N++   IP RSSLRRSKFNTY+IR             NL
Sbjct: 358 KSND-----AENDSEFASNMFNESGRTIPERSSLRRSKFNTYKIRLEGSGLPQAANLKNL 412

Query: 412 KVSSTEENPQPEIEVAVEETLPRVLEEHILNSPSTINDMQDIYDHYDTSSVEES--LPPQ 469
               T ++ +     A    LP+           ++ND Q+I+DHY  +S + S     +
Sbjct: 413 MNMRTSDDRRSTSSPACYARLPQ--------EQGSLNDFQEIFDHYRRTSTDWSTDWSTE 464

Query: 470 NSNYSSA---QQDGDNLQXXXXXXXXXXXXXTA--NAILKSKQSIVQTKSDSIQKEFLSP 524
           N+ Y  +     D ++L               +  N++L    +     S+ + ++ +S 
Sbjct: 465 NAKYDDSPNYHSDEEDLTHASISQDSSLLSTDSSNNSVLVKPHNAGSMISERLDQQHVSS 524

Query: 525 VTESTTADVKRQKKKGGWSWFNKKSKK-------------EPEEDNLKQSEQHTHRDSSD 571
             E    ++   +   GWSW N  ++              + ++D   ++E+      +D
Sbjct: 525 -REDENNNI--SEPSHGWSWLNYSNENLNNNDNTHEQFIDDQDDDGCVENEK------AD 575

Query: 572 FFNVLSPSNGTSKHNLPSNRINHSRNRHHSVVPASNDGSTS 612
           F N LS S  T      S RINHS+NRH  +    +D S S
Sbjct: 576 FVN-LSVSRRTKSTKRASERINHSKNRHSPIFQVRSDESKS 615

 Score =  190 bits (483), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 111/145 (76%), Gaps = 10/145 (6%)

Query: 798 PASPTNDPHRLPPRKLVFEDVKRPEYPNAPMKFTDSAFGFPLPPLTVSTVIMFDHRLPIN 857
           P+  T  P+ L PRKL F DV +P+YPNAP+KFTDSAFGFPLP +T STVIMFDHRL IN
Sbjct: 815 PSPETQTPN-LIPRKLTFGDVVKPKYPNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGIN 873

Query: 858 VERAIYRLSHLKLSDPKRELRQQVLLSNFMYAYLNLVNHSLYLQQVEEENSMIVGDDSMN 917
           VERAIYRLSHLKLSDP RELRQQVLLSNFMY+YLNLVNH+LY++Q+  E+ +  GD ++ 
Sbjct: 874 VERAIYRLSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQMGSEDVVFNGDSALG 933

Query: 918 EYSVGTPATDPIQNDNNGIINIPEI 942
                       +ND++G I IP+I
Sbjct: 934 MVD---------KNDSDGTILIPDI 949

>NCAS0B01110 Chr2 complement(182537..185518) [2982 bp, 993 aa] {ON}
           Anc_8.831 YML109W
          Length = 993

 Score =  245 bits (626), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 190/499 (38%), Positives = 247/499 (49%), Gaps = 95/499 (19%)

Query: 31  TSKEKRKSEVLIAAQSLDNELQNVKNLKRLSIGSMDLLMDPEMEFRINXXXXXXXXXXXX 90
           T ++KRKSEVLIAAQSLDNE+Q+VKNLKRLSIGSMDLL+DPE+EFR+N            
Sbjct: 19  TQRDKRKSEVLIAAQSLDNEVQSVKNLKRLSIGSMDLLIDPELEFRVNNDKSNQSTPIGS 78

Query: 91  XXXXXNDKEGYAXXXXXXXXXXXXXMD----ITKTEYLHDNSNDDYGEYNRGNRTGSVGV 146
                 + E                +D    +T+TEYLHD S        + NRT     
Sbjct: 79  YERSNENLEQINEPEDNENDESSVSIDDSIELTQTEYLHDAS------VPQTNRT----- 127

Query: 147 SEDAWKTTLEIADGTSPRRALSGTGSVRRGGVLSNRSRL---SGGKLNDPNDE------- 196
                     +       R++SG GS++R G   ++ +L   S G    P          
Sbjct: 128 ----------VTPEEPSHRSMSGAGSLKRNGSSISKRKLPFISTGMSAAPTSHLSPSSTS 177

Query: 197 ----------------EALTQNLLWVPANQHPSVKPENYLELVQDTLQNLQLENGV---- 236
                           + LT+NLLWVPANQHP+VKPENYLELVQDTLQN+ LE       
Sbjct: 178 TSSSSSSSSNSASSSPDDLTKNLLWVPANQHPNVKPENYLELVQDTLQNIHLEEPASSLQ 237

Query: 237 RDESNKENTVKLIHGLNSNVSQ---------------LPIQQGKNSLVRRPSRLRKSYTE 281
            +     N  + I    SN+S+               L I     SLVRRPSRLR SYTE
Sbjct: 238 HENEKSNNNKENIDISKSNMSEEEPIDRHPQSLDKTFLEITNRNRSLVRRPSRLRTSYTE 297

Query: 282 FED--------------------TEEYNLPISGNXXXXXXXXXXXXXXXXXEITDELTKV 321
           FE+                     EE     +                   +IT+ELT +
Sbjct: 298 FEEDDYSNSEESEAKTNESQLSSREEKPFLFNDRNGLNQLRNFSQRSVSLKDITEELTNI 357

Query: 322 SNNAGLTDSDAITLARTLSMASTFYEGSNSEKENQSNTEKAEEDEFASNMLNQNSLAIPA 381
           SN AGLTDSDAITLARTLSMAS+F +G+ +  +++   E  EE EFASNM  +N L IP 
Sbjct: 358 SNKAGLTDSDAITLARTLSMASSFSDGNVNLGKSKLQNESNEESEFASNMFMKNGLTIPE 417

Query: 382 RSSLRRSKFNTYRIRTPSGSSTNEFAQSNLKVSST---EENPQPEIEVAVEETLPRVLEE 438
           RSSLRRSKFNTYRIR+ S S++     S L  SS+   +E    +++ +      R  + 
Sbjct: 418 RSSLRRSKFNTYRIRSTSSSTSTREKTSPLLQSSSFARQEADTDDLQRSPVSFTNR--DS 475

Query: 439 HILNSPSTINDMQDIYDHY 457
           ++  + S+   + D+YDHY
Sbjct: 476 YLATTTSSPGSISDLYDHY 494

 Score =  209 bits (533), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 122/241 (50%), Positives = 147/241 (60%), Gaps = 16/241 (6%)

Query: 715 FQNESFESDGLEELPTLQPAVSVTSTKQSDGAIPGVLENKTVSKEYEQNQYNHVQQTLDX 774
             N+  + + +E LP+LQPAVSVTSTK    +   V   +TV +  E +  +     L  
Sbjct: 756 LSNKDTDDEAIEALPSLQPAVSVTSTKNVHLSASIV---ETVRELGEDDSQDISGGDLST 812

Query: 775 XXXXXXXXXXXXXXXXXXXSLKPPASPTND----PHRLPPRKLVFEDVKRPEYPNAPMKF 830
                              S++  +   N      H LP RKL F DVKRP+ PNAP++F
Sbjct: 813 EVDNSMLAERNVMNSSDLQSIENSSDDINTGNTIEHVLPARKLTFADVKRPDRPNAPIQF 872

Query: 831 TDSAFGFPLPPLTVSTVIMFDHRLPINVERAIYRLSHLKLSDPKRELRQQVLLSNFMYAY 890
           TDSAFGFPLP LTVSTVIMFDHRL INVERAIYRLSHLKLSD KRELRQQVLLSNFMYAY
Sbjct: 873 TDSAFGFPLPMLTVSTVIMFDHRLGINVERAIYRLSHLKLSDSKRELRQQVLLSNFMYAY 932

Query: 891 LNLVNHSLYLQQVEEENSM----IVGDDSMN-----EYSVGTPATDPIQNDNNGIINIPE 941
           LNLVNH+LY++QV ++ +M    I G D ++       S GT      QN+ NG I IPE
Sbjct: 933 LNLVNHTLYMEQVAQQETMEDVAITGTDVIDSDIHESSSYGTGVYTTEQNNANGTILIPE 992

Query: 942 I 942
           I
Sbjct: 993 I 993

>Smik_13.486 Chr13 complement(794245..797016) [2772 bp, 923 aa] {ON}
           YMR273C (REAL)
          Length = 923

 Score =  238 bits (606), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 187/559 (33%), Positives = 268/559 (47%), Gaps = 117/559 (20%)

Query: 31  TSKEKRKSEVLIAAQSLDNELQNVKNLKRLSIGSMDLLMDPEMEFRINXXXXXXXXXXXX 90
           + ++KRKSEVLIAAQSLDNE+++VKNLKRLSIGSMDLL+DPE++ +              
Sbjct: 21  SQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVDPELDIKFGGESNGRRSWSGT 80

Query: 91  XXXXXNDKEGYAXXXXXXXXXXXXXMDITKTEYLHDNSNDDYGEYNRGNRTGSVGVSEDA 150
                +   G                D T  E LH+  +      ++G ++   G     
Sbjct: 81  AYNSASTPGGTTRMNNTRYS------DPTPLENLHERGDLKLESSDKGRQSNYAGS---- 130

Query: 151 WKTTLEIADGTSPRRALSGTGSVRRGGVLSNRSRLSGGKLNDPNDEEALTQNLLWVPANQ 210
                                   + GV S   +L+           AL +NLLWVPANQ
Sbjct: 131 ------------------------KKGVHSTSRKLNAN---------ALKKNLLWVPANQ 157

Query: 211 HPSVKPENYLELVQDTLQNLQL---------------ENGVRDESNKENTVKLIHGLNSN 255
           HP+VKP+NYLELVQDTLQN+QL                +G +   NKEN  +       N
Sbjct: 158 HPNVKPDNYLELVQDTLQNIQLNGSEDNNDDQNNGNKNSGSKVYDNKENDTE-------N 210

Query: 256 VSQLPIQQGKNSLVRRPSRLRKSYTEFEDTEEYNL-PISGNXXXXXXXXXXXXXXXXXEI 314
           +++   + G  SL+RRPS LR+SYTEF+D+E+ N    + N                 +I
Sbjct: 211 LNRAMSRHGTASLIRRPSTLRRSYTEFDDSEDDNGDSKTVNKVEERTSRIKERPVSLRDI 270

Query: 315 TDELTKVSNNAGLTDSDAITLARTLSMASTF-----------YEGSNSEKENQSNTEKAE 363
           T+ELTK+SN+AGLTD+DAITLARTLSMA ++            EG + E+++ + T +AE
Sbjct: 271 TEELTKISNSAGLTDNDAITLARTLSMAGSYSDKKDEAEPSNQEGHHIEEDSNAMTSQAE 330

Query: 364 ---EDEFASNMLNQNSLAIPARSSLRRSKFNTYRIRTPSGSSTNEFAQSNLKVSSTEEN- 419
              + E+ASNM   N++  P RSSLRRS+FNTYRIR        E  +  +K   TE + 
Sbjct: 331 PSDDGEYASNMPINNNMTWPERSSLRRSRFNTYRIRQQEQEKEVEEDKEKIKDYETEHHL 390

Query: 420 ------PQPEIEVAVEETLPRVLEEHILNSPSTINDMQDIYDHYDTSSVEESLPPQNSNY 473
                  +  I+        +  E   ++SP +I D QDIYDHY  SS E          
Sbjct: 391 PLANNTSKTAIDPHKSPFRQQAEEPESMSSPGSIGDFQDIYDHYRQSSGE---------- 440

Query: 474 SSAQQDGDNLQXXXXXXXXXXXXXTANAILKSKQSIVQTKSD-SIQKEFLSPVTESTT-- 530
              Q+ G   +                 ++ +K  I   + D  +++E +  +  S+T  
Sbjct: 441 -WEQEMGIEKEAE---------------VVATKFEIDSLEQDLELREEPVGVIKSSSTEE 484

Query: 531 -ADVKRQKKKGGWSWFNKK 548
             + KR +++ GW+W N K
Sbjct: 485 NKETKRHRRRNGWTWLNNK 503

 Score =  183 bits (465), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 90/96 (93%)

Query: 808 LPPRKLVFEDVKRPEYPNAPMKFTDSAFGFPLPPLTVSTVIMFDHRLPINVERAIYRLSH 867
           LPPRKL F DVK+P+ PNAP++FTDSAFGFPLP LTVSTVIMFDHRLPINVERAIYRLSH
Sbjct: 816 LPPRKLTFADVKKPDKPNAPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSH 875

Query: 868 LKLSDPKRELRQQVLLSNFMYAYLNLVNHSLYLQQV 903
           LKLS+ KR LR+QVLLSNFMYAYLNLVNH+LY++QV
Sbjct: 876 LKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQV 911

>YMR273C Chr13 complement(811233..813980) [2748 bp, 915 aa] {ON}
           ZDS1Protein with a role in regulating Swe1p-dependent
           polarized growth; involved in maintaining Cdc55p in the
           cytoplasm where it promotes mitotic entry; involved in
           mitotic exit through Cdc14p regulation; interacts with
           silencing proteins at the telomere; has a role in Bcy1p
           localization; implicated in mRNA nuclear export
          Length = 915

 Score =  225 bits (574), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 191/579 (32%), Positives = 269/579 (46%), Gaps = 142/579 (24%)

Query: 31  TSKEKRKSEVLIAAQSLDNELQNVKNLKRLSIGSMDLLMDPEMEFRINXXXXXXXXXXXX 90
           + ++KRKSEVLIAAQSLDNE+++VKNLKRLSIGSMDLL+DPE++ +              
Sbjct: 21  SQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKFGGESSGRRSWSGT 80

Query: 91  XXXXXNDKEGYAXXXXXXXXXXXXXMDITKTEYLHDNSNDDYGEYNRGNRTGSVGVSEDA 150
                      +              D T  E LH   N      N+  +   +G+ +  
Sbjct: 81  TSSSA------SMPSDTTTVNNTRYSDPTPLENLHGRGNSGIESSNKTKQGNYLGIKKGV 134

Query: 151 WKTTLEIADGTSPRRALSGTGSVRRGGVLSNRSRLSGGKLNDPNDEEALTQNLLWVPANQ 210
                      SP R L+                              L +NLLWVPANQ
Sbjct: 135 ----------HSPSRKLNAN---------------------------VLKKNLLWVPANQ 157

Query: 211 HPSVKPENYLELVQDTLQNLQL------------------ENGVRDES----NKEN-TVK 247
           HP+VKP+N+LELVQDTLQN+QL                  +NG   ES    NKEN T+ 
Sbjct: 158 HPNVKPDNFLELVQDTLQNIQLSDNGEDNDGNSNENNDIEDNGEDKESQSYENKENNTIN 217

Query: 248 LIHGLNSNVSQLPIQQGKNSLVRRPSRLRKSYTEFEDTEEYNLPISG-----NXXXXXXX 302
           L  GL+        + G  SL+RRPS LR+SYTEF+D E+ +          N       
Sbjct: 218 LNRGLS--------RHGNASLIRRPSTLRRSYTEFDDNEDDDNKGDSASETVNKVEERIS 269

Query: 303 XXXXXXXXXXEITDELTKVSNNAGLTDSDAITLARTLSMASTFY--------EGSNSEKE 354
                     +IT+ELTK+SN+AGLTD+DAITLARTLSMA ++         EG   E +
Sbjct: 270 KIKERPVSLRDITEELTKISNSAGLTDNDAITLARTLSMAGSYSDKKDQPQPEGHYDEGD 329

Query: 355 NQSNTEKA---EEDEFASNMLNQNSLAIPARSSLRRSKFNTYRIRTPSGSSTNEFAQSNL 411
              +T +A   ++ EFASNM   N++  P RSSLRRS+FNTYRIR  S     E  QS  
Sbjct: 330 IGFSTSQANTLDDGEFASNMPINNTMTWPERSSLRRSRFNTYRIR--SQEQEKEVEQSVD 387

Query: 412 KVSSTEENPQP------EIEVAVEETLPRVLEEHI--LNSPSTINDMQDIYDHYDTSSVE 463
           ++ + +E          ++E+   ++  R  +E    ++SP +I D QDIY+HY  SS E
Sbjct: 388 EMKNDDEERLKLTKNTIKVEIDPHKSPFRQQDEDSENMSSPGSIGDFQDIYNHYRQSSGE 447

Query: 464 ESLPPQNSNYSSAQQDGDNLQXXXXXXXXXXXXXTANAILKSKQSI-VQTKSDSIQKEF- 521
                        Q+ G                     I K  + + V+ ++D+++++  
Sbjct: 448 -----------WEQEMG---------------------IEKEAEEVPVKVRNDTVEQDLE 475

Query: 522 --------LSPVTESTTADVKRQKKKGGWSWFNKKSKKE 552
                   + P       + KR +++ GW+W N K  +E
Sbjct: 476 LREGTTDMVKPSATDDNKETKRHRRRNGWTWLNNKMSRE 514

 Score =  185 bits (469), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 83/107 (77%), Positives = 93/107 (86%)

Query: 797 PPASPTNDPHRLPPRKLVFEDVKRPEYPNAPMKFTDSAFGFPLPPLTVSTVIMFDHRLPI 856
           P A P      LPPRKL F DVK+P+ PN+P++FTDSAFGFPLP LTVSTVIMFDHRLPI
Sbjct: 795 PAAPPLKHTSILPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPI 854

Query: 857 NVERAIYRLSHLKLSDPKRELRQQVLLSNFMYAYLNLVNHSLYLQQV 903
           NVERAIYRLSHLKLS+ KR LR+QVLLSNFMYAYLNLVNH+LY++QV
Sbjct: 855 NVERAIYRLSHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQV 901

>Kpol_1069.2 s1069 (1560..4565) [3006 bp, 1001 aa] {ON} (1560..4565)
           [3006 nt, 1002 aa]
          Length = 1001

 Score =  223 bits (569), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 174/413 (42%), Positives = 228/413 (55%), Gaps = 61/413 (14%)

Query: 33  KEKRKSEVLIAAQSLDNELQNVKNLKRLSIGSMDLLMDPEMEFRINXXXXXXXXXXXXXX 92
           ++KRKS VLIAAQSLD E+QNVKNLKRLSIGSMDLL+DPE+E+ +N              
Sbjct: 20  RDKRKSAVLIAAQSLDQEVQNVKNLKRLSIGSMDLLIDPELEYTVNNPSSPPSSVNSQKS 79

Query: 93  XXXND------------KEG------YAXXXXXXXXXXXXXMDITKTEYLHDNSNDDYGE 134
              N+            KEG                      D T  EYLHD        
Sbjct: 80  YSSNETTYETAETSLDKKEGSYLEDSVVDASNSSIADASDSFDTTGVEYLHD-------- 131

Query: 135 YNRGNRTGSVGVSEDAWKTTLEIADGTSP--RRALSGTGSVRRGG--VLS---NRSR-LS 186
              GN   S     D+ KT  E  + + P  +R LSG G +RR    V S   N ++ L 
Sbjct: 132 ---GNEPVSSNEQLDSIKTVKE-NELSQPQSKRNLSGIGGLRRSSRNVTSKPENETQVLP 187

Query: 187 GGKLNDPNDEEALTQNLLWVPANQHPSVKPENYLELVQDTLQNLQLENGVRDESNKENTV 246
             KL    +++A T NLLWVPANQHPSVKP+N++ELV DTLQN+ L++   +ES  +N V
Sbjct: 188 KRKL---ENKKAFTNNLLWVPANQHPSVKPQNFVELVHDTLQNMSLDDVQTNESESKNEV 244

Query: 247 K--LIHGLNSNVSQLPIQQGKNSLVRRPSRLRKSYTEFEDTEEYNL-PISGN---XXXXX 300
              L++  + +     +     SLVRRPSRLRKSYTEFE+  E  + P + +        
Sbjct: 245 SKDLLNTFSRD-----MNMRNKSLVRRPSRLRKSYTEFEEETEEEVKPTTSSNNINESNK 299

Query: 301 XXXXXXXXXXXXEITDELTKVSNNAGLTDSDAITLARTLSMASTFYEGSNSEKE------ 354
                       +I DELT +SNN GL++SDAI+LAR+LS+A +   GS SE+E      
Sbjct: 300 KNVQGKRAVSLKDIADELTVISNNVGLSNSDAISLARSLSIAGSI--GSTSEEEEEDKVL 357

Query: 355 NQSNTEKAEEDEFASNMLNQNSLAIPARSSLRRSKFNTYRIRTPSGSSTNEFA 407
           N S+  ++EE  FASN+L +N ++IPARSSLRRSKFNTY+IRT   S  +E +
Sbjct: 358 NTSSIGQSEE-VFASNILAKNGISIPARSSLRRSKFNTYKIRTSGSSQKDELS 409

 Score =  192 bits (488), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 96/151 (63%), Positives = 115/151 (76%), Gaps = 15/151 (9%)

Query: 805  PHRLPPRKLVFEDVKRPEYPNAPMKFTDSAFGFPLPPLTVSTVIMFDHRLPINVERAIYR 864
            P  LPPRKL FEDV+R + PN  M FTDSAFGFPLP LTVSTVIMFDHRLP+NVERAIYR
Sbjct: 853  PTILPPRKLTFEDVERLDRPNGSMVFTDSAFGFPLPLLTVSTVIMFDHRLPVNVERAIYR 912

Query: 865  LSHLKLSDPKRELRQQVLLSNFMYAYLNLVNHSLYLQQVEEE----------NSMI---V 911
            LSHLKLSD +R LR+QVLLSNFMYAYL+LVNHSLY++QVEEE          NS I   +
Sbjct: 913  LSHLKLSDSRRSLREQVLLSNFMYAYLHLVNHSLYMEQVEEESMDASYSDMDNSEIETAI 972

Query: 912  GDDSMNEYSVGTPATDPIQNDNNGIINIPEI 942
             D+  N+++  +  T+  QND +G I+IP++
Sbjct: 973  ADNDPNKWNSNSYRTN--QNDAHGAISIPDL 1001

>Skud_13.445 Chr13 complement(784651..787347) [2697 bp, 898 aa] {ON}
           YMR273C (REAL)
          Length = 898

 Score =  222 bits (565), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 191/571 (33%), Positives = 265/571 (46%), Gaps = 120/571 (21%)

Query: 27  RNSPTSKEKRKSEVLIAAQSLDNELQNVKNLKRLSIGSMDLLMDPEMEFRINXXXXXXXX 86
           R +   ++KRKSEVLIAAQSLDNE+++VKNLKRLSIGSMDLL+DPE++ +          
Sbjct: 17  RMAACQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKF--------- 67

Query: 87  XXXXXXXXXNDKEGYAXXXXXXXXXXXXXMDITKTEYLHDNSNDDYGEYNRGNRTGSVGV 146
                    N +  ++               +  T Y      ++  E        S G+
Sbjct: 68  -----CGESNGRRSWSGTTSKPTSAPNGTTGMNNTRYSDPTPLENLHERR------SSGI 116

Query: 147 SEDAWKTTLEIADGTSPRRALSGTGSVRRGGVLSNRSRLSGGKLNDPNDEEALTQNLLWV 206
                +T  +   G+S       TG  R  GV S   +L+   L          +NLLWV
Sbjct: 117 -----ETCAKNKQGSS-------TGHKR--GVHSPSRKLTANALK---------KNLLWV 153

Query: 207 PANQHPSVKPENYLELVQDTLQNLQL--------------ENGVRDES----NKE--NTV 246
           PANQHP+VKP+NYLELVQDTLQN++L               N V +E+    NKE  NTV
Sbjct: 154 PANQHPNVKPDNYLELVQDTLQNIRLGDNDDNDDENDKNENNRVTEETESHGNKENMNTV 213

Query: 247 KLIHGLNSNVSQLPIQQGKNSLVRRPSRLRKSYTEFEDTEEYN-----LPISGNXXXXXX 301
            L  G+        ++ G  SL+RRPS LR+SYTEF+D E+ N        + N      
Sbjct: 214 DLNRGM--------LRHGNASLIRRPSTLRRSYTEFDDIEDDNGQRNEASKTVNRVEERT 265

Query: 302 XXXXXXXXXXXEITDELTKVSNNAGLTDSDAITLARTLSMASTFYEGSNS---------- 351
                      +IT+ELTK+SN+AGLT++D ITLARTLSMA ++ +G N           
Sbjct: 266 SRIKERPVSLRDITEELTKISNSAGLTNNDTITLARTLSMAGSYSDGGNEAGPKDLKDDY 325

Query: 352 EKEN---QSNTEKAEED-EFASNMLNQNSLAIPARSSLRRSKFNTYRIRTPSGSSTNEFA 407
           E E+    S+  KA +D E+ASNM   N +  P RSSL+RS+FNTYRIR+       E  
Sbjct: 326 EGESIGVASSQRKASDDGEYASNMPTNNDMTGPERSSLKRSRFNTYRIRSQEQEKEEEQN 385

Query: 408 QSNLK------VSSTEENPQPEIEVAVEETLPRVLEEHILNSPSTINDMQDIYDHYDTSS 461
               K      +  T++  + EIE           E    +SP ++ D QDIYDHY    
Sbjct: 386 VEETKNEEAGRLHLTDKTLKTEIESPKSPFGQEDDESEYASSPGSVGDFQDIYDHY---- 441

Query: 462 VEESLPPQNSNYSSAQQDGDNLQXXXXXXXXXXXXXTANAILKSKQSIVQTKSDSIQKEF 521
                          Q  GD                   A +    ++ Q      +   
Sbjct: 442 --------------RQFSGD-----WEQEEGIEKEEEPTAAMLPDDTVEQQLELGEESAG 482

Query: 522 LSPVTESTTADVKRQKKKGGWSWFNKKSKKE 552
           ++  T+  + + KR +++ GW+W N K  KE
Sbjct: 483 MNKSTDD-SKETKRHRRRNGWTWLNSKMNKE 512

 Score =  185 bits (470), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 122/198 (61%), Gaps = 22/198 (11%)

Query: 720 FESDGLEELPTLQPAVSVTSTKQSDGAIPGVLENKTVSKEYEQNQYNHVQQ--------- 770
            ESD  E L  LQPAV+V+STK           N+  ++E E  + N  ++         
Sbjct: 697 VESDS-EGLLQLQPAVNVSSTKS----------NRRDTEEAETRKQNKKKRGDTIDLPNE 745

Query: 771 --TLDXXXXXXXXXXXXXXXXXXXXSLKPPASPTNDPHRLPPRKLVFEDVKRPEYPNAPM 828
             T D                       P A P      LPPRKL F DVK+PE PNAP+
Sbjct: 746 RLTKDVQKEKAHERKAQVQTEAPVQVQAPVAPPLRHTSVLPPRKLTFADVKKPEKPNAPV 805

Query: 829 KFTDSAFGFPLPPLTVSTVIMFDHRLPINVERAIYRLSHLKLSDPKRELRQQVLLSNFMY 888
           +F+DSAFGFPLP LTVSTVIMFDHRLPINVERAIYRLSHLKLS+ KR LR+QVLLSNFMY
Sbjct: 806 QFSDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHLKLSNSKRGLREQVLLSNFMY 865

Query: 889 AYLNLVNHSLYLQQVEEE 906
           AYLNLVNH+LY++Q  ++
Sbjct: 866 AYLNLVNHTLYMEQAAQD 883

>NDAI0E00350 Chr5 (54073..57564) [3492 bp, 1163 aa] {ON} Anc_8.831
            YML109W
          Length = 1163

 Score =  206 bits (525), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 114/146 (78%), Gaps = 4/146 (2%)

Query: 801  PTNDPHRLPPRKLVFEDVKRPEYPNAPMKFTDSAFGFPLPPLTVSTVIMFDHRLPINVER 860
            P +  H LPPRKL F+DVKRPE PNAP++FTDSAFGFPLP LTVSTVIMFDHRL INVER
Sbjct: 1018 PLSQQHGLPPRKLTFDDVKRPERPNAPVEFTDSAFGFPLPALTVSTVIMFDHRLGINVER 1077

Query: 861  AIYRLSHLKLSDPKRELRQQVLLSNFMYAYLNLVNHSLYLQQVEEENSM----IVGDDSM 916
            AIYRLSHLKLSD KRELR+QVLLSNFMYAYLNLVNH+LY++QV ++ ++      GDD+ 
Sbjct: 1078 AIYRLSHLKLSDSKRELREQVLLSNFMYAYLNLVNHTLYMEQVAQQETIDNVEFTGDDAN 1137

Query: 917  NEYSVGTPATDPIQNDNNGIINIPEI 942
            +           I ND+NG I IP+I
Sbjct: 1138 DHQMNMVTGNGGIYNDSNGSILIPDI 1163

 Score =  172 bits (437), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 137/359 (38%), Positives = 180/359 (50%), Gaps = 90/359 (25%)

Query: 116 MDITKTEYLHDNSNDDYGEYNRGNRTGSVGVSEDAWKTTLEIADGTSPRRALSGTGSVRR 175
           +D+T++EYLHD +       N  N    +  S D   +        S  R++SG GS++R
Sbjct: 167 IDVTQSEYLHDEATLKKKTQNDMN----IETSNDQPNSLQR-----SSHRSMSGVGSLKR 217

Query: 176 GGV-----------------LSNRSRLSGGKLNDP-----NDEEALT-QNLLWVPANQHP 212
            G+                  S +S LS     DP     +  + LT QNLLWVPANQHP
Sbjct: 218 NGLNRRKLPFLSSSYASTSSTSKQSILSSQSEKDPTFTSSSSSDNLTPQNLLWVPANQHP 277

Query: 213 SVKPENYLELVQDTLQNLQLENGVR-------------------DESNKENTVKLIHGLN 253
           ++KPE+YLELVQDTL N+ L++                      DE+NKEN + + +   
Sbjct: 278 NIKPESYLELVQDTLHNIHLDDDNHNNDDAKVSTDDDLYSMDGTDETNKEN-LNIDYLTK 336

Query: 254 SNVSQLPIQQGKNSLVRRPSRLRKSYTEFE------------DTEEYNLPISGNXXXXXX 301
            + S+L  ++   SLVRRPS LRKSYTEFE            D EE     + N      
Sbjct: 337 PSTSEL--RRKNKSLVRRPSGLRKSYTEFEEFNTSDEEDETSDCEEEQQLSTDNSTNNAN 394

Query: 302 X-------------------XXXXXXXXXXEITDELTKVSNNAGLTDSDAITLARTLSMA 342
                                         +IT+ELTK+SNNAGLTDSDAITLARTLSMA
Sbjct: 395 HHQDIIINNKTPEIIIPKGNTRSSRFVSLKDITEELTKISNNAGLTDSDAITLARTLSMA 454

Query: 343 STFYEGSNSEKENQSNTEKA-----EEDEFASNMLNQNSLAIPARSSLRRSKFNTYRIR 396
            +F + SN+   + +  E+      E+DE+ASNM  +N L IP RSSLRRS+FNTYRIR
Sbjct: 455 GSFQDNSNNNHNSDNFNEEQNGNTPEDDEYASNMFMKNGLTIPTRSSLRRSRFNTYRIR 513

 Score = 80.9 bits (198), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 44/45 (97%)

Query: 33 KEKRKSEVLIAAQSLDNELQNVKNLKRLSIGSMDLLMDPEMEFRI 77
          KEKRKS++ IAA+SLDNELQ+V+NLKRLSIGSMDLL+DPE+EFR+
Sbjct: 35 KEKRKSDMFIAAKSLDNELQSVQNLKRLSIGSMDLLIDPELEFRV 79

>KLLA0D01683g Chr4 complement(148855..151689) [2835 bp, 944 aa] {ON}
           some similarities with uniprot|P54786 Saccharomyces
           cerevisiae YML109W ZDS2 Protein that interacts with
           silencing proteins at the telomere involved in
           transcriptional silencing paralog of Zds1p and with
           YMR273C uniprot|P50111 Saccharomyces cerevisiae YMR273C
           ZDS1 Protein that interacts with silencing proteins at
           the telomere, involved in transcriptional silencing;
           also has a role in localization of Bcy1p, which is a
           regulatory subunit of protein kinase A; paralog of Zds2p
          Length = 944

 Score =  203 bits (517), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 110/135 (81%), Gaps = 14/135 (10%)

Query: 808 LPPRKLVFEDVKRPEYPNAPMKFTDSAFGFPLPPLTVSTVIMFDHRLPINVERAIYRLSH 867
           LPPRKL F DV +P+ PN+PMKFTDSAFGFPLPPLT+STVIMFDHRLPI+VERAIYRLSH
Sbjct: 824 LPPRKLTFADVLKPDRPNSPMKFTDSAFGFPLPPLTISTVIMFDHRLPIHVERAIYRLSH 883

Query: 868 LKLSDPKRELRQQVLLSNFMYAYLNLVNHSLYLQQVEEENSMIVGDDSMNEYSVGTPATD 927
           LKLSDPKR LRQQVLLSNFMYAYLNLVNHSLYLQQ+EEE+  +  + SMN          
Sbjct: 884 LKLSDPKRVLRQQVLLSNFMYAYLNLVNHSLYLQQIEEEH--MGNNGSMN---------- 931

Query: 928 PIQNDNNGIINIPEI 942
               ++N +I+IP++
Sbjct: 932 --MGNSNALIDIPDM 944

 Score =  167 bits (423), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 108/231 (46%), Positives = 139/231 (60%), Gaps = 31/231 (13%)

Query: 192 DPNDE----EALTQNLLWVPANQHPSVKPENYLELVQDTLQNLQLENGVRDESNKENTVK 247
           D NDE    E+L QNLLWV A+QHP+VKPENYLELVQ+TL+N+ L  G R  +  E   +
Sbjct: 177 DGNDESKHNESLGQNLLWVRADQHPNVKPENYLELVQNTLENMNL--GGRSPTANETQAQ 234

Query: 248 LIHGLNSNVSQLPIQQGKNSLVRRPSRLRKSYTEF-EDTEEYNL---PISGNXXXXXXXX 303
            + GL + + +  +Q G NSL RRPSRLR SYTE  ED E+  +   P++          
Sbjct: 235 SLSGLKT-LRKRSMQSG-NSLARRPSRLRTSYTELSEDDEDKGMTDQPLAA----AAPTM 288

Query: 304 XXXXXXXXXEITDELTKVSNNAGLTDSDAITLARTLSMASTFYEGSNSEKENQSNTEKAE 363
                    +IT+ELTK+SN AGLTD+DA+TLARTL +A      ++S  +  SN    E
Sbjct: 289 SSRRTVSLKDITEELTKLSNQAGLTDTDAVTLARTLWVADE--STTDSTGQGLSNNLADE 346

Query: 364 EDEFASNMLNQNSLAIPARSSLRRSKFNTYRI-------------RTPSGS 401
           E+EFAS M  ++   +PAR SLRRSKFNTYRI             R+PSGS
Sbjct: 347 EEEFASTMFTKSGFTVPARHSLRRSKFNTYRIQSSSSKEERIIETRSPSGS 397

 Score = 81.3 bits (199), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 39/49 (79%), Positives = 46/49 (93%), Gaps = 1/49 (2%)

Query: 30 PTSK-EKRKSEVLIAAQSLDNELQNVKNLKRLSIGSMDLLMDPEMEFRI 77
          P SK +KRKSEVLIAAQSLD E+++VKNLKRLSIGSMDLLMDPE+E+R+
Sbjct: 2  PMSKRDKRKSEVLIAAQSLDQEVKHVKNLKRLSIGSMDLLMDPELEYRV 50

>ZYRO0G13992g Chr7 complement(1112324..1115959) [3636 bp, 1211 aa]
            {ON} similar to uniprot|P54786 Saccharomyces cerevisiae
            YML109W ZDS2 Protein that interacts with silencing
            proteins at the telomere involved in transcriptional
            silencing paralog of Zds1p
          Length = 1211

 Score =  204 bits (519), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 102/153 (66%), Positives = 112/153 (73%), Gaps = 11/153 (7%)

Query: 797  PPASPTNDPHRLPPRKLVFEDVKRPEYPNAPMKFTDSAFGFPLPPLTVSTVIMFDHRLPI 856
            PP    N P  LP RKL F DVKR + PNAPM+FTDSAFGFPLP LTVSTV+MFDHRLPI
Sbjct: 1061 PPVQ--NQPQPLPARKLTFSDVKRLDRPNAPMQFTDSAFGFPLPMLTVSTVVMFDHRLPI 1118

Query: 857  NVERAIYRLSHLKLSDPKRELRQQVLLSNFMYAYLNLVNHSLYLQQVEEEN-------SM 909
            NVERAIYRLSHLKLSDPKRELRQQV+LSNFMYAYLNLVNH+LY++QV +E        S 
Sbjct: 1119 NVERAIYRLSHLKLSDPKRELRQQVMLSNFMYAYLNLVNHTLYMEQVAQEGGQEIPTASK 1178

Query: 910  IVGDDSMNEYSVGTPATDPIQNDNNGIINIPEI 942
                 S      G+  TD  QND NG I IP+I
Sbjct: 1179 TTNAASTAHTGSGSYTTD--QNDANGAICIPDI 1209

 Score =  200 bits (508), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 138/324 (42%), Positives = 180/324 (55%), Gaps = 43/324 (13%)

Query: 116 MDITKTEYLHD-NSNDDYGEYNRGNRTGSVGVSEDAWKTTLEIADGTSPRRALSGTGSVR 174
            D+T +EYL   + NDD       N T  +  S+ +  +        S  R++SG G+++
Sbjct: 159 FDVTNSEYLEGLDPNDDSSIQKSENDTTDLRGSQKSQVS--------SSGRSISGVGTLK 210

Query: 175 RGGVLSNRSRLSGGKLNDPNDEEALTQNLLWVPANQHPSVKPENYLELVQDTLQNLQLEN 234
           RG       + S           +LT+NLLWVPANQHP+VKPENYLELVQDTL N++LE 
Sbjct: 211 RGASNIPLRKTSTSSDASSGSNGSLTKNLLWVPANQHPNVKPENYLELVQDTLHNIRLE- 269

Query: 235 GVRDESNKEN----TVKLIHGLNS-NVSQLPIQQGKNSLVRRPSRLRKSYTEFEDTEEYN 289
           G  DE    +    T K+ HG N  N  +  + +  NSLVR+PSRLRKSYTEF++  +  
Sbjct: 270 GNEDEQTGNDMNTTTAKVEHGTNKENEDKGYLPRKNNSLVRKPSRLRKSYTEFDEENDDY 329

Query: 290 LPISGNXXXXX------------XXXXXXXXXXXXEITDELTKVSNNAGLTDSDAITLAR 337
           L  SG                              +ITDELTK+SNNAGLTDSDAITLAR
Sbjct: 330 LDTSGFSKKRSSEDVEDASNLTISSTNSSRAVSLRDITDELTKISNNAGLTDSDAITLAR 389

Query: 338 TLSMASTF--------------YEGSNSEKENQSNT-EKAEED-EFASNMLNQNSLAIPA 381
           TLSMA +F               +G + +  N+++  EK E+D EFASNM  +N   IPA
Sbjct: 390 TLSMAGSFTSDEPDDIIENSRGTQGDDLQYYNEADAMEKKEDDAEFASNMFMKNGFVIPA 449

Query: 382 RSSLRRSKFNTYRIRTPSGSSTNE 405
           RSSLRRSKFNTYR+R+ S  + +E
Sbjct: 450 RSSLRRSKFNTYRVRSASDENLDE 473

 Score = 84.0 bits (206), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 37/47 (78%), Positives = 46/47 (97%)

Query: 31 TSKEKRKSEVLIAAQSLDNELQNVKNLKRLSIGSMDLLMDPEMEFRI 77
          T KEKRKSEV+IAAQSLDNE+Q+VKNLKR+SIGSMD+L+DPE+E+R+
Sbjct: 53 TMKEKRKSEVMIAAQSLDNEVQSVKNLKRISIGSMDMLLDPELEYRV 99

 Score = 39.3 bits (90), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 17/23 (73%), Positives = 19/23 (82%)

Query: 441 LNSPSTINDMQDIYDHYDTSSVE 463
           L SPSTI+D QDIYDHY  SSV+
Sbjct: 570 LTSPSTISDFQDIYDHYRQSSVD 592

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 46/86 (53%), Gaps = 13/86 (15%)

Query: 534 KRQKKKGGWSWFNKKSK--------KEPEEDNLK----QSEQHTHRDSSDFFNVLSPSNG 581
           ++ +K+GGW+ F+  +K         + +EDN +    QSE++  ++++DF    S    
Sbjct: 717 RQAQKRGGWALFSMGTKDILGGDQRSDKDEDNNQMEEFQSEEYVPKENADFIKT-STHMR 775

Query: 582 TSKHNLPSNRINHSRNRHHSVVPASN 607
           T    + ++R NHS+NRH  +   +N
Sbjct: 776 TDYERVAADRSNHSKNRHSPIFTENN 801

>Ecym_2710 Chr2 (1373818..1376508) [2691 bp, 896 aa] {ON} similar to
           Ashbya gossypii AAL185W
          Length = 896

 Score =  197 bits (501), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 88/104 (84%), Positives = 96/104 (92%)

Query: 806 HRLPPRKLVFEDVKRPEYPNAPMKFTDSAFGFPLPPLTVSTVIMFDHRLPINVERAIYRL 865
           + LPPR+L F+DV RPE PN+PMKFT SAFGFPLPPLT+STVIMFDHRLPI  ERAIYRL
Sbjct: 789 YALPPRELTFDDVIRPEKPNSPMKFTPSAFGFPLPPLTISTVIMFDHRLPIYAERAIYRL 848

Query: 866 SHLKLSDPKRELRQQVLLSNFMYAYLNLVNHSLYLQQVEEENSM 909
           SHLKLSDPKRELRQQVLLSNFMY+YLNLVNHSLYLQQ+EEE +M
Sbjct: 849 SHLKLSDPKRELRQQVLLSNFMYSYLNLVNHSLYLQQIEEEKNM 892

 Score =  196 bits (499), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 196/587 (33%), Positives = 277/587 (47%), Gaps = 104/587 (17%)

Query: 65  MDLLMDPEMEFRINXXXXXXXXXXXXXXXXXNDKEGYAXXXXXXXXXXXXXMDITKTEYL 124
           MDLL+DPEMEFR                       G +               I + ++ 
Sbjct: 1   MDLLVDPEMEFRF----------------------GGSASMSSAPRRSLSEESIDRFQFS 38

Query: 125 HDNSNDDYGEYNRGNRTGSVGVSEDAWKTTLE------IADGTSPR-----RALSGTGSV 173
            +N  D Y      +   S   +ED+ + T E       AD  + +     R +S + +V
Sbjct: 39  VENEPDPY----VTDADDSYSFTEDSAEITCEDHLQSTFADKAAEKDSKYTRNISRSFTV 94

Query: 174 RRGGVLSNRSRLSGGKLNDP----NDE-EALTQNLLWVPANQHPSVKPENYLELVQDTLQ 228
           ++  + S+RS+      + P    NDE E  + NLLWVPA+QHP+VK ENYLELV DTL 
Sbjct: 95  KKSSLSSSRSKFGKSLKDSPPTSENDENEPFSSNLLWVPADQHPNVKLENYLELVTDTLH 154

Query: 229 NLQLENGVRDESNKENTVKLIHGLNSNVSQLPIQQGKNSLVRRPSRLRKSYTEFEDTEEY 288
           NLQL    + E N  +  +L    NS  +   I   KNSLVR+PSRLRKS+TE E+ ++ 
Sbjct: 155 NLQLVGREQLEKNPNSNYQLSQ-TNSTSAHEAI-PSKNSLVRKPSRLRKSFTEAENIDDP 212

Query: 289 N--------LPISGNXXXXXXXXXXXXXXXXXEITDELTKVSNNAGLTDSDAITLARTLS 340
           N         PIS                   EIT+ELT++SNNAGLTDSDAITLARTL 
Sbjct: 213 NSDEDLNTETPIS----------KRKRVSSLKEITEELTRISNNAGLTDSDAITLARTLG 262

Query: 341 MASTFYEGSNSEKENQSNTEKAEED----EFASNMLNQNSLAIPARSSLRRSKFNTYRIR 396
           + +     + +++ N +NT+ A  D    E+ASN+L +N L+I   SSLRRSKF TYRIR
Sbjct: 263 IGTP----AATDRRNFTNTDVASNDEIDEEYASNILTKNGLSISQGSSLRRSKFATYRIR 318

Query: 397 TPSGSSTNEFAQSNLKVSSTEENPQPEI-------EVAVEETLPRVLEEHILNSPSTIND 449
           +PSG S       +L + S  E  Q ++        V  E   P+  +  I  +P + N 
Sbjct: 319 SPSGDSLPLLESGSL-LPSLPEYAQEQVANHLKDAHVFKEGQPPQSWDASI--TPQSPNS 375

Query: 450 MQDIYDHYDTSSVEESLPPQNSNYSSAQQDGDNLQXXXXXXXXXXXXXTANAILKSKQSI 509
           + DIYDHY+T+  +E +   +    S Q  G +                  AI  S  S 
Sbjct: 376 INDIYDHYNTTDTDEYV-SDDLTSPSTQMSGASYTVSPAQVSCGHSKKDTYAISSSTTSP 434

Query: 510 -------VQTKSDSIQKEFLS------PVTESTTADVKRQKKKGGWSWFNKKSKKEPEE- 555
                    + S  I K  +       P  +ST +   R+KKK GW+WFN  +K+ P E 
Sbjct: 435 SSNPPIDATSTSSLISKSPIRTIPANLPAKDSTKS---REKKKPGWNWFN--NKRTPSET 489

Query: 556 ---DNLKQSEQHTHRDSSDFFNVLSPSNGTSKHNLPSNRINHSRNRH 599
              D+     Q    +S++ F  +S  +  S   +   ++NHSRNRH
Sbjct: 490 DNSDSNSDQLQFEKGNSNENFPAVSVQSAPSPERV-DRKVNHSRNRH 535

>Suva_13.35 Chr13 (51377..54325) [2949 bp, 982 aa] {ON} YML109W
           (REAL)
          Length = 982

 Score =  195 bits (495), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 93/135 (68%), Positives = 109/135 (80%), Gaps = 9/135 (6%)

Query: 808 LPPRKLVFEDVKRPEYPNAPMKFTDSAFGFPLPPLTVSTVIMFDHRLPINVERAIYRLSH 867
           L P+KL FEDV  PEYPNAP+KFTDSAFGFPLP +T STVIMFDHRL INVERAIYRLSH
Sbjct: 857 LLPKKLTFEDVITPEYPNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVERAIYRLSH 916

Query: 868 LKLSDPKRELRQQVLLSNFMYAYLNLVNHSLYLQQVEEENSMIVGDDSMNEYSVGTPATD 927
           LKLSDP RELRQQVLLSNFMY+YLNLVNH+LY++Q+  EN++  GD ++         TD
Sbjct: 917 LKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQIGSENAVFNGDSAL-------AMTD 969

Query: 928 PIQNDNNGIINIPEI 942
             +ND++G I IP+I
Sbjct: 970 --KNDSDGTILIPDI 982

 Score =  179 bits (455), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 176/522 (33%), Positives = 244/522 (46%), Gaps = 82/522 (15%)

Query: 116 MDITKTEYLHDNSNDDYGEYNRGNRTGSVGVSEDAWKTTLEIADGTSPRRALSGTGSVRR 175
           +DIT+TEYLHD   ++  E  + +R  S         +T   A  TS  R LSG  S   
Sbjct: 180 IDITQTEYLHD---EETLEKEKSSRNAS--------SSTSSSARVTSSNRRLSGVNSFAH 228

Query: 176 GGVLSNRSRLSGGKLNDPNDEEALTQNLLWVPANQHPSVKPENYLELVQDTLQNLQLENG 235
             VL      S    N       LTQNLLWVPA+QHP+VKPENYLELVQDTLQN+Q+   
Sbjct: 229 DEVLDVAEDHSSNTAN-------LTQNLLWVPASQHPNVKPENYLELVQDTLQNIQI--- 278

Query: 236 VRDESNKENTVKLIHGLNSNVSQLPIQQGKNSLVRRPSRLRKSYTEFED-----TEEYNL 290
             D+   E    L     SN      +Q   S+VRRPS L+ SYT+F+D       +   
Sbjct: 279 TTDQDPDEKNSDL-----SNNHVFSNRQRSGSIVRRPSHLKTSYTKFDDEPSSVDRQRQG 333

Query: 291 PISGNXXXXXXXXXXXXXXXXXEITDELTKVSNNAGLTDSDAITLARTLSMASTFYEGSN 350
                                 EIT+ELTK+S+NAGLTDSDAITLAR+LSM+ +F   S 
Sbjct: 334 HGQAEKRISSLETKSIRCVSLKEITEELTKISDNAGLTDSDAITLARSLSMSGSFTNESL 393

Query: 351 SEKENQSNTEKAEEDEFASNMLNQNSLAIPARSSLRRSKFNTYRIR------TPSGSSTN 404
               N++++    ++EFASNM N++ L IP R SLRRSKFNTY+IR       P+G   +
Sbjct: 394 HLSSNKTDS----DNEFASNMFNKSGLTIPER-SLRRSKFNTYKIRLENNDLLPTGRPNS 448

Query: 405 EF-AQSN---LKVSSTEENPQPEIEVAVEETLPRVLEEHILNSPSTINDMQDIYDHYDTS 460
               Q+N    + SS     QP      ++  P             +ND Q+I++HY  +
Sbjct: 449 LMNVQTNDDRRRASSPASYTQPP-----QDQTP-------------LNDFQEIFEHYRRT 490

Query: 461 S----VEESLPPQNSNYSSAQQDGDNLQXXXXXXXXXXXXXTANAILKSKQSIVQTKSDS 516
           S     E +    N+NY S ++D  +               + N++L    +     S+ 
Sbjct: 491 STDWGTENTKYVDNTNYYSDEEDLTH-ASISQDSSFLSTDSSNNSVLVKPHNAGSMISER 549

Query: 517 IQKEFLSPVTESTTADVKRQKKKGGWSWFNKKSKK--------EPEEDNLKQSEQHTHRD 568
           + ++  S   E    D+   +   GWSW N  ++         E   D+ +        +
Sbjct: 550 LDQDIASNENE----DIDINEPNHGWSWLNSANENLTNYDGAYEQVIDDEEDIGDCVEDE 605

Query: 569 SSDFFNVLSPSNGTSKHNLPSNRINHSRNRHHSVVPASNDGS 610
            +DF N LS S         S RINHS+NRH  +    +D S
Sbjct: 606 KADFVN-LSVSRRAKSTKRASERINHSKNRHSPIFQMQSDES 646

 Score = 78.2 bits (191), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 50/60 (83%), Gaps = 4/60 (6%)

Query: 22 QASKIRNSPTSK----EKRKSEVLIAAQSLDNELQNVKNLKRLSIGSMDLLMDPEMEFRI 77
          Q  ++R +  SK    EKRKS+VLIAA+SLD E+Q+VKNLKRLSIGSMDL++DPE+EF++
Sbjct: 35 QIRRMRKTQLSKKELLEKRKSDVLIAAKSLDTEIQHVKNLKRLSIGSMDLVIDPELEFKV 94

>Suva_13.461 Chr13 complement(793859..796654) [2796 bp, 931 aa] {ON}
           YMR273C (REAL)
          Length = 931

 Score =  189 bits (481), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 121/186 (65%), Gaps = 9/186 (4%)

Query: 721 ESDGLEELPTLQPAVSVTSTKQSDGAIPGVLENKTVSKEYEQN---QYNHVQQTLDXXXX 777
           ESD  E LP LQPA+SV+STK +      V + K  +KE   N      HVQ+ +D    
Sbjct: 737 ESD-TESLPKLQPAISVSSTKSNPRDCEEV-DAKKKNKEKRSNTGKHAKHVQKEMDHEQR 794

Query: 778 XXXXXXXXXXXXXXXXSLKPPASPTNDPHRLPPRKLVFEDVKRPEYPNAPMKFTDSAFGF 837
                                A        LPPRKL F DVK+ E PNAP++FTDSAFGF
Sbjct: 795 GQAAAAPVAPADPAAPP----APALRHTSVLPPRKLTFADVKKSEKPNAPVQFTDSAFGF 850

Query: 838 PLPPLTVSTVIMFDHRLPINVERAIYRLSHLKLSDPKRELRQQVLLSNFMYAYLNLVNHS 897
           PLP LTVSTV+MFDHRLPINVERAIYRLSHLKLS+ KRELR+QVLLSNFMYAYLNLVNH+
Sbjct: 851 PLPLLTVSTVVMFDHRLPINVERAIYRLSHLKLSNSKRELREQVLLSNFMYAYLNLVNHT 910

Query: 898 LYLQQV 903
           LY++Q 
Sbjct: 911 LYMEQA 916

 Score =  182 bits (462), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 149/407 (36%), Positives = 196/407 (48%), Gaps = 82/407 (20%)

Query: 198 ALTQNLLWVPANQHPSVKPENYLELVQDTLQNLQLENGVRDESNKENTVKLIHG------ 251
           AL  NLLWVPANQHP+VKP+NYLELVQDTLQN++L +   D  N +N     HG      
Sbjct: 145 ALKNNLLWVPANQHPNVKPDNYLELVQDTLQNIRLGDNDDDNDNNDNEGDEAHGETESYG 204

Query: 252 ----LNS-NVSQLPIQQGKNSLVRRPSRLRKSYTEFEDTEEY-----NLPISGNXXXXXX 301
               LN  NV++   + G  SL+RRPS LR+SYTEF+D+E       +  ++ N      
Sbjct: 205 NKENLNVVNVNRGMPRHGNASLIRRPSTLRRSYTEFDDSEGDIGQGDDDSMTVNKAKERT 264

Query: 302 XXXXXXXXXXXEITDELTKVSNNAGLTDSDAITLARTLSMASTF---------------Y 346
                      +IT+ELTK+SN+AGLTD DAITLARTL+MA ++               Y
Sbjct: 265 SRIRERPISLRDITEELTKISNSAGLTDDDAITLARTLNMAGSYSDKGDGPRSEDSRVGY 324

Query: 347 EGSNSEKENQSNTEKAEEDEFASNMLNQNSLAIPARSSLRRSKFNTYRIRTPSGSSTNEF 406
           E  N+ K   S TE  ++ E+ASNM   N    P RSSL+RS+FNTYRIR+ +     E 
Sbjct: 325 EEENA-KVTGSQTETPDDVEYASNMPINNDSTGPERSSLKRSRFNTYRIRSHTEEQEEEQ 383

Query: 407 AQSNLKVSSTEENPQPE--IEVAVEETLPRVLEEHI----LNSPSTINDMQDIYDHYDTS 460
                K          E  IE+ +        +E      ++SP +I D QDIYDHY  S
Sbjct: 384 VLEETKKEDVSRLHLAENTIEIGINSPKSPFRQEDDESDPVSSPGSIGDFQDIYDHYTQS 443

Query: 461 SVEESLPPQNSNYSSAQQDGDNLQXXXXXXXXXXXXXTANAILKSKQSIVQTKSDSIQKE 520
           S                  GD  +                 I KSK        D+  ++
Sbjct: 444 S------------------GDWEKEM--------------GIEKSKALEGGKVEDNAVEQ 471

Query: 521 FLSPVTEST----------TADVKRQKKKGGWSWFNKKSKKEPEEDN 557
            L P  EST          + + KR +++ GW+W N K  K  EEDN
Sbjct: 472 ELEPQEESTGTVVSGTTDDSKETKRHRRRNGWTWLNNKMNK--EEDN 516

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 35/51 (68%), Positives = 46/51 (90%)

Query: 27 RNSPTSKEKRKSEVLIAAQSLDNELQNVKNLKRLSIGSMDLLMDPEMEFRI 77
          R + + ++KRKSEVLIAAQSLDNE+++VKNLKRLSIGSMDLL+DPE++ + 
Sbjct: 17 RAAASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKF 67

>KNAG0G03370 Chr7 complement(724041..727271) [3231 bp, 1076 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1076

 Score =  190 bits (482), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 102/186 (54%), Positives = 120/186 (64%), Gaps = 16/186 (8%)

Query: 726  EELPTLQPAVSVTSTKQS--DGAIPGVL------ENKTVSKEYEQNQYNHVQQTLDXXXX 777
            +ELP LQPAVSVTS K +  +G +   +      +++ +S    Q Q   + + +D    
Sbjct: 848  DELPGLQPAVSVTSAKNTRDNGDVVETVRELDGDDSQDISGGDIQYQMQPIDEPVDGEVA 907

Query: 778  XXXXXXXXXXXXXXXXSLKPPASPTNDPHRLPPRKLVFEDVKRPEYPNAPMKFTDSAFGF 837
                                          LPPRKL + DVKRPE PNAP++FTDSAFGF
Sbjct: 908  TVDDTQTVTAAAASALPAVIST--------LPPRKLTYADVKRPEKPNAPIQFTDSAFGF 959

Query: 838  PLPPLTVSTVIMFDHRLPINVERAIYRLSHLKLSDPKRELRQQVLLSNFMYAYLNLVNHS 897
            PLP LTVSTVIMFDHRL INVERAIYRLSHLKLSD KRELRQQVLLSNFMYAYLNLVNH+
Sbjct: 960  PLPMLTVSTVIMFDHRLGINVERAIYRLSHLKLSDSKRELRQQVLLSNFMYAYLNLVNHT 1019

Query: 898  LYLQQV 903
            LY++QV
Sbjct: 1020 LYMEQV 1025

 Score =  176 bits (447), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 168/534 (31%), Positives = 245/534 (45%), Gaps = 107/534 (20%)

Query: 165 RALSGTGSVRRGG-VLSNRSRLSGGKLNDPNDEEALTQNLLWVPANQHPSVKPENYLELV 223
           R LSG G +RRG   +S  +R   G  +       L  NLLWVPANQHP+VKPENYLELV
Sbjct: 203 RKLSGAGFLRRGSSAVSQTARKLSGTAD-------LKSNLLWVPANQHPNVKPENYLELV 255

Query: 224 QDTLQNL---------------QLENGVR----DESNKENTVKLIHGLNSNVSQLPIQQG 264
            DTLQ +                 + G      DES+KEN        N+   ++  + G
Sbjct: 256 HDTLQTINGEGDGDGDGHTIDTSADTGTAADSVDESDKEN--------NNTRLRVRYRNG 307

Query: 265 K-NSLVRRPSRLRKSYTEFEDTEEYNLP-----------ISGNXXXXXXXXXXXXXXXXX 312
           K +SLVRRPSRLR+SY E ++ E+ N              S +                 
Sbjct: 308 KASSLVRRPSRLRRSYIETDEDEDSNTSNAKIDDIEEGGRSLDERKPTRTNGDRKSVSLR 367

Query: 313 EITDELTKVSNNAGLTDSDAITLARTLSMASTFY----EGSNS------------EKENQ 356
           +IT+ELTK+SN+ GLTD DA+TLARTL+M  T+     EG ++            E EN 
Sbjct: 368 DITEELTKMSNSVGLTDDDAVTLARTLNMTCTYTDTDSEGLDNLRTDSKEQLRAEESENP 427

Query: 357 SNTEKA----EEDEFASNMLNQNSLAIPARSSLRRSKFNTYRIRTPSGSS---------T 403
             T  A    +E++FASNM  +N L+IP RSSLRRSKFNTYRIRT S  +          
Sbjct: 428 PGTTHAKILPDENQFASNMFMKNGLSIPTRSSLRRSKFNTYRIRTTSAPTPLVEKPKRNN 487

Query: 404 NEFAQSNLKVSSTEENPQPEIEVAVEETLPRVLEEHILNSPSTINDMQDIYDHYDTSSVE 463
           +  A+ +      EE    E   A++       E  ++ SP +I+D+   YDHY  ++ E
Sbjct: 488 SRHARLSFVHLDDEEFASHESPAALQSPTVNNDEAGVIESPGSISDL---YDHYTGTASE 544

Query: 464 ESLP--------PQNSNYSSAQQDGDNLQXXXXXXXXXXXXXTANAILKSKQSI---VQT 512
              P         ++ +   +  D D                + +++L    +I   +  
Sbjct: 545 PGSPDVSEDKELKEDMSREYSTDDNDFSTNTSHDSSFLSNESSNDSVLYRPTNIKPMISE 604

Query: 513 KSDSIQKE----FLSPVTESTTADVKRQKKKGGWSWFNKKSKKEPEE------DNLKQSE 562
             D++++E      + V E T  D         WSW  K      ++      + +++ E
Sbjct: 605 NFDAVEQEDEETISTAVAEPTKNDNNNNTNSMPWSWLAKDGTDIDDQPMDLKGEIVQEGE 664

Query: 563 QHTHRDSSDFFNVLSPSNGTSKHNLPSNRINHSRNRHHSVVPASNDGSTSTATP 616
            +TH  ++DF +V   +   SKH  P +R NHS+NRH  +   ++  +    TP
Sbjct: 665 ANTH--TNDFVSV---NAAPSKH--PIDRGNHSKNRHMPIFTLNSASTNQDDTP 711

 Score = 82.8 bits (203), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 46/52 (88%)

Query: 27 RNSPTSKEKRKSEVLIAAQSLDNELQNVKNLKRLSIGSMDLLMDPEMEFRIN 78
          R +   + KRKSEVLIAAQSLD E+QNVK+LKRLSIGSMDLL+DPE+EFR+N
Sbjct: 18 RATEMDRNKRKSEVLIAAQSLDVEVQNVKHLKRLSIGSMDLLIDPELEFRVN 69

>CAGL0J06688g Chr10 complement(640041..642527) [2487 bp, 828 aa]
           {ON} similar to uniprot|P54786 Saccharomyces cerevisiae
           YML109w ZDS2 or uniprot|P50111 Saccharomyces cerevisiae
           YMR273c ZDS1
          Length = 828

 Score =  188 bits (477), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 152/390 (38%), Positives = 204/390 (52%), Gaps = 69/390 (17%)

Query: 38  SEVLIAAQSLDNELQNVKNLKRLSIGSMDLLMDPEMEFRINXXXXXXXXXXXXXXXXXND 97
           SE L AAQSLD E+QNVKNLKRLSIGS+DL+ DPE+   +                    
Sbjct: 21  SEYLRAAQSLDQEVQNVKNLKRLSIGSIDLITDPELNVTVTGTEREDTSYDADLSNGSFT 80

Query: 98  KEG--YAXXXXXXXXXXXXXMDITKTEYL--HDNSNDDYGEYNRG-NRTGSVGVSEDAWK 152
           +E                  +D T+ EYL  +DN+ +   E  +G  RT S+ ++  A  
Sbjct: 81  EEDDTTTEIDGSDADETSASIDRTRVEYLTSYDNTQESSNESPKGVARTRSLNLNYHANS 140

Query: 153 TTLEIADGTSPRRALSGTGSVRRGGVLSNRSRLSGGKLNDP-NDEEALTQNLLWVPANQH 211
                +D +   R L G+ S      LSN        L  P N+E++++  L WVPANQH
Sbjct: 141 N----SDISIKERTLRGSRS------LSN--------LKKPKNEEQSVSDKLFWVPANQH 182

Query: 212 PSVKPENYLELVQDTLQNLQLENGVRD----------------ESNKENTVKLIHGLNSN 255
           P+VKPENYLELV++TL      N +RD                 SNKEN       +N N
Sbjct: 183 PNVKPENYLELVKETL------NKIRDINTDGKEKSENNSEEEVSNKEN-------INEN 229

Query: 256 VSQLPIQQGKNSLVRRPSRLRKSYTEF--EDTEEYNLPISGNXXXXXXXXXXXXXXXXXE 313
                  + + S+VRRPS+LRKSYTEF  ED E  +  +S N                 E
Sbjct: 230 ------GRLRGSIVRRPSKLRKSYTEFSSEDLELLDKALSNNRIISTRNTTNSKRLSLKE 283

Query: 314 ITDELTKVSNNAGLTDSDAITLARTLSMASTFYEGSNSEKENQSNTEK------AEEDEF 367
           IT+EL K SN AGLTD +A+TLARTLS+AS+    + + + +QSNTE+      A++D F
Sbjct: 284 ITNELVKHSNKAGLTDDNAVTLARTLSIASSVTNQNETGRNDQSNTEQQKQSEDADDDTF 343

Query: 368 ASNML-NQNSLAIPARSSLRRSKFNTYRIR 396
           A+ ++ N +SLA    SSLRRSKFNTYR++
Sbjct: 344 ATAVVGNSHSLA-SNTSSLRRSKFNTYRVK 372

 Score =  174 bits (440), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 87/143 (60%), Positives = 109/143 (76%), Gaps = 4/143 (2%)

Query: 802 TNDPHRL-PPRKLVFEDVKRPEYPNAPMKFTDSAFGFPLPPLTVSTVIMFDHRLPINVER 860
           T++P+++  P+KL F+DVK+PE  NAPM+FTDSAFGFPLPPLT+STVIM DHRL INVER
Sbjct: 687 TDEPNKVGKPKKLTFDDVKKPERANAPMEFTDSAFGFPLPPLTISTVIMCDHRLGINVER 746

Query: 861 AIYRLSHLKLSDPKRELRQQVLLSNFMYAYLNLVNHSLYLQQVEEE-NSMIVGDDSMNEY 919
           AIYRLSHLKLS+  RELRQQVLLSNFMYAYLNLV H+L +++ E++  S    D+ + E 
Sbjct: 747 AIYRLSHLKLSETNRELRQQVLLSNFMYAYLNLVEHTLSVEEAEQDKQSTSSPDNKVVEL 806

Query: 920 SVGTPATDPIQNDNNGIINIPEI 942
                 T    N ++G I IPE+
Sbjct: 807 EGSNYNT--AHNQSDGTILIPEL 827

>TPHA0I00200 Chr9 complement(34713..37862) [3150 bp, 1049 aa] {ON}
           Anc_8.831 YMR273C
          Length = 1049

 Score =  187 bits (475), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 80/99 (80%), Positives = 91/99 (91%)

Query: 808 LPPRKLVFEDVKRPEYPNAPMKFTDSAFGFPLPPLTVSTVIMFDHRLPINVERAIYRLSH 867
           LP RKL F+DV +PE PN PM+FTDSAFGFPLP LT STVIMFDHRLP+NVERAIYRLSH
Sbjct: 885 LPARKLTFKDVVKPERPNGPMEFTDSAFGFPLPKLTTSTVIMFDHRLPVNVERAIYRLSH 944

Query: 868 LKLSDPKRELRQQVLLSNFMYAYLNLVNHSLYLQQVEEE 906
           LKLSDPKRELR+Q+LLSNFMYAYL+LVNHSLY++Q E++
Sbjct: 945 LKLSDPKRELREQILLSNFMYAYLHLVNHSLYIEQAEQQ 983

 Score =  154 bits (390), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 120/331 (36%), Positives = 174/331 (52%), Gaps = 57/331 (17%)

Query: 116 MDITKTEYLHDNSNDDYGE-YNRGNRTGSVG----VSEDAWKTTLEIADGTSPRRALSGT 170
            D T  EYLH   N+D+   +   N   ++G    ++E  +++     + +  RR LSG 
Sbjct: 125 FDKTGIEYLH---NEDFEHVHTNENNNYTLGEEPNINESLFQSH---KNNSQLRRGLSGV 178

Query: 171 GSVRRGGVLSNRSRLSGGKLNDPNDEEALTQNLLWVPANQHPSVKPENYLELVQDTLQNL 230
            S+ RG     + ++   +      E+ +TQNLLWVPAN+HP VKPENY+EL+QDTLQN+
Sbjct: 179 HSLNRGNSKQLKPKIQNKQ---TETEDQITQNLLWVPANKHPGVKPENYVELLQDTLQNI 235

Query: 231 QL-----ENGVRDESNKENTVKLIHG---LNSNVSQLPIQQGKNSLVRRPSRLRKSYT-- 280
            L     +N V D SNK +   ++         +SQ  + +  +SLVRRP+ LR SY+  
Sbjct: 236 NLNLNETQNNVEDTSNKTSDKMVMDREVIRRRRISQ-DLNRNHSSLVRRPTGLRISYSES 294

Query: 281 --EFEDTEEYN------------------LPISGNXXXXXXXXXXXXXXXXXEITDELTK 320
             EF D  E                      I+ +                 +IT+ELTK
Sbjct: 295 VEEFHDALESENSLNSDKEREPSLSQNSISMITIDLQNKSTYQMGKNYASLKDITEELTK 354

Query: 321 VSNNAGLTDSDAITLARTLSMASTFYEGSNSEKEN-QSNTE----------KAEEDEFAS 369
           +SN AGL++SDAI+LAR+LS+A +  +  NS  +N QS T+          +  E  +AS
Sbjct: 355 ISNKAGLSNSDAISLARSLSIAGSVSKTDNSVSDNLQSATQGNDDNKPRSSEVSEAGYAS 414

Query: 370 NMLNQNSLAIPARSSLRRSKFNTYRIRTPSG 400
           N+L +N + +P R SLRRSKFNTY+IR PSG
Sbjct: 415 NILVRNGITMPTR-SLRRSKFNTYKIRNPSG 444

 Score = 74.3 bits (181), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/57 (64%), Positives = 46/57 (80%), Gaps = 1/57 (1%)

Query: 21 YQASKIRNSPTSKEKRKSEVLIAAQSLDNELQNVKNLKRLSIGSMDLLMDPEMEFRI 77
          Y+   +R + T +EKRKS VLIAAQSLD E+QNVK LKRLS+GSMDLL+DPE E+ +
Sbjct: 3  YKNETLR-ACTVEEKRKSAVLIAAQSLDLEVQNVKKLKRLSVGSMDLLLDPEFEYTM 58

>Kpol_541.10 s541 complement(26683..29853) [3171 bp, 1056 aa] {ON}
            complement(26683..29853) [3171 nt, 1057 aa]
          Length = 1056

 Score =  179 bits (454), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 77/98 (78%), Positives = 89/98 (90%)

Query: 808  LPPRKLVFEDVKRPEYPNAPMKFTDSAFGFPLPPLTVSTVIMFDHRLPINVERAIYRLSH 867
            LPPRKLVF DV + + PN P++FTDSAFGFPLP LT+STVIMFDHRLP+NVERAIYRLSH
Sbjct: 930  LPPRKLVFADVHKSDIPNGPIQFTDSAFGFPLPLLTISTVIMFDHRLPVNVERAIYRLSH 989

Query: 868  LKLSDPKRELRQQVLLSNFMYAYLNLVNHSLYLQQVEE 905
            LKLS+PKR LR QVLLSNFMYAYL+LVNH+LY++Q E+
Sbjct: 990  LKLSEPKRALRDQVLLSNFMYAYLHLVNHTLYMEQHEQ 1027

 Score =  146 bits (369), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 139/453 (30%), Positives = 211/453 (46%), Gaps = 95/453 (20%)

Query: 182 RSRLSGGK-LNDPNDEEALT-------QNLLWVPANQHPSVKPENYLELVQDTLQNLQLE 233
           R +LSG + LN   D  A         +NLLWVPA++HP+V P+NY++++Q++L NL LE
Sbjct: 138 RRKLSGSRSLNTIPDSMAYNSKASTTKKNLLWVPADKHPNVMPDNYIQMIQNSLNNLSLE 197

Query: 234 NG--------VRDESNKENTVKLIHGLNSNVSQLPIQQGKNSLVRRPSRLRKSYTEF--- 282
           +         V  + NKEN  +    L+     +  ++   SLVRRPS+LRKSYTEF   
Sbjct: 198 SNEDVDKDSKVLPQENKENIYEDRERLS-----VAYKRRNRSLVRRPSQLRKSYTEFNNS 252

Query: 283 ----EDTEEYNLPISGNXXXXXXXXXXXXXXXXX-------------EITDELTKVSNNA 325
               ++T+E NL  +                                +IT ELTK+SN+ 
Sbjct: 253 DDEEDNTDENNLSKNNKDTNENSANTSMDSIKTSKSFDNKRYSISLKDITAELTKISNSV 312

Query: 326 GLTDSDAITLARTLSMASTFYEGSNSEK------ENQSNTEKAEEDEFASNMLNQNSLAI 379
           GL+DSDA++LAR+LS+   + + + S+       +N S+ E++  DEF SNM+ +N L I
Sbjct: 313 GLSDSDAVSLARSLSITGPYQDETESDGAGDIMLDNPSD-EESLNDEFVSNMVLRNGLMI 371

Query: 380 PARSSLRRSKFNTYR-------IRTPSGSSTNEFAQSNLKVSSTEEN-------PQPEIE 425
           P RSSLRRSKF TYR         +P   + ++  ++++  S   EN         PE+ 
Sbjct: 372 PTRSSLRRSKFTTYRSRTSSSDSLSPKKQNFDDKQETSVSSSKANENEIKNPFGKLPEVN 431

Query: 426 VAVEETLPRVLEEHILNSPSTINDMQDIYDHY---------------DTSSVEESLPPQN 470
           +  EE+     +E +  SP+  +D QDIYDHY               DTS  + S+    
Sbjct: 432 LKAEES--NEDDESLKTSPAA-SDFQDIYDHYRQPSSDWDMEFKKHDDTSFTDSSITNSY 488

Query: 471 SNYSSAQ----------QDGDNLQXXXXXXXXXXXXXTANAILKSKQSIVQTKSDSIQKE 520
           S  SS Q          +D +N                 + +  ++ S+    S SI KE
Sbjct: 489 SYTSSVQKLDTEPSDEIEDQNNDFSYEIDSYEVPDSDKFDNLDGTENSLNNKSSTSINKE 548

Query: 521 FL-----SPVTESTTADVKRQKKKGGWSWFNKK 548
            +     S +        K   +K  W WF+K+
Sbjct: 549 HIETSKPSELLAKENEPEKHHSRKAAWPWFSKR 581

 Score = 74.7 bits (182), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 36/74 (48%), Positives = 55/74 (74%), Gaps = 4/74 (5%)

Query: 4  AKLDDARIRGQQMDEEEYQASKIRNSPTSKEKRKSEVLIAAQSLDNELQNVKNLKRLSIG 63
          ++ +D  +R QQ ++    +    N+ +  +KRKS VLIAA+SLD EL+++K+LKR SIG
Sbjct: 6  SRTEDTNLREQQSNDRLLSS----NATSMDDKRKSAVLIAAKSLDRELKHIKDLKRFSIG 61

Query: 64 SMDLLMDPEMEFRI 77
          SMD+LMDPE+E+R+
Sbjct: 62 SMDMLMDPELEYRV 75

>CAGL0F03421g Chr6 complement(336157..338610) [2454 bp, 817 aa] {ON}
           similar to uniprot|P50111 Saccharomyces cerevisiae
           YMR273c ZDS1
          Length = 817

 Score =  171 bits (433), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 107/173 (61%), Gaps = 33/173 (19%)

Query: 730 TLQPAVSVTSTKQSDGAIPGVLENKTVSKEYEQNQYNHVQQTLDXXXXXXXXXXXXXXXX 789
           +LQPAV+VTSTK  +  I  V    T S+  E                            
Sbjct: 676 SLQPAVNVTSTKNQEIVIQNVTVTATPSQREE------------------------ATDS 711

Query: 790 XXXXSLKPPASPTNDPHRLPPRKLVFEDVKRPEYPNAPMKFTDSAFGFPLPPLTVSTVIM 849
               S KP           PPRKL F DVK+ +  NAP++FTDSAFGFPLP LT STVIM
Sbjct: 712 SKTASKKP---------LYPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVIM 762

Query: 850 FDHRLPINVERAIYRLSHLKLSDPKRELRQQVLLSNFMYAYLNLVNHSLYLQQ 902
           FDHRLPI+VERAIYRLSHLKLS+ KR LR+QVLLSNFMY+YLNLVNH+LY++Q
Sbjct: 763 FDHRLPIHVERAIYRLSHLKLSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQ 815

 Score =  164 bits (414), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 156/455 (34%), Positives = 223/455 (49%), Gaps = 96/455 (21%)

Query: 165 RALSGTGSV----RRGGVLSNRSRLSGGKLNDPNDEEALTQNLLWVPANQHPSVKPENYL 220
           ++L+  G+V    RR    SN S+ +  K+ND   +E + QNLLWV A+QHP+VKPENY+
Sbjct: 114 KSLTRRGAVNFSSRRPVDRSNHSK-NSSKINDTLPDE-VAQNLLWVRADQHPNVKPENYI 171

Query: 221 ELVQDTLQNLQLENGVRDESNKENT---VKLIHGLNSNVSQLPIQQGKNSLVRRPSRLRK 277
           ELVQD L N+Q++    +E +KEN+    K+    NSN  + P   G   LVRRPS LRK
Sbjct: 172 ELVQDALHNIQIDKT--EEHDKENSDTLDKVSRYYNSNNKRSPNNTG---LVRRPSLLRK 226

Query: 278 SYTEFEDTEEYNLPISGNXXXXXXXXXXXXXXXXXEITDELTKVSNNAGLTDSDAITLAR 337
           SYTEF++ ++ ++    +                 +IT+ELT++SN AGLT++DA+TLAR
Sbjct: 227 SYTEFDEVKDSDIKEQSSTNNNVDSTPHNKKFTLKDITEELTRISNKAGLTNNDAVTLAR 286

Query: 338 TLSMASTFYEGSNSEKENQSNTE-------KAEEDEFASNM-LNQNSLAIPARSSLRRSK 389
           TLSMAS   E    + + +   E       +  +D +AS M L  +SL     S+L+RSK
Sbjct: 287 TLSMASVAEEDETDDLQERPEAEDDYARQSRNNDDNYASTMLLPTDSLIKSEHSTLKRSK 346

Query: 390 FNTYRIRTPSGSSTNEFAQSNLKVSSTEENPQPEIEVAVEETLPRVLEEHILNSPSTIND 449
           + TY IR                   T+E+  P I V+ E     V+E     SP +IN 
Sbjct: 347 Y-TYHIR-------------------TQEDKDPTIPVSTESQHQDVIEA----SPGSIN- 381

Query: 450 MQDIYDHY-----DTSSVEESLPPQNSNYSSAQQDGDNLQXXXXXXXXXXXXXTANAILK 504
             DIYDHY     D SS+ + + P+N N      D D+               T +  L 
Sbjct: 382 --DIYDHYREPSGDWSSLIQ-VAPENENKKRTDTDIDS-------NTKIVQHSTEHVDLG 431

Query: 505 SKQSIVQTKSDSIQKEFLSPVTESTTADVKRQKKKGGWSWFNKKSKKEPEEDNLKQSEQH 564
           S       KSD  +KE   P           +KK+ GW W +K S+K     N+  S++H
Sbjct: 432 STGHSTSDKSDINKKE---PA---------HRKKRNGWLWSSKTSEKV----NV-TSDKH 474

Query: 565 THRDSSDFFNVLSPSNGTSKHNLPSNRINHSRNRH 599
            + D                  +P +R NHS+NRH
Sbjct: 475 ENEDI-----------------VPESRFNHSKNRH 492

 Score = 68.6 bits (166), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 35/38 (92%)

Query: 38 SEVLIAAQSLDNELQNVKNLKRLSIGSMDLLMDPEMEF 75
          SEV IAAQSLD EL++VKNLKRLSIGSMDLLMDPEM+ 
Sbjct: 6  SEVYIAAQSLDKELRSVKNLKRLSIGSMDLLMDPEMDM 43

>KAFR0B03860 Chr2 complement(798642..801173) [2532 bp, 843 aa] {ON}
           Anc_8.831 YMR273C
          Length = 843

 Score =  166 bits (421), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 92/111 (82%), Gaps = 2/111 (1%)

Query: 794 SLKPPASPTNDPHR--LPPRKLVFEDVKRPEYPNAPMKFTDSAFGFPLPPLTVSTVIMFD 851
           S++ P +  N  H+  LPPRKL F+DVK+PE  N PM++TDSAFGFPLP LTVSTVIM+D
Sbjct: 700 SIQKPTNMANYQHKSILPPRKLTFDDVKKPEKVNGPMQYTDSAFGFPLPLLTVSTVIMYD 759

Query: 852 HRLPINVERAIYRLSHLKLSDPKRELRQQVLLSNFMYAYLNLVNHSLYLQQ 902
            RL  NVERAIYRLSHLKL + KR LR+QVL+SNFMYAYLNLVNH+L+++Q
Sbjct: 760 CRLATNVERAIYRLSHLKLGNRKRPLREQVLVSNFMYAYLNLVNHTLFMEQ 810

 Score =  130 bits (327), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 111/360 (30%), Positives = 161/360 (44%), Gaps = 42/360 (11%)

Query: 33  KEKRKSEVLIAAQSLDNELQNVKNLKRLSIGSMDLLMDPEMEFRINXXXXXXXXXXXXXX 92
           KE+R S + +AAQSL +E+QNV +LKRLS+GS+D+L D ++EF  N              
Sbjct: 8   KEQRNSRIYLAAQSLGHEVQNVNHLKRLSVGSIDMLTDTDVEFSFNKLQRNISAKKT--- 64

Query: 93  XXXNDKEGYAXXXXXXXXXXXXXMDITKTEYLHDNSNDDYGEYNRGNRTGSVGVSEDAWK 152
                +E  +               + +  Y  D++ D   E  +  R  S+  + D   
Sbjct: 65  -----QEILSQKRTSTETESVSYNTLLEGFYGSDDAED---ESEKTTRNTSISETRDKSP 116

Query: 153 TTLEIADGTSPRRALSGTGSVRRGGVLSNRSRLSGGKLNDPNDEEALTQNLLWVPANQHP 212
           +         P RA       R+ G +S  SR +        D+E +++ LLWV A+ HP
Sbjct: 117 SV--------PARARG-----RKVGAVSRSSRTANLGKKGGYDKE-ISKGLLWVSADVHP 162

Query: 213 SVKPENYLELVQDTLQNLQLENGVRDESNKENTVKLIHGLNSNVSQLPIQQGKNSLVRRP 272
           +VKPENY+ELVQDTL+     +    E   E+   L+    +  S        +SLVR+P
Sbjct: 163 NVKPENYIELVQDTLEQYNSSDYSISERLPEDKQVLLSAFRAKKS--------HSLVRKP 214

Query: 273 SRLRKSYTEFEDTEEYNLPISGNXXXX------XXXXXXXXXXXXXEITDELTKVSNNAG 326
           S+LRKSY   E     N P   N                       E+++EL K+S++AG
Sbjct: 215 SKLRKSYISIESN---NTPAENNDANAHRKPLGSSRDPVVSTISLKELSEELAKISSSAG 271

Query: 327 LTDSDAITLARTLSMASTFYEGSNSEKENQSNTEKAEEDEFASNMLNQNSLAIPARSSLR 386
           LT  DAITLA TL +  +     N      S       + FA++      L IP RS LR
Sbjct: 272 LTKDDAITLATTLWLTHSLLHSDNVTTIKSSQDIDGYINSFATSFSRSGPLEIPKRSVLR 331

>TBLA0B03200 Chr2 complement(743165..746425) [3261 bp, 1086 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1086

 Score =  164 bits (415), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 77/109 (70%), Positives = 89/109 (81%), Gaps = 5/109 (4%)

Query: 801  PTNDPHRLPPRKLVFEDVKRPEYPNAPMKFTDSAFGFPLPPLTVSTVIMFDHRLPINVER 860
            PT+ PH     KL F DVKR + PN  M FTDSAFGFPLP LT STVIMFD+RLPI+VER
Sbjct: 964  PTDIPH-----KLSFSDVKRLDKPNGTMIFTDSAFGFPLPLLTNSTVIMFDYRLPISVER 1018

Query: 861  AIYRLSHLKLSDPKRELRQQVLLSNFMYAYLNLVNHSLYLQQVEEENSM 909
            AIYRLSHLKLS+PKR LRQQVLLSNFMYAYL+LVNH+LY+++  + + M
Sbjct: 1019 AIYRLSHLKLSEPKRTLRQQVLLSNFMYAYLHLVNHTLYMEKYAKSHDM 1067

 Score =  119 bits (299), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 97/291 (33%), Positives = 146/291 (50%), Gaps = 57/291 (19%)

Query: 160 GTSPRRALSGTGSVRRGGVLSNRSRL----SGGKLNDPNDEE--ALTQNLLWVPANQHPS 213
            TS RR  S +     G +  N+S +    +   L+D  D E   +++NLLWVPA+QHP+
Sbjct: 110 NTSLRRGQSTSKVSYNGRISYNKSSMPKQHTHQTLDDDIDNENVPISKNLLWVPASQHPN 169

Query: 214 VKPENYLELVQDTLQNLQLENGVRDESNKENTVKLIHGLNSNVSQLPIQQGKNSLVRRPS 273
            KP+N   + QD+L    L NG+  +SN +  +     L  N S L  ++  NSLVR+PS
Sbjct: 170 AKPKN---INQDSL----LNNGLVQDSNSD--LDTQEELQRNKSYLNSRRKNNSLVRKPS 220

Query: 274 RLRKSYTEF-EDTEEYNLPISGNXXXXXXXXX----------------XXXXXXXXEITD 316
            LRKSYT+F +D  +YN     N                                 +I +
Sbjct: 221 TLRKSYTDFTDDDSDYNRSREANTSNNSRNTSDNEMNNLKASHGNSPSADSTFSLNDIKE 280

Query: 317 ELTKVSNNAGLTDSDAITLARTLSMASTFYEGSNSEKENQSNTEKAE----------ED- 365
           EL+K+SN+AGLT+++A TLAR+LS+   +      E++++++T              ED 
Sbjct: 281 ELSKISNSAGLTETNAATLARSLSITGKYINRELLEEDDEASTSDDNNDANDINTSIEDK 340

Query: 366 --------------EFASNMLNQNSLAIPARSSLRRSKFNTYRIRTPSGSS 402
                         EFAS++L   ++ +P RSSLRR KFNTYR+R+ S +S
Sbjct: 341 STLKQIPDLNEVDGEFASHILLTKNVNVPVRSSLRRKKFNTYRVRSSSTTS 391

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 41/52 (78%), Gaps = 4/52 (7%)

Query: 27 RNSPTSKEKRKSEVLIAAQSLDNELQNVKNLKRLSIGSMDLLMDPEMEFRIN 78
          RNSP     R+ E+LIAAQ+LD E+Q+VK LKR SIGS DL+ DPE+EFR+N
Sbjct: 31 RNSP----PREDELLIAAQTLDFEVQSVKELKRFSIGSNDLVGDPELEFRVN 78

>TBLA0D03190 Chr4 complement(776722..781770) [5049 bp, 1682 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1682

 Score =  163 bits (413), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 84/96 (87%)

Query: 812  KLVFEDVKRPEYPNAPMKFTDSAFGFPLPPLTVSTVIMFDHRLPINVERAIYRLSHLKLS 871
            KL F DVKR   PN+ M F +SAFGFPLPPLT ST+IM D+RLPINVERAIYRLSHLKLS
Sbjct: 1430 KLTFADVKRNLQPNSSMIFQESAFGFPLPPLTNSTIIMIDNRLPINVERAIYRLSHLKLS 1489

Query: 872  DPKRELRQQVLLSNFMYAYLNLVNHSLYLQQVEEEN 907
            DPKRELR+QVLLSNFMY+YL+LVNH+LYL+QV + N
Sbjct: 1490 DPKRELREQVLLSNFMYSYLHLVNHTLYLEQVTQGN 1525

 Score = 85.9 bits (211), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 82/258 (31%), Positives = 117/258 (45%), Gaps = 60/258 (23%)

Query: 203 LLWVPANQHPSVKPENYLELVQDTLQNLQLENGVRDESNKENTVKLIHGLNSNVSQLP-- 260
           L W   N+  S+KP+NY+ELV D + +    N V   +N   T   I   +S    +P  
Sbjct: 368 LSWSSVNKRSSLKPDNYIELVNDAINS---SNNVSVTTNSTPTANKIEQGDSYYDNIPDS 424

Query: 261 --IQQGKNSLVRRPSRLRKSYTEFE----DTEEYNLPISG-------------------- 294
             ++  +NS VRRPS LR SYT+ +    D E+ NL IS                     
Sbjct: 425 RKVKYRRNSNVRRPSSLRNSYTDLDFNLADYED-NLNISNVSNSIDEVSNNDHQLTPDDS 483

Query: 295 -NXXXXXXXXXXXXXXXXXEITDELTKVSNNAGLTDSDAITLARTLSMASTFYEGSNSE- 352
            N                 ++TDELTK+SNNAGLTDSDAITLA+TLS+     + + +  
Sbjct: 484 FNFDANVTNNSVASNLTLKDLTDELTKLSNNAGLTDSDAITLAKTLSLNERLLDNTTTVN 543

Query: 353 --------KENQSNT-----------------EKAEED-EFASNMLNQNSLAIPARSSLR 386
                   K N+ N                  E  E+D E+ASN+   +++ I  RS+L+
Sbjct: 544 SNTNVKRYKSNKINLFNEDNINNIPNNMNQDEEIVEDDKEYASNLNYDDNINISNRSTLK 603

Query: 387 RSKFNTYRIRTPSGSSTN 404
           R+KF +   R  S   +N
Sbjct: 604 RNKFKSATSRGNSSEESN 621

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 41/54 (75%)

Query: 24 SKIRNSPTSKEKRKSEVLIAAQSLDNELQNVKNLKRLSIGSMDLLMDPEMEFRI 77
          S+ R S   ++KR S+V IAAQSLD ++QNVK LKR SIGS+DLL DP++E  +
Sbjct: 23 SQNRKSLLDRQKRNSDVRIAAQSLDLQVQNVKKLKRQSIGSIDLLADPDLELVV 76

>TPHA0C04720 Chr3 complement(1017585..1020803) [3219 bp, 1072 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1072

 Score =  153 bits (386), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 70/95 (73%), Positives = 79/95 (83%)

Query: 808  LPPRKLVFEDVKRPEYPNAPMKFTDSAFGFPLPPLTVSTVIMFDHRLPINVERAIYRLSH 867
            LP RKL F DV      N P++F DS FGFPLP LT ST+IMF++RLPI+VERAIYRLSH
Sbjct: 938  LPLRKLTFADVPPTGRANGPVQFMDSTFGFPLPLLTRSTIIMFENRLPISVERAIYRLSH 997

Query: 868  LKLSDPKRELRQQVLLSNFMYAYLNLVNHSLYLQQ 902
            LKL D K+ELRQQVLLSNFMYAYL+LVNHSLYL+Q
Sbjct: 998  LKLGDTKKELRQQVLLSNFMYAYLHLVNHSLYLEQ 1032

 Score = 84.0 bits (206), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 99/353 (28%), Positives = 149/353 (42%), Gaps = 112/353 (31%)

Query: 200 TQNLLWVPANQHPSVKPENYLELVQDTLQNLQLENGVRDESNKENTVKLIHGLNSNVSQL 259
           T  + WV A+QHP+V P   L  V   L+NL +E+    +  K++ + + +         
Sbjct: 145 TNAVKWVRADQHPNVSPSKQLNEV---LENLHIED---KQVTKKDRLSITY--------- 189

Query: 260 PIQQGKNSLVRRPSRLRKS--------------YTEFEDT------------EEYNLPIS 293
             ++ K+S+VRRPS+LR S              +T+  DT            ++ ++ I+
Sbjct: 190 --KKNKSSIVRRPSKLRHSSNDESFDSDIEDPSFTKDHDTFSFENESSFSTNDQTDISIT 247

Query: 294 --GNXXXXXXXXXXXXXXXXXEITDELTKVSNNAGLTDSDAITLARTLSMAST------- 344
              +                  ITDELT++SN+AGL DSDAI LA++L + S+       
Sbjct: 248 RFDSRDTINSNGNSNHRLSLKNITDELTRISNDAGLVDSDAINLAQSLGLTSSYQNNIND 307

Query: 345 FYEGSN-----SEKENQSNTEKAEEDEFASNMLNQNS---------LAIPARSSLRRSKF 390
           FY+  N     S     SN E   E +   N+ ++NS         + +P RSSLRRSKF
Sbjct: 308 FYDDKNLAIYDSTINESSNMETFNEQDKILNLNSENSKGGTFAVNGMKVPMRSSLRRSKF 367

Query: 391 NTYRIRTPSGSSTNEFAQSNLKVSSTEENPQ-------------PEIEVAV--------- 428
           NTYR       S N    S++      ENP               EI+VA+         
Sbjct: 368 NTYRY------SRNNQKDSDIPEKKEIENPYMGSQHISEEKSDVTEIQVALSNNQNALVS 421

Query: 429 --------------EETLPRVLEEHI----LNSPSTINDMQDIYDHYDTSSVE 463
                         ++ L + +EE       +  S ++D QDIYDHY   S E
Sbjct: 422 PERNNDKISFKDSQKDYLTKPIEEKADADEQSGSSPVSDFQDIYDHYRQPSSE 474

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 36/47 (76%)

Query: 31 TSKEKRKSEVLIAAQSLDNELQNVKNLKRLSIGSMDLLMDPEMEFRI 77
          T+ E R   +L A Q LD E++NV +LKR SIGSMD+L+DPE+E+RI
Sbjct: 9  TNIESRNPAMLKAVQYLDREIKNVNHLKRFSIGSMDMLIDPELEYRI 55

 Score = 32.3 bits (72), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 9/18 (50%), Positives = 14/18 (77%)

Query: 534 KRQKKKGGWSWFNKKSKK 551
           K   ++GGW+WFN K+K+
Sbjct: 611 KHHYRRGGWAWFNNKTKE 628

>Skud_14.8 Chr14 (9768..9905,9909..9914,9918..9926,9930..9998) [222
           bp, 74 aa] {ON} YMR273C (REAL)
          Length = 74

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 36/74 (48%), Gaps = 2/74 (2%)

Query: 270 RRPSRLRKSYTEFEDTEEYNLPISGNXXXXXXXXXXXXXXXXXEITDEL--TKVSNNAGL 327
           RR S LR SYTEF+D E+ N   + +                 E  + L   K+SN+A L
Sbjct: 1   RRSSTLRSSYTEFDDIEDENGQRNKDSKFVNKVEERTSRIRENECHETLKNKKISNSASL 60

Query: 328 TDSDAITLARTLSM 341
           TD   I L RTLS+
Sbjct: 61  TDIGVIALVRTLSI 74

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.125    0.342 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 99,098,219
Number of extensions: 4466845
Number of successful extensions: 19713
Number of sequences better than 10.0: 247
Number of HSP's gapped: 20528
Number of HSP's successfully gapped: 323
Length of query: 942
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 823
Effective length of database: 39,836,145
Effective search space: 32785147335
Effective search space used: 32785147335
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 71 (32.0 bits)