Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0D01562g8.836ON2182189151e-126
Kwal_27.102868.836ON295431055e-05
KLTH0C03960g8.836ON222431028e-05
Skud_13.288.836ON242131910.002
Suva_13.318.836ON25199880.006
Smik_13.218.836ON242102860.011
TBLA0B032308.836ON32297870.011
YML113W (DAT1)8.836ON24894830.024
NCAS0B003308.836ON199125810.035
Kpol_541.148.836ON29035780.14
KAFR0A028108.836ON196103760.17
KLLA0D01837g8.836ON25638770.18
Ecym_46078.836ON19441720.49
TDEL0B006108.836ON21534720.66
NDAI0G053501.250ON437103720.74
NDAI0E003108.836ON28515720.77
CAGL0B02277g8.836ON23034710.80
TPHA0C047708.836ON31415710.96
ZYRO0G14102g8.836ON24018673.0
Kthe_YGOB_Kwal_33.14517na 1ON84772674.2
KLLA0C05588g6.107ON518100656.6
Smik_4.6205.411ON31973646.7
Kpol_1045.397.392ON25371639.3
NOTE: 1 genes in the same pillar as SAKL0D01562g were not hit in these BLAST results
LIST: KNAG0G03400

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0D01562g
         (218 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0D01562g Chr4 (126163..126819) [657 bp, 218 aa] {ON} some si...   357   e-126
Kwal_27.10286 s27 (275677..276564) [888 bp, 295 aa] {ON} YML113W...    45   5e-05
KLTH0C03960g Chr3 (346440..347108) [669 bp, 222 aa] {ON} weakly ...    44   8e-05
Skud_13.28 Chr13 (43675..44403) [729 bp, 242 aa] {ON} YML113W (R...    40   0.002
Suva_13.31 Chr13 (43793..44548) [756 bp, 251 aa] {ON} YML113W (R...    39   0.006
Smik_13.21 Chr13 (40315..41043) [729 bp, 242 aa] {ON} YML113W (R...    38   0.011
TBLA0B03230 Chr2 complement(752972..753940) [969 bp, 322 aa] {ON...    38   0.011
YML113W Chr13 (44045..44791) [747 bp, 248 aa] {ON}  DAT1DNA bind...    37   0.024
NCAS0B00330 Chr2 (41882..42481) [600 bp, 199 aa] {ON} Anc_8.836 ...    36   0.035
Kpol_541.14 s541 complement(38346..39218) [873 bp, 290 aa] {ON} ...    35   0.14 
KAFR0A02810 Chr1 complement(584061..584651) [591 bp, 196 aa] {ON...    34   0.17 
KLLA0D01837g Chr4 complement(160236..161006) [771 bp, 256 aa] {O...    34   0.18 
Ecym_4607 Chr4 complement(1184220..1184804) [585 bp, 194 aa] {ON...    32   0.49 
TDEL0B00610 Chr2 (117113..117760) [648 bp, 215 aa] {ON}                32   0.66 
NDAI0G05350 Chr7 complement(1304235..1305548) [1314 bp, 437 aa] ...    32   0.74 
NDAI0E00310 Chr5 (45261..46118) [858 bp, 285 aa] {ON}                  32   0.77 
CAGL0B02277g Chr2 complement(216053..216745) [693 bp, 230 aa] {O...    32   0.80 
TPHA0C04770 Chr3 complement(1029507..1030451) [945 bp, 314 aa] {...    32   0.96 
ZYRO0G14102g Chr7 complement(1123672..1124394) [723 bp, 240 aa] ...    30   3.0  
Kthe_YGOB_Kwal_33.14517 Chr2 complement(532859..535402) [2544 bp...    30   4.2  
KLLA0C05588g Chr3 (500622..502178) [1557 bp, 518 aa] {ON} simila...    30   6.6  
Smik_4.620 Chr4 (1109756..1110715) [960 bp, 319 aa] {ON} YDR353W...    29   6.7  
Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON...    29   9.3  

>SAKL0D01562g Chr4 (126163..126819) [657 bp, 218 aa] {ON} some
           similarities with uniprot|P13483 Saccharomyces
           cerevisiae YML113W DAT1 DNA binding protein that
           recognizes oligo(dA).oligo(dT) tracts Arg side chain in
           its N-terminal pentad Gly-Arg-Lys-Pro-Gly repeat is
           required for DNA-binding
          Length = 218

 Score =  357 bits (915), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 189/218 (86%), Positives = 189/218 (86%)

Query: 1   MAKTLAQXXXXXXXXXXXXXXTLAEGRKVGSGRKPGSKLKVKKPSAEAPVKIKTTAIDSN 60
           MAKTLAQ              TLAEGRKVGSGRKPGSKLKVKKPSAEAPVKIKTTAIDSN
Sbjct: 1   MAKTLAQGRKPGSGRKPGKAKTLAEGRKVGSGRKPGSKLKVKKPSAEAPVKIKTTAIDSN 60

Query: 61  SNHLLDQILEAASFTMDSKLSTGNAKPLALKSILNQEEALKSSGDVEAINALRELNRSPS 120
           SNHLLDQILEAASFTMDSKLSTGNAKPLALKSILNQEEALKSSGDVEAINALRELNRSPS
Sbjct: 61  SNHLLDQILEAASFTMDSKLSTGNAKPLALKSILNQEEALKSSGDVEAINALRELNRSPS 120

Query: 121 PSIALLHSISPNTSLSSQQAPMDQSLPVSITPSVNLLSALRTAKSTSVTTMPVIPKSSKS 180
           PSIALLHSISPNTSLSSQQAPMDQSLPVSITPSVNLLSALRTAKSTSVTTMPVIPKSSKS
Sbjct: 121 PSIALLHSISPNTSLSSQQAPMDQSLPVSITPSVNLLSALRTAKSTSVTTMPVIPKSSKS 180

Query: 181 TLIPXXXXXXXXXXXXXXXQTMSYHGDTSSMSSKNGNI 218
           TLIP               QTMSYHGDTSSMSSKNGNI
Sbjct: 181 TLIPSSSSSSSSSSSSSSSQTMSYHGDTSSMSSKNGNI 218

>Kwal_27.10286 s27 (275677..276564) [888 bp, 295 aa] {ON} YML113W
          (DAT1) - datin, an oligo(dA).oligo(dT)-binding protein
          [contig 37] FULL
          Length = 295

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/43 (55%), Positives = 26/43 (60%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLAEGRKVGSGRKPGSKLKVKK 43
          MAKTLAQ              TLA+GRK GSGRKPGSK +V K
Sbjct: 1  MAKTLAQGRKPGSGRKPGKGKTLAQGRKPGSGRKPGSKGQVSK 43

>KLTH0C03960g Chr3 (346440..347108) [669 bp, 222 aa] {ON} weakly
          similar to uniprot|P13483 Saccharomyces cerevisiae
          YML113W DAT1 DNA binding protein that recognizes
          oligo(dA).oligo(dT) tracts
          Length = 222

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/43 (55%), Positives = 26/43 (60%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLAEGRKVGSGRKPGSKLKVKK 43
          MAKTLAQ              TLA+GRK GSGRKPGSK +V K
Sbjct: 1  MAKTLAQGRKPGSGRKPGKGKTLAQGRKPGSGRKPGSKGQVTK 43

>Skud_13.28 Chr13 (43675..44403) [729 bp, 242 aa] {ON} YML113W
           (REAL)
          Length = 242

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 57/131 (43%), Gaps = 35/131 (26%)

Query: 22  TLAEGRKVGSGRKPGSKLKVKKPSAEAPVKIKTTAIDSNSNHLLDQILEAASFTMDSKLS 81
           TLA+GRK GSGRKPG    +++       + +   I            + A  T+     
Sbjct: 4   TLAQGRKPGSGRKPGKGKTLREGRKPGSGRRRRQDIGG----------KDADITLQ---- 49

Query: 82  TGNAKPLALKSILNQEEALKSSGDVEAINALRELNRSPSPSIALLHSISPNTSL------ 135
                        +QE    SS D+EA++ALREL  SPS   A  H+ +P T+       
Sbjct: 50  -------------DQESRPISSRDMEAVDALRELTHSPSSHPA--HNSAPVTAALPPSMD 94

Query: 136 SSQQAPMDQSL 146
            + Q+ MDQ L
Sbjct: 95  YTHQSLMDQQL 105

>Suva_13.31 Chr13 (43793..44548) [756 bp, 251 aa] {ON} YML113W
           (REAL)
          Length = 251

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 41/99 (41%), Gaps = 27/99 (27%)

Query: 22  TLAEGRKVGSGRKPGSKLKVKKPSAEAPVKIKTTAIDSNSNHLLDQILEAASFTMDSKLS 81
           TLA+GRK GSGRKPG    +++       + +   I      +  Q              
Sbjct: 4   TLAQGRKPGSGRKPGKGKTLREGRKPGSGRRRRQDIGGRDADVSQQ-------------- 49

Query: 82  TGNAKPLALKSILNQEEALKSSGDVEAINALRELNRSPS 120
                        +QE    SS D+EA++ALREL  SPS
Sbjct: 50  -------------DQESRPISSRDMEAVDALRELTHSPS 75

>Smik_13.21 Chr13 (40315..41043) [729 bp, 242 aa] {ON} YML113W
           (REAL)
          Length = 242

 Score = 37.7 bits (86), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 42/102 (41%), Gaps = 33/102 (32%)

Query: 22  TLAEGRKVGSGRKPGSK---LKVKKPSAEAPVKIKTTAIDSNSNHLLDQILEAASFTMDS 78
           TLA+GRK GSGRKPG      + +KP +    +      D++                  
Sbjct: 4   TLAQGRKPGSGRKPGKGKTLREGRKPGSGRRRRQDIAGKDTDGTQ--------------- 48

Query: 79  KLSTGNAKPLALKSILNQEEALKSSGDVEAINALRELNRSPS 120
                           +QE    SS D+EA++ALREL  SPS
Sbjct: 49  ---------------QDQESRSISSRDMEAVDALRELTHSPS 75

>TBLA0B03230 Chr2 complement(752972..753940) [969 bp, 322 aa] {ON}
           Anc_8.836 YML113W
          Length = 322

 Score = 38.1 bits (87), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 46/97 (47%), Gaps = 14/97 (14%)

Query: 22  TLAEGRKVGSGRKPGSKLKVKKPSAEAPVKIKTTAIDSNSNHLLDQILEAASFTMDSKLS 81
           TLA+GRK GSGRKPG    +++       + +     SN NHL+         + D+  S
Sbjct: 4   TLAQGRKPGSGRKPGKGKTLREGRKPGSGRKRRDGNISNENHLI--------HSNDTVTS 55

Query: 82  TGNAKPLALKSILNQEEALKSSGDVEAINALRELNRS 118
           T N+      S    E+      D+EA+ AL  LN+S
Sbjct: 56  TVNSSRNGSVSNAFTEQ------DLEALQALNSLNKS 86

>YML113W Chr13 (44045..44791) [747 bp, 248 aa] {ON}  DAT1DNA binding
           protein that recognizes oligo(dA).oligo(dT) tracts; Arg
           side chain in its N-terminal pentad Gly-Arg-Lys-Pro-Gly
           repeat is required for DNA-binding; not essential for
           viability
          Length = 248

 Score = 36.6 bits (83), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 43/94 (45%), Gaps = 27/94 (28%)

Query: 22  TLAEGRKVGSGRKPGSKLKVKKPSAEAPVKIKTTAIDSNSNHLLDQILEAASFTMDSKLS 81
           TLA+GRK GSGRKPG    +++     P   +    D+                   K +
Sbjct: 4   TLAQGRKPGSGRKPGKGKTLRE--GRKPGSGRRRRQDTGG-----------------KET 44

Query: 82  TGNAKPLALKSILNQEEALKSSGDVEAINALREL 115
            G+ +        +QE  L SS D+EA++ALREL
Sbjct: 45  DGSQQ--------DQESRLISSRDMEAVDALREL 70

>NCAS0B00330 Chr2 (41882..42481) [600 bp, 199 aa] {ON} Anc_8.836
           YML113W
          Length = 199

 Score = 35.8 bits (81), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 53/125 (42%), Gaps = 29/125 (23%)

Query: 1   MAKTLAQXXXXXXXXXXXXXXTLAEGRKVGSGRKPGSKLKVKKPSAEAPVKIKTTAIDSN 60
           MAKTLAQ              TL EGRK GSGR      K ++P+     ++++ A    
Sbjct: 1   MAKTLAQGRKPGSGRKPGKAKTLREGRKPGSGR------KRREPALNNHTQLQSEAQIGT 54

Query: 61  SNHLLDQILEAASFTMDSKLSTGNAKPLALKSILNQEEALKSSGDVEAINALRELNRSPS 120
           +  L D + ++ +  ++  L                        D+EA++ALR L  SP 
Sbjct: 55  NKTLNDNLTKSPTNELNFTLR-----------------------DMEAVDALRGLTHSPH 91

Query: 121 PSIAL 125
            S++L
Sbjct: 92  LSLSL 96

>Kpol_541.14 s541 complement(38346..39218) [873 bp, 290 aa] {ON}
          complement(38346..39218) [873 nt, 291 aa]
          Length = 290

 Score = 34.7 bits (78), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 19/35 (54%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLAEGRKVGSGRKP 35
          MAKTLAQ              TL EGRK GSGR+P
Sbjct: 1  MAKTLAQGRKPGSGRKPGKGKTLREGRKPGSGRRP 35

>KAFR0A02810 Chr1 complement(584061..584651) [591 bp, 196 aa] {ON}
           Anc_8.836 YML113W
          Length = 196

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 47/103 (45%), Gaps = 27/103 (26%)

Query: 22  TLAEGRKVGSGRKPGSKLKVK---KPSAEAPVKIKTTAIDSNS--NHLLDQILEAASFTM 76
           TLA+GRK GSGRKPG    +K   KP +    +  + +I S +   H   +  E  S T 
Sbjct: 4   TLAQGRKPGSGRKPGKAKTLKEGRKPGSGRRKRAVSASIASLAIPPHTGARTRE-ESNTY 62

Query: 77  DSKLSTGNAKPLALKSILNQEEALKSSGDVEAINALRELNRSP 119
           D  +                     +S D+EAI+ALREL  SP
Sbjct: 63  DHPI---------------------TSRDLEAIDALRELTHSP 84

>KLLA0D01837g Chr4 complement(160236..161006) [771 bp, 256 aa]
          {ON} similar to uniprot|P13483 Saccharomyces cerevisiae
          YML113W DAT1 DNA binding protein that recognizes
          oligo(dA). oligo(dT) tracts; Arg side chain in its N-
          terminal pentad Gly-Arg-Lys-Pro-Gly repeat is required
          for DNA-binding; not essential for viability
          Length = 256

 Score = 34.3 bits (77), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 20/38 (52%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLAEGRKVGSGRKPGSK 38
          MAK L+               TLAEGRK GSGRK GSK
Sbjct: 1  MAKKLSDGRKPGSGRKPGRAKTLAEGRKPGSGRKKGSK 38

>Ecym_4607 Chr4 complement(1184220..1184804) [585 bp, 194 aa] {ON}
          similar to Saccharomyces cerevisiae YML113W DAT1
          Length = 194

 Score = 32.3 bits (72), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 26/41 (63%), Gaps = 6/41 (14%)

Query: 22 TLAEGRKVGSGRKPGSK---LKVKKPSAEAPVKIKTTAIDS 59
          TLA+GRK GSGRKPG     L+ +KP +    + K  AID+
Sbjct: 4  TLAQGRKPGSGRKPGKAKTLLEGRKPGSG---RKKRQAIDA 41

 Score = 32.3 bits (72), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 18/34 (52%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLAEGRKVGSGRK 34
          MAKTLAQ              TL EGRK GSGRK
Sbjct: 1  MAKTLAQGRKPGSGRKPGKAKTLLEGRKPGSGRK 34

>TDEL0B00610 Chr2 (117113..117760) [648 bp, 215 aa] {ON} 
          Length = 215

 Score = 32.3 bits (72), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 18/34 (52%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLAEGRKVGSGRK 34
          MAKTLAQ              TL EGRK GSGR+
Sbjct: 1  MAKTLAQGRKPGSGRKPGKGKTLREGRKPGSGRR 34

 Score = 30.8 bits (68), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 13/15 (86%), Positives = 14/15 (93%)

Query: 22 TLAEGRKVGSGRKPG 36
          TLA+GRK GSGRKPG
Sbjct: 4  TLAQGRKPGSGRKPG 18

>NDAI0G05350 Chr7 complement(1304235..1305548) [1314 bp, 437 aa]
           {ON} Anc_1.250
          Length = 437

 Score = 32.3 bits (72), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 51/103 (49%), Gaps = 11/103 (10%)

Query: 56  AIDSNSNHLL------DQILEAASFTMDSKLSTGNAKPLALKSILNQEEALKSSGDVEAI 109
           ++D  ++HLL      D++ + A      K +TGN    ALK    +E     S +V   
Sbjct: 29  SVDLKASHLLSGTKKSDEMGDFAPKKNGEKFNTGNDGYHALK----KETTSSKSDNVSIR 84

Query: 110 NALRELNRSPSPSIALLHSISPNTSLSSQQAPMDQSLPVSITP 152
           N L   + + +P + ++ SI P+T+  SQQ P+ ++   S TP
Sbjct: 85  NGLPSASSTNTPGLKIITSI-PSTTFKSQQVPICKNCLTSTTP 126

>NDAI0E00310 Chr5 (45261..46118) [858 bp, 285 aa] {ON} 
          Length = 285

 Score = 32.3 bits (72), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 13/15 (86%), Positives = 14/15 (93%)

Query: 22 TLAEGRKVGSGRKPG 36
          TLA+GRK GSGRKPG
Sbjct: 4  TLAQGRKPGSGRKPG 18

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 18/34 (52%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLAEGRKVGSGRK 34
          MAKTLAQ              TL EGRK GSGR+
Sbjct: 1  MAKTLAQGRKPGSGRKPGKGKTLKEGRKPGSGRR 34

>CAGL0B02277g Chr2 complement(216053..216745) [693 bp, 230 aa]
          {ON} some similarities with uniprot|P13483
          Saccharomyces cerevisiae YML113w DAT1
          Length = 230

 Score = 32.0 bits (71), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 18/34 (52%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLAEGRKVGSGRK 34
          MAKTLAQ              TL EGRK GSGR+
Sbjct: 1  MAKTLAQGRKPGSGRKPGKGKTLREGRKPGSGRR 34

>TPHA0C04770 Chr3 complement(1029507..1030451) [945 bp, 314 aa]
          {ON} Anc_8.836 YML113W
          Length = 314

 Score = 32.0 bits (71), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 13/15 (86%), Positives = 14/15 (93%)

Query: 22 TLAEGRKVGSGRKPG 36
          TLA+GRK GSGRKPG
Sbjct: 4  TLAQGRKPGSGRKPG 18

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 18/34 (52%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLAEGRKVGSGRK 34
          MAKTLAQ              TL EGRK GSGR+
Sbjct: 1  MAKTLAQGRKPGSGRKPGKGKTLREGRKPGSGRR 34

>ZYRO0G14102g Chr7 complement(1123672..1124394) [723 bp, 240 aa]
           {ON} some similarities with uniprot|P13483 Saccharomyces
           cerevisiae YML113W
          Length = 240

 Score = 30.4 bits (67), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 14/18 (77%), Positives = 16/18 (88%)

Query: 102 SSGDVEAINALRELNRSP 119
           SS D+EAI+ALRELN SP
Sbjct: 118 SSRDLEAIDALRELNNSP 135

>Kthe_YGOB_Kwal_33.14517 Chr2 complement(532859..535402) [2544 bp,
           847 aa] {ON} ANNOTATED BY YGOB -
          Length = 847

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 36/72 (50%), Gaps = 7/72 (9%)

Query: 97  EEALKSS-GDVEAINALRELNRSPSPS----IALLHSISPNTSLSSQQAPMDQSLPVSIT 151
           EE LK +  D E IN L E    PSPS    + ++ S  PN +L+ QQ    Q++     
Sbjct: 259 EEQLKQALSDTENINVLIET--MPSPSGEALLVVMASFCPNLALAEQQPLKLQAVNARTG 316

Query: 152 PSVNLLSALRTA 163
           P V++L  +  A
Sbjct: 317 PGVHVLELINAA 328

>KLLA0C05588g Chr3 (500622..502178) [1557 bp, 518 aa] {ON} similar
           to uniprot|P53172 Saccharomyces cerevisiae YGL056C SDS23
           Spindle pole body protein and similar to YBR214W
           uniprot|P38314 Saccharomyces cerevisiae YBR214W SDS24
           Nuclear protein with similarity to S. pombe Sds23,
           suppresses dis2 mutations
          Length = 518

 Score = 29.6 bits (65), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 47/100 (47%), Gaps = 11/100 (11%)

Query: 26  GRKVGSGRKPGSKLKVKKPSAEAPVKIKTTAIDSNSNHLLDQILEAASF-TMDSKLSTGN 84
           G   GSG  PG       P+++ P+    +A+D+  +H + +    +SF T  S++ T  
Sbjct: 119 GSGTGSGYVPG-------PNSDVPISPSLSAVDTLHSHSVSRTNSESSFDTQLSRIHTTK 171

Query: 85  AKPLALKSILNQEEALKSSGDV---EAINALRELNRSPSP 121
            + + L  ++ Q + +   G +   EA N L + N +  P
Sbjct: 172 WQLIPLSQLVEQNKLIFIDGSISVEEAFNTLVKYNLTSLP 211

>Smik_4.620 Chr4 (1109756..1110715) [960 bp, 319 aa] {ON} YDR353W
           (REAL)
          Length = 319

 Score = 29.3 bits (64), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 36/73 (49%), Gaps = 7/73 (9%)

Query: 93  ILNQEEALKSSGDVEAINALRELN-----RSPSPSIALLHSI--SPNTSLSSQQAPMDQS 145
           IL    AL++ GD + +NALR  N      +  P   L ++I  SP T + + Q  +D++
Sbjct: 207 ILYNTVALEAKGDGKLLNALRIKNTKKNEETDLPVNGLFYAIGHSPATKIVADQVDVDEA 266

Query: 146 LPVSITPSVNLLS 158
             +   P  +L S
Sbjct: 267 GYIKTVPGSSLTS 279

>Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON}
           complement(92064..92825) [762 nt, 254 aa]
          Length = 253

 Score = 28.9 bits (63), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 36/71 (50%)

Query: 59  SNSNHLLDQILEAASFTMDSKLSTGNAKPLALKSILNQEEALKSSGDVEAINALRELNRS 118
           +N N   D++L       D+  +    KP++L+ IL+ E+ +++   ++AI      N +
Sbjct: 170 NNQNEKEDELLAGTKKQEDAIANAAKEKPISLEEILDPEDRIRAEQTLKAIQEKGNENNN 229

Query: 119 PSPSIALLHSI 129
           P  S + L+ I
Sbjct: 230 PQGSSSTLYII 240

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.304    0.119    0.305 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 17,034,690
Number of extensions: 625128
Number of successful extensions: 2489
Number of sequences better than 10.0: 148
Number of HSP's gapped: 2437
Number of HSP's successfully gapped: 174
Length of query: 218
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 113
Effective length of database: 41,441,469
Effective search space: 4682885997
Effective search space used: 4682885997
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 63 (28.9 bits)