Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0D01540g8.837ON36536516100.0
CAGL0M02937g8.837ON37338711031e-150
KAFR0B039008.837ON37938310791e-146
KLTH0C03938g8.837ON37639010751e-145
TDEL0B006008.837ON36937510501e-142
Kwal_27.102758.837ON37938410511e-142
Skud_13.4488.837ON36437310461e-141
Smik_13.4898.837ON37237710241e-138
NCAS0C004308.837ON36937810131e-136
KLLA0D01859g8.837ON37138910061e-135
YMR276W (DSK2)8.837ON3733869881e-132
Ecym_46088.837ON4064119911e-132
Kpol_1068.118.837ON3813859761e-130
ZYRO0G14124g8.837ON3693789691e-129
Suva_13.4648.837ON3663719511e-127
TPHA0I002208.837ON3773849331e-124
ABL129W8.837ON3453689291e-124
TBLA0D032308.837ON3753788821e-116
KNAG0J002908.837ON3673798391e-110
NDAI0K004408.837ON4042166862e-86
TBLA0B032408.837ON2842191405e-09
Kpol_1036.628.311ON77561261e-08
SAKL0H15818g8.311ON77561182e-07
NCAS0B035208.311ON77561163e-07
TPHA0C008908.311ON77561137e-07
KLTH0G12540g8.311ON77711102e-06
TDEL0G017504.16ON77561102e-06
ZYRO0D05962g8.311ON77561092e-06
NDAI0H002704.16ON77561093e-06
TDEL0F043808.311ON77561084e-06
NDAI0J010708.311ON77561067e-06
Suva_10.32singletonON62561057e-06
KLLA0F17974g8.311ON77561059e-06
KAFR0E005301.480ON379731151e-05
Kwal_YGOB_Anc_5.7015.701ON128561052e-05
Skud_9.205.701ON125561053e-05
Smik_11.3575.701ON125561053e-05
AFR358W1.480ON413891123e-05
ZYRO0G06622g5.701ON128561053e-05
KAFR0D022305.701ON128561053e-05
KAFR0H002205.701ON128561053e-05
Suva_11.3305.701ON128561053e-05
Skud_11.3335.701ON128561053e-05
YIL148W (RPL40A)5.701ON128561053e-05
YKR094C (RPL40B)5.701ON128561053e-05
KLTH0E01078g5.701ON128561053e-05
Smik_9.215.701ON124561053e-05
Kpol_1043.695.701ON128561053e-05
SAKL0E14894g5.701ON128561053e-05
KLLA0A00616g5.701ON128561053e-05
TPHA0E002405.701ON128561053e-05
TPHA0D046005.701ON128561053e-05
TBLA0E021105.701ON128561053e-05
CAGL0G02475g5.701ON128561053e-05
CAGL0L01309g1.480ON392721113e-05
NDAI0E050305.701ON128561043e-05
NCAS0A032105.701ON128561043e-05
NCAS0G002405.701ON128561043e-05
Ecym_40195.701ON128561044e-05
TDEL0B022005.701ON128561044e-05
AFR285C5.701ON128561044e-05
KNAG0L021205.701ON128561044e-05
Suva_9.405.701ON144671044e-05
KNAG0J028804.16ON153561055e-05
TPHA0C023908.386ON150561045e-05
Ecym_84084.16ON153561045e-05
TPHA0K022504.16ON153561045e-05
Suva_10.34singletonON151561046e-05
CAGL0B01589g8.311ON7756996e-05
NCAS0C029408.386ON152561046e-05
Ecym_41818.386ON152561046e-05
Kwal_23.33118.386ON150561037e-05
Kwal_27.101521.480ON381571087e-05
ZYRO0C04026g8.386ON152561037e-05
KLTH0F08734g8.386ON150561037e-05
KLLA0D18304g8.386ON150561029e-05
KAFR0H020008.386ON152561039e-05
AGL128W8.386ON152561029e-05
SAKL0H13926g8.386ON154561029e-05
Kwal_55.206074.16ON231641059e-05
NDAI0G003301.480ON427621079e-05
NDAI0G022808.386ON152561029e-05
Smik_12.184.16ON460631071e-04
TDEL0F051008.386ON150561021e-04
YLR167W (RPS31)8.386ON152561021e-04
TBLA0G006704.16ON229561041e-04
NDAI0D049304.16ON229561041e-04
KAFR0I014704.16ON229561041e-04
KNAG0C065805.701ON149671011e-04
KLTH0E05852g4.16ON409561061e-04
CAGL0G08173g8.386ON152561011e-04
KNAG0A027308.386ON150561011e-04
Kpol_1030.58.386ON152561011e-04
Kpol_1024.168.386ON152561011e-04
Suva_5.321.480ON409711052e-04
YDR139C (RUB1)8.311ON7756962e-04
Suva_10.33singletonON254561042e-04
SAKL0H25784g4.16ON305561052e-04
TBLA0H031808.386ON152561002e-04
SAKL0D11814g1.480ON400711052e-04
YEL037C (RAD23)1.480ON398621052e-04
Ecym_35721.480ON443731052e-04
Skud_12.294.16ON381561052e-04
YLL039C (UBI4)4.16ON381561052e-04
NDAI0F003005.701ON187881012e-04
Suva_10.2668.386ON152561002e-04
Skud_12.2348.386ON152561002e-04
Smik_12.2298.386ON152561002e-04
ACL062C4.16ON382561042e-04
Suva_10.304.16ON381561042e-04
KLLA0E00749g4.16ON381561042e-04
Smik_5.561.480ON397711042e-04
Kpol_1070.64.16ON533561042e-04
NCAS0C058504.16ON388561042e-04
ZYRO0G07854g4.16ON460561042e-04
CAGL0D05082g4.16ON533561042e-04
KAFR0C030008.142ON397491043e-04
Skud_5.531.480ON397711033e-04
KLTH0C03410g1.480ON39157960.002
NCAS0G041201.480ON39262950.003
Ecym_42448.311ON5034820.006
NCAS0B045908.142ON44738920.006
TBLA0D022108.142ON56338930.007
NDAI0B01850singletonON40344910.008
CAGL0L06028g8.142ON50538900.015
Kwal_56.238838.311ON5249780.021
SAKL0H24772g8.142ON41443860.033
TDEL0B046908.142ON44238850.048
Smik_7.918.142ON39938850.051
YGL181W (GTS1)8.142ON39638850.056
AGL185W8.311ON5034730.095
TPHA0O004401.480ON36962820.10
Suva_2.3008.311ON8638760.11
Suva_7.818.142ON40138810.15
NCAS0C040908.142ON39651800.23
Skud_4.3988.311ON9434730.28
Kpol_370.61.480ON40471790.28
KAFR0B056708.311ON5734700.29
KAFR0I027801.480ON21461770.35
Suva_10.31singletonON6436700.43
TBLA0H013108.311ON7134700.45
Smik_4.3838.311ON10034720.47
KLLA0E22133g1.480ON38372760.56
TBLA0B021601.480ON40436750.84
TDEL0C025901.480ON36862750.87
Kwal_47.184335.570ON80049751.1
TBLA0C012001.369ON50347731.5
Skud_7.908.142ON39638731.5
KNAG0G005101.480ON37574721.9
TPHA0H004008.142ON46638722.1
Kpol_541.508.142ON51138722.2
ZYRO0F05192g1.480ON38462703.7
AGR326C5.150ON20269684.3
AAL082W5.299ON20956675.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0D01540g
         (365 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {...   624   0.0  
CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highl...   429   e-150
KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.8...   420   e-146
KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {...   418   e-145
TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {O...   409   e-142
Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {...   409   e-142
Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276...   407   e-141
Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276...   399   e-138
NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}...   394   e-136
KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} simila...   392   e-135
YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}  DSK2Nucle...   385   e-132
Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar...   386   e-132
Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {O...   380   e-130
ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} simi...   377   e-129
Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276...   370   e-127
TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837...   363   e-124
ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic ho...   362   e-124
TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {O...   344   e-116
KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON...   327   e-110
NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {O...   268   2e-86
TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.83...    59   5e-09
Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [23...    53   1e-08
SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 7...    50   2e-07
NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234 ...    49   3e-07
TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]...    48   7e-07
KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 7...    47   2e-06
TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16 ...    47   2e-06
ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa...    47   2e-06
NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON} A...    47   3e-06
TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234 ...    46   4e-06
NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa...    45   7e-06
Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON} Y...    45   7e-06
KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 7...    45   9e-06
KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa] {O...    49   1e-05
Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128...    45   2e-05
Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C (REAL)     45   3e-05
Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa] {O...    45   3e-05
AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic ...    48   3e-05
ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128 a...    45   3e-05
KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa...    45   3e-05
KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa] {O...    45   3e-05
Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387...    45   3e-05
Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387...    45   3e-05
YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}  ...    45   3e-05
YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,...    45   3e-05
KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128 a...    45   3e-05
Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C (REAL)     45   3e-05
Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa] {...    45   3e-05
SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212) ...    45   3e-05
KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa] {...    45   3e-05
TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa] {O...    45   3e-05
TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083) [...    45   3e-05
TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387 ...    45   3e-05
CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387...    45   3e-05
CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa] ...    47   3e-05
NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634) [...    45   3e-05
NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa...    45   3e-05
NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa] {O...    45   3e-05
Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}...    45   4e-05
TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa...    45   4e-05
AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp, ...    45   4e-05
KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387...    45   4e-05
Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W (REAL)     45   4e-05
KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.1...    45   5e-05
TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON...    45   5e-05
Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to...    45   5e-05
TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.1...    45   5e-05
Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON} ...    45   6e-05
CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa...    43   6e-05
NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON...    45   6e-05
Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON} ...    45   6e-05
Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON...    44   7e-05
Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa] {...    46   7e-05
ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar...    44   7e-05
KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa] {O...    44   7e-05
KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON} simil...    44   9e-05
KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON...    44   9e-05
AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic hom...    44   9e-05
SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa] ...    44   9e-05
Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa] {O...    45   9e-05
NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}...    46   9e-05
NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON...    44   9e-05
Smik_12.18 Chr12 complement(49088..49552,49091..49552,49091..495...    46   1e-04
TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.38...    44   1e-04
YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusio...    44   1e-04
TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16...    45   1e-04
NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON}              45   1e-04
KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.70...    45   1e-04
KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304) [...    44   1e-04
KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {...    45   1e-04
CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly ...    44   1e-04
KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON...    44   1e-04
Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}...    44   1e-04
Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON...    44   1e-04
Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON} Y...    45   2e-04
YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp, ...    42   2e-04
Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON} ...    45   2e-04
SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highl...    45   2e-04
TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.38...    43   2e-04
SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} simila...    45   2e-04
YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}  RA...    45   2e-04
Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa] {O...    45   2e-04
Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,...    45   2e-04
YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}  U...    45   2e-04
NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701        44   2e-04
Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W...    43   2e-04
Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W...    43   2e-04
Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W...    43   2e-04
ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON} S...    45   2e-04
Suva_10.30 Chr10 complement(67747..67841,68061..68288,68558..690...    45   2e-04
KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON...    45   2e-04
Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON} Y...    45   2e-04
Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON...    45   2e-04
NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON}             45   2e-04
ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa] {...    45   2e-04
CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} simila...    45   2e-04
KAFR0C03000 Chr3 (597127..598320) [1194 bp, 397 aa] {ON} Anc_8.1...    45   3e-04
Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON} Y...    44   3e-04
KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa] {...    42   0.002
NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON} Anc_1.4...    41   0.003
Ecym_4244 Chr4 complement(507884..508036) [153 bp, 50 aa] {ON} s...    36   0.006
NCAS0B04590 Chr2 complement(835478..836821) [1344 bp, 447 aa] {O...    40   0.006
TBLA0D02210 Chr4 (555236..556927) [1692 bp, 563 aa] {ON} Anc_8.1...    40   0.007
NDAI0B01850 Chr2 complement(440321..441532) [1212 bp, 403 aa] {O...    40   0.008
CAGL0L06028g Chr12 complement(677581..679098) [1518 bp, 505 aa] ...    39   0.015
Kwal_56.23883 s56 complement(755602..755760) [159 bp, 52 aa] {ON...    35   0.021
SAKL0H24772g Chr8 complement(2155837..2157081) [1245 bp, 414 aa]...    38   0.033
TDEL0B04690 Chr2 (832571..833899) [1329 bp, 442 aa] {ON} Anc_8.1...    37   0.048
Smik_7.91 Chr7 (152642..153637,153905..154108) [1200 bp, 399 aa]...    37   0.051
YGL181W Chr7 (157906..159096) [1191 bp, 396 aa] {ON}  GTS1Protei...    37   0.056
AGL185W Chr7 (350325..350477) [153 bp, 50 aa] {ON} Syntenic homo...    33   0.095
TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.48...    36   0.10 
Suva_2.300 Chr2 complement(528809..528920,529056..529204) [261 b...    34   0.11 
Suva_7.81 Chr7 (153418..154434,154933..155121) [1206 bp, 401 aa]...    36   0.15 
NCAS0C04090 Chr3 (833393..834583) [1191 bp, 396 aa] {ON} Anc_8.142     35   0.23 
Skud_4.398 Chr4 complement(705294..705386,705390..705431,705435....    33   0.28 
Kpol_370.6 s370 (10094..11308) [1215 bp, 404 aa] {ON} (10094..11...    35   0.28 
KAFR0B05670 Chr2 complement(1169417..1169441,1169546..1169694) [...    32   0.29 
KAFR0I02780 Chr9 (560687..561331) [645 bp, 214 aa] {ON} Anc_1.48...    34   0.35 
Suva_10.31 Chr10 complement(68008..68199) [192 bp, 64 aa] {ON} Y...    32   0.43 
TBLA0H01310 Chr8 (293921..294136) [216 bp, 71 aa] {ON} Anc_8.311...    32   0.45 
Smik_4.383 Chr4 complement(694349..694483,694487..694651) [300 b...    32   0.47 
KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]...    34   0.56 
TBLA0B02160 Chr2 complement(496901..498115) [1215 bp, 404 aa] {O...    33   0.84 
TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa] {O...    33   0.87 
Kwal_47.18433 s47 (823782..826184) [2403 bp, 800 aa] {ON} YML029...    33   1.1  
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    33   1.5  
Skud_7.90 Chr7 (163529..164719) [1191 bp, 396 aa] {ON} YGL181W (...    33   1.5  
KNAG0G00510 Chr7 complement(85742..86869) [1128 bp, 375 aa] {ON}...    32   1.9  
TPHA0H00400 Chr8 (77122..78522) [1401 bp, 466 aa] {ON} Anc_8.142...    32   2.1  
Kpol_541.50 s541 complement(162130..163665) [1536 bp, 511 aa] {O...    32   2.2  
ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} simila...    32   3.7  
AGR326C Chr7 complement(1338531..1339139) [609 bp, 202 aa] {ON} ...    31   4.3  
AAL082W Chr1 (202080..202093,202146..202761) [630 bp, 209 aa] {O...    30   5.4  

>SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {ON}
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin- binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 365

 Score =  624 bits (1610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/365 (87%), Positives = 321/365 (87%)

Query: 1   MSITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESY 60
           MSITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESY
Sbjct: 1   MSITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESY 60

Query: 61  KIADDHAVHLVRSGGPKPAASKXXXXXXXXXXXXXXXXXXXXXXXGQTGGFNPLADLTGA 120
           KIADDHAVHLVRSGGPKPAASK                       GQTGGFNPLADLTGA
Sbjct: 61  KIADDHAVHLVRSGGPKPAASKSESTSATDTGAAAAAAVPSNISSGQTGGFNPLADLTGA 120

Query: 121 RYAGYANLPSADMFGPDGGLTNAPNSDEILNMLDNPIVQSQMNEMLSNPQMVDFMIQQNP 180
           RYAGYANLPSADMFGPDGGLTNAPNSDEILNMLDNPIVQSQMNEMLSNPQMVDFMIQQNP
Sbjct: 121 RYAGYANLPSADMFGPDGGLTNAPNSDEILNMLDNPIVQSQMNEMLSNPQMVDFMIQQNP 180

Query: 181 QLQAMGPRARELLQSDYFRQMMTNPDMIRQSMQFARXXXXXXXXXXXXXXXXXXXXXQTA 240
           QLQAMGPRARELLQSDYFRQMMTNPDMIRQSMQFAR                     QTA
Sbjct: 181 QLQAMGPRARELLQSDYFRQMMTNPDMIRQSMQFARMFGMEGAEGAGGAFPAPGTATQTA 240

Query: 241 STEGGPAGTTASPSTTGNGSANSEAANPFASLFNGQANPFASMFPNGRAPQFDPSLLSSF 300
           STEGGPAGTTASPSTTGNGSANSEAANPFASLFNGQANPFASMFPNGRAPQFDPSLLSSF
Sbjct: 241 STEGGPAGTTASPSTTGNGSANSEAANPFASLFNGQANPFASMFPNGRAPQFDPSLLSSF 300

Query: 301 LGGNTAAPGQQQQPQDNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDAL 360
           LGGNTAAPGQQQQPQDNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDAL
Sbjct: 301 LGGNTAAPGQQQQPQDNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDAL 360

Query: 361 LNGDV 365
           LNGDV
Sbjct: 361 LNGDV 365

>CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highly
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276w DSK2
          Length = 373

 Score =  429 bits (1103), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 236/387 (60%), Positives = 270/387 (69%), Gaps = 36/387 (9%)

Query: 1   MSITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESY 60
           MSIT+HIKSGQNKWDVSI+P+ T++ LKE I+KVSEIP  NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSITIHIKSGQNKWDVSIDPSQTILNLKEEIAKVSEIPSGNQRLIYSGKILKDDQTVESY 60

Query: 61  KIADDHAVHLVRSGGPKPAASKXXXXXXXXXXXXXXXXXXXXXXXGQTGGFNPLADLTGA 120
            I DDHA+H+V+SGG   A++                        GQTGGFNPLADLTGA
Sbjct: 61  NIKDDHAIHMVKSGGN--ASTSNAPTNANESSNSSTTAVPSNIASGQTGGFNPLADLTGA 118

Query: 121 RYAGYANLPSADMFGPDGGLTNAPNSDEILNMLDNPIVQSQMNEMLSNPQMVDFMIQQNP 180
           RYAGYANLPSADMFGPDGG+ NAP+ DE+L M++NPI QSQMNEMLSNP+M+DFMIQ NP
Sbjct: 119 RYAGYANLPSADMFGPDGGINNAPDQDEMLRMMENPIFQSQMNEMLSNPEMLDFMIQSNP 178

Query: 181 QLQAMGPRARELLQSDYFRQMMTNPDMIRQSMQFARXXXXXXXXXXXXXXXXXXXXXQTA 240
           QLQAMGP+AR++LQS +FRQM+TNP MIRQSMQFAR                       A
Sbjct: 179 QLQAMGPQARQMLQSPFFRQMLTNPAMIRQSMQFARMMNGQGGMPGADATD--------A 230

Query: 241 STEGGPAG--TTASPSTTGNGSANSEA-----------ANPFASLFNGQANPFASMFPN- 286
           S    P G  T  +  +T N S N+             ANPFA+L +  +NPFA+M  N 
Sbjct: 231 SAFPAPGGDDTETTTGSTENTSTNNRTNSNANANPNAAANPFAALMDPASNPFAAMMGNM 290

Query: 287 --------GRAPQFDPSLLSSFLGGNTAAPGQQQQPQDNRPPEERYEQQLRQLNDMGFFD 338
                    + P FDP+LL+S LGG   AP Q    +DNRPPEERYEQQLRQLNDMGFFD
Sbjct: 291 NNQQGGAGVQQPAFDPTLLASLLGGQLPAPAQ----EDNRPPEERYEQQLRQLNDMGFFD 346

Query: 339 FDRNVAALRRSGGSVQGALDALLNGDV 365
           FDRNVAALRRSGGSVQGALDALLNGDV
Sbjct: 347 FDRNVAALRRSGGSVQGALDALLNGDV 373

>KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.837
           YMR276W
          Length = 379

 Score =  420 bits (1079), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 233/383 (60%), Positives = 262/383 (68%), Gaps = 22/383 (5%)

Query: 1   MSITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESY 60
           MSIT+HIKSGQNKWDV+   ++++  LKE ISK+SEIP  NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESY 60

Query: 61  KIADDHAVHLVRSGG---PKPAASKXXXXXXXXXXXXXXXXXXXXXXXGQTGGFNPLADL 117
           KI + H++HLV+SGG      AA+                        GQTGGFNPL DL
Sbjct: 61  KIEEGHSIHLVKSGGNVARNSAATNTTPTATSNENTNSAPSVPSNIASGQTGGFNPLNDL 120

Query: 118 TGARYAGYANLPSADMFGPDGGLTNAPNSDEILNMLDNPIVQSQMNEMLSNPQMVDFMIQ 177
           T ARYAGY N+PSADMFGPDGGL + P+ D++L MLDNP+ QSQMNEMLSNPQM+DFMIQ
Sbjct: 121 TSARYAGYLNMPSADMFGPDGGLNSGPSQDDMLRMLDNPVFQSQMNEMLSNPQMIDFMIQ 180

Query: 178 QNPQLQAMGPRARELLQSDYFRQMMTNPDMIRQSMQFARXXXXXXXXXXXXXXXXXXXXX 237
            NPQLQAMGP+AR++LQS  FRQM+ NPDMIRQSMQFAR                     
Sbjct: 181 SNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQSMQFARMMNGGNDPAATGNDPSAFPAP 240

Query: 238 QTASTEGGPAGTTAS-PSTTGNGSANSE-------AANPFASLFNGQANPFASMFP--NG 287
             AS       T AS  STT  G+ N+        AANPF +LFN  ANPF +M    NG
Sbjct: 241 GEASASTNEQNTNASGESTTAGGATNNTNSTSAPAAANPFDALFNPAANPFGAMSSNTNG 300

Query: 288 RAPQ---FDPSLLSSFLGGNTAAPGQQQQP--QDNRPPEERYEQQLRQLNDMGFFDFDRN 342
             PQ   FDP+LL+S LG     P  QQ P  QDNRPPEERYE QLRQLNDMGFFDFDRN
Sbjct: 301 SQPQQPAFDPALLASMLG----MPQSQQTPAQQDNRPPEERYEAQLRQLNDMGFFDFDRN 356

Query: 343 VAALRRSGGSVQGALDALLNGDV 365
           VAALRRSGGSVQGALDALLNGDV
Sbjct: 357 VAALRRSGGSVQGALDALLNGDV 379

>KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {ON}
           some similarities with uniprot|P48510 Saccharomyces
           cerevisiae YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 376

 Score =  418 bits (1075), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 231/390 (59%), Positives = 262/390 (67%), Gaps = 39/390 (10%)

Query: 1   MSITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESY 60
           MSIT+HIKSGQNKWDV+I+P++T+ + K AI+  SEI P NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60

Query: 61  KIADDHAVHLVRSGGPKPAASKXXXXXXXXXXXXXXXXXXXXX----------XXGQTGG 110
           KI DDH+VHLV+SGG K A S                                  GQ  G
Sbjct: 61  KILDDHSVHLVKSGGSKKATSPGATAAASGDATATGATSTPAAQPQQSAPANLSTGQGNG 120

Query: 111 FNPLADLTGARYAGYANLPSADMFGPDGGLTNAPNSDEILNMLDNPIVQSQMNEMLSNPQ 170
           FNPL+DLT ARYAG+ NLPSAD FGPDGG+T+APNSD++L ML+NP++QSQMNEMLSNPQ
Sbjct: 121 FNPLSDLTSARYAGFLNLPSADSFGPDGGMTSAPNSDDVLRMLENPVMQSQMNEMLSNPQ 180

Query: 171 MVDFMIQQNPQLQAMGPRARELLQSDYFRQMMTNPDMIRQSMQFARXXXXXXXXXXXXXX 230
           M+DF+IQQ+PQLQ+MGP+AR LLQS +FRQMMTNPDMIRQSMQF+               
Sbjct: 181 MIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQSMQFS----------SMLGG 230

Query: 231 XXXXXXXQTASTEGGPAGTTASPSTTGNGSANSE---AANPFASLFNGQ---------AN 278
                   +    G PA   A PS      + +     ANPFASL  GQ         AN
Sbjct: 231 DSAAGGGSSFPAPGTPAEADA-PSQPAANPSAAPSAGTANPFASLLGGQAGASGASPAAN 289

Query: 279 PFASMFPNGRA---PQFDPSLLSSFLGGNTAAPGQQQQPQDNRPPEERYEQQLRQLNDMG 335
           PF SM   G A   P  DP +LSS LGG  AA    QQPQD RPPEERYE QLRQLNDMG
Sbjct: 290 PFLSMLGGGSAGTPPALDPMVLSSILGGAGAA---NQQPQDTRPPEERYEHQLRQLNDMG 346

Query: 336 FFDFDRNVAALRRSGGSVQGALDALLNGDV 365
           FF+FDRNVAALRRSGGSVQGALDALLNGDV
Sbjct: 347 FFEFDRNVAALRRSGGSVQGALDALLNGDV 376

>TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score =  409 bits (1050), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 228/375 (60%), Positives = 262/375 (69%), Gaps = 16/375 (4%)

Query: 1   MSITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESY 60
           MSIT+ +K GQ+KW+VS+ P  TV E K+ I+KVSEIP ANQRLIYSGKILKDDQ VESY
Sbjct: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60

Query: 61  KIADDHAVHLVRSGGP--KPAASKXXXXXXXXXXXXXXXXXXXXXXXGQTGGFNPLADLT 118
           KI D HA+HLV+SGG     AA                         GQTGGFNPL+DLT
Sbjct: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIASGQTGGFNPLSDLT 120

Query: 119 GARYAGYANLPSADMFGPDGGLTNAPNSDEILNMLDNPIVQSQMNEMLSNPQMVDFMIQQ 178
            ARYAG+ NLPSADMFGPDGGLTN PN D++L ML+NPI QSQMNEMLSNPQMVDFMIQ 
Sbjct: 121 SARYAGFTNLPSADMFGPDGGLTNMPNQDDMLGMLENPIFQSQMNEMLSNPQMVDFMIQS 180

Query: 179 NPQLQAMGPRARELLQSDYFRQMMTNPDMIRQSMQFARXXXXXXXXXXXXXXXXXXXXXQ 238
           NPQLQAMGP+AR+LLQS +FRQM+TNP M+RQSMQF+                       
Sbjct: 181 NPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQSMQFSSMMNPSGGNDAAAASFPAPG--- 237

Query: 239 TASTEGGPAGTTASPSTTGNGSANSEAANPFASLFNGQANPFASMFPN---GRAPQ---- 291
            ++TE          +   N +AN+ AANPFA++FN  +NP ASMF N   G A      
Sbjct: 238 DSTTEASSTEANTDANANTNANANTNAANPFAAMFNPGSNPLASMFGNQGVGAADNQQNQ 297

Query: 292 -FDPSLLSSFLGGNTAAPGQQQQPQDNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRSG 350
            FDPS+L+S LGG  A   QQ+  QDNRPPEERYEQQLRQLNDMGFFDF++NVAALRRSG
Sbjct: 298 PFDPSMLASLLGGGAA---QQRAEQDNRPPEERYEQQLRQLNDMGFFDFEKNVAALRRSG 354

Query: 351 GSVQGALDALLNGDV 365
           GSVQGALD+LLNGDV
Sbjct: 355 GSVQGALDSLLNGDV 369

>Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {ON}
           YMR276W (DSK2) - ubiquitin-like protein [contig 37] FULL
          Length = 379

 Score =  409 bits (1051), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 220/384 (57%), Positives = 261/384 (67%), Gaps = 24/384 (6%)

Query: 1   MSITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESY 60
           MSIT+H+KSGQ+KWDVS++  +TV + K AI++ S+I P NQRLIYSGKILKDDQT+ESY
Sbjct: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60

Query: 61  KIADDHAVHLVRSGGPKPA----ASKXXXXXXXXXXXXXXXXXXXXXXXGQTGGFNPLAD 116
           KI D HAVHLV+SG    +    A                         GQ GGFNPL+D
Sbjct: 61  KILDGHAVHLVKSGTKSGSGAIGAPGSGSTAPTNTASSGAAAAPASLSSGQAGGFNPLSD 120

Query: 117 LTGARYAGYANLPSADMFGPDGGLTNAPNSDEILNMLDNPIVQSQMNEMLSNPQMVDFMI 176
           LT ARYAGY NLPSAD FGPDGG+T+APNSD++L ML+NP++QSQMNEMLSNPQM+DF+I
Sbjct: 121 LTSARYAGYLNLPSADSFGPDGGMTSAPNSDDMLRMLENPVMQSQMNEMLSNPQMIDFLI 180

Query: 177 QQNPQLQAMGPRARELLQSDYFRQMMTNPDMIRQSMQFARXXXXXXXXXXXXXXXXXXXX 236
           QQ+PQLQ+MGP+AR++LQS +FRQMMTNP+MIRQSMQF+                     
Sbjct: 181 QQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQSMQFSGVLGGAGDPSAAGANAFPAPG 240

Query: 237 XQTASTEGGPAGTTASPSTTGNGSANSEAANPFASLF----------NGQANPFASMFPN 286
              +     PA T  S   T + + ++  ANPFASL           +  ANPF SM   
Sbjct: 241 TADSDASAQPASTNTS---TADAAQSATNANPFASLLAGQAAAPGGASAPANPFLSMLGQ 297

Query: 287 -----GRAPQFDPSLLSSFLGGNTAAPGQQQQPQDNRPPEERYEQQLRQLNDMGFFDFDR 341
                G  P FDP++LS+ LGG  A     QQPQD RPPEERYEQQLRQLNDMGFF+FDR
Sbjct: 298 QAPGAGGLPAFDPAMLSALLGG--AGNNASQQPQDTRPPEERYEQQLRQLNDMGFFEFDR 355

Query: 342 NVAALRRSGGSVQGALDALLNGDV 365
           NVAALRRSGGSVQGALDALLNGDV
Sbjct: 356 NVAALRRSGGSVQGALDALLNGDV 379

>Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276W
           (REAL)
          Length = 364

 Score =  407 bits (1046), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 227/373 (60%), Positives = 261/373 (69%), Gaps = 17/373 (4%)

Query: 1   MSITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESY 60
           MS+ +HIKSGQ+KW+V++ P  TV++ KEAISK + IP ANQRLIYSGKILKDDQTV+SY
Sbjct: 1   MSLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSY 60

Query: 61  KIADDHAVHLVRSGGPKP-AASKXXXXXXXXXXXXXXXXXXXXXXXGQTGGFNPLADLTG 119
            I D H+VHLV+S  PKP A                          GQ+ GFNPLADLT 
Sbjct: 61  HIQDGHSVHLVKSQ-PKPDAGGATGANNATATSAAVGTSATPNMSSGQSAGFNPLADLTS 119

Query: 120 ARYAGYANLPSADMFGPDGGLTN--APNSDEILNMLDNPIVQSQMNEMLSNPQMVDFMIQ 177
           ARYAGY N+PSADMFGPDGG  N  + N DE+L M++NPI QSQMNEMLSNPQM+DFMIQ
Sbjct: 120 ARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQ 179

Query: 178 QNPQLQAMGPRARELLQSDYFRQMMTNPDMIRQSMQFARXXXXXXXXXXXXXXXXXXXXX 237
            NPQLQAMGP+AR++LQS  FRQM+TNP+M+RQSMQFAR                     
Sbjct: 180 SNPQLQAMGPQARQMLQSPMFRQMLTNPEMMRQSMQFARMMDPNADNSAASAFPAPGG-- 237

Query: 238 QTASTEGGPAGTTASPSTTG--NGSANSEAANPFASLFNGQANPFA---SMFPNGRAPQF 292
             AS EG  A T A PS+    NGSAN+ AANPFASL N   NPFA   +  P G  P F
Sbjct: 238 -DASEEG--ANTNAVPSSNAGTNGSANA-AANPFASLLNPALNPFANAGNTAPTGM-PAF 292

Query: 293 DPSLLSSFLGGNTAAPGQQQQPQDNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRSGGS 352
           DP+LL+S      A+  Q  QP+D+RPPEERYE QLRQLNDMGFFDFDRNVAALRRSGGS
Sbjct: 293 DPALLASMFQPQQAS-AQASQPEDSRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGS 351

Query: 353 VQGALDALLNGDV 365
           VQGALD+LLNGDV
Sbjct: 352 VQGALDSLLNGDV 364

>Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276W
           (REAL)
          Length = 372

 Score =  399 bits (1024), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 222/377 (58%), Positives = 254/377 (67%), Gaps = 17/377 (4%)

Query: 1   MSITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESY 60
           MS+ +HIKSGQ+KW+VS+ P +TV + KEAISK + +P ANQRLIYSGKILKDDQTVESY
Sbjct: 1   MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESY 60

Query: 61  KIADDHAVHLVRSGGPKPA-ASKXXXXXXXXXXXXXXXXXXXXXXXGQTGGFNPLADLTG 119
            I D H+VHLV+S  PKP   +                        GQ+ GFNPLADLT 
Sbjct: 61  HIQDGHSVHLVKSQ-PKPQPGAAAGTNNATATGAAAGTVATPNMSSGQSAGFNPLADLTS 119

Query: 120 ARYAGYANLPSADMFGPDGGLTN--APNSDEILNMLDNPIVQSQMNEMLSNPQMVDFMIQ 177
           ARYAGY N+PSADMFGPDGG  N  + N DE+L M++NPI QSQMNEMLSNPQM+DFMIQ
Sbjct: 120 ARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQ 179

Query: 178 QNPQLQAMGPRARELLQSDYFRQMMTNPDMIRQSMQFARXXXXXXXXXXXXXXXXXXXX- 236
            NPQLQAMGP+AR++LQS  FRQM+TNPDMIRQSMQFAR                     
Sbjct: 180 SNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNAGTGSTGGAASAFPAP 239

Query: 237 ---XQTASTEGGPAGTTASPSTTGNGSANSEAANPFASLFNGQANPFASMFPNGRA---- 289
                  S        TAS    G+ +++S AANPFASL N   NPFAS    G A    
Sbjct: 240 GGDAPEESANTNTNTNTASSPNAGSNASSSTAANPFASLLNPALNPFASA---GNATGTG 296

Query: 290 -PQFDPSLLSSFLGGNTAAPGQQQQPQDNRPPEERYEQQLRQLNDMGFFDFDRNVAALRR 348
            P FDP+LL+S      A+  Q  QP+D RPPEERYE QLRQLNDMGFFDFDRNVAALRR
Sbjct: 297 MPAFDPALLASMFQPQQAS-AQASQPEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRR 355

Query: 349 SGGSVQGALDALLNGDV 365
           SGGSVQGALD+LLNGDV
Sbjct: 356 SGGSVQGALDSLLNGDV 372

>NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score =  394 bits (1013), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 215/378 (56%), Positives = 254/378 (67%), Gaps = 22/378 (5%)

Query: 1   MSITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESY 60
           MSI++H+KSGQN W VSI+P +T+++LKE I+KVSE+P  NQRLI+SGKILKDDQTVE Y
Sbjct: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60

Query: 61  KIADDHAVHLVRSGGPKPAASKXXXXXXXXXXXXXXXXXXXXXXXGQTGGFNPLADLTGA 120
           KI D  ++H+V+SGG     S                        G+TGGFNPL+DLT A
Sbjct: 61  KILDGLSIHMVKSGG----GSANKNKSPPPQANTTATPVAPNMAAGETGGFNPLSDLTSA 116

Query: 121 RYAGYANLPSADMFGPDGGLTNA-PNSDEILNMLDNPIVQSQMNEMLSNPQMVDFMIQQN 179
           RYAGY NLPSAD FGPDGGL N+ PN DE+L MLDNP+ QSQMNEMLSNPQM+DF+IQ N
Sbjct: 117 RYAGYLNLPSADTFGPDGGLNNSGPNQDEMLRMLDNPVFQSQMNEMLSNPQMLDFIIQAN 176

Query: 180 PQLQAMGPRARELLQSDYFRQMMTNPDMIRQSMQFARXXXXXXXXXXXXXXXXXXX---- 235
           PQLQAMGP+AR++LQ+  FRQM+TNPDMIRQSMQ AR                       
Sbjct: 177 PQLQAMGPQARQILQNPMFRQMLTNPDMIRQSMQMARAMNGGVDPNGNGQANTSSDFPAP 236

Query: 236 --XXQTASTEGGPAGTTASPSTTGNGSANSEAANPFASLFNGQANPFASMFPN------G 287
                   +E  P+ TT + ST  + +A + AANPFASLFN   NPFA+   N      G
Sbjct: 237 GGDDDNTVSENTPS-TTNTASTNPSSTATTNAANPFASLFNPAMNPFAAGMANTNAAGSG 295

Query: 288 RAPQFDPSLLSSFLGGNTAAPGQQQQPQDNRPPEERYEQQLRQLNDMGFFDFDRNVAALR 347
             P FDPS  +S      A     QQ +D RPPEERYE QLRQLNDMGFFDFDRNVAALR
Sbjct: 296 NPPAFDPSFFASMFQPPAAQ----QQQEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALR 351

Query: 348 RSGGSVQGALDALLNGDV 365
           RSGG+V+ AL+ALLNGDV
Sbjct: 352 RSGGNVESALNALLNGDV 369

>KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 371

 Score =  392 bits (1006), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 220/389 (56%), Positives = 250/389 (64%), Gaps = 47/389 (12%)

Query: 3   ITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKI 62
           I++H+KSGQN W V IE   T+   KE IS VS +P  NQRLIYSGKILKD +TVESYKI
Sbjct: 4   ISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKI 63

Query: 63  ADDHAVHLVRSGGPKPAASKXXXXXXXXXXXXXXXXXXXXXXXGQTGGFNPLADLTGARY 122
            D H+VH+V+SGG   A +                        GQTGGFNPLADLTGARY
Sbjct: 64  QDGHSVHMVKSGGASAATTGSTTTGSAASPAATNSAAPSNISAGQTGGFNPLADLTGARY 123

Query: 123 AGYANLPSADMFGPDGGL--TNAPNSDEILNMLDNPIVQSQMNEMLSNPQMVDFMIQQNP 180
           AG ANLPSADMFGPDGGL  +N  N + +L ML+NPI QSQMNEMLSNPQMVDF+IQQNP
Sbjct: 124 AGLANLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMNEMLSNPQMVDFLIQQNP 183

Query: 181 QLQAMGPRARELLQSDYFRQMMTNPDMIRQSMQFARXXXXXXXXXXXXXXXXXXXXXQTA 240
           QLQA+GPRAR++LQS +FRQMMT+P MIRQSMQ A                         
Sbjct: 184 QLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMANSMGM-------------------- 223

Query: 241 STEGGPAGTTASPSTTGNGSANSEA------------------ANPFASLFNGQ------ 276
           S +G  +   A  S +G G AN  +                  ANPFA LF         
Sbjct: 224 SPDGAASAFPAPGSASGAGGANETSTNDADSAATGAAASSTGQANPFAGLFGATPGNAAA 283

Query: 277 ANPFASMFPNGRAPQFDPSLLSSFLGGNTAAPGQQQQPQDNRPPEERYEQQLRQLNDMGF 336
           ANPFA +FP G+ PQF+  LL+S  GGN+ A G      DNRPPEERYE QLRQLNDMGF
Sbjct: 284 ANPFAGLFPGGQQPQFNQELLASMFGGNSNATGAAPA-VDNRPPEERYESQLRQLNDMGF 342

Query: 337 FDFDRNVAALRRSGGSVQGALDALLNGDV 365
           FDFDRNVAALRR+GGSVQGALDALLNGDV
Sbjct: 343 FDFDRNVAALRRAGGSVQGALDALLNGDV 371

>YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}
           DSK2Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein, required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle, involved in proteolysis,
           interacts with the proteasome
          Length = 373

 Score =  385 bits (988), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 222/386 (57%), Positives = 255/386 (66%), Gaps = 34/386 (8%)

Query: 1   MSITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESY 60
           MS+ +HIKSGQ+KW+V++ P +TV++ KEAI+K + IP ANQRLIYSGKILKDDQTVESY
Sbjct: 1   MSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESY 60

Query: 61  KIADDHAVHLVRSGGPKP-AASKXXXXXXXXXXXXXXXXXXXXXXXGQTGGFNPLADLTG 119
            I D H+VHLV+S  PKP  AS                        GQ+ GFNPLADLT 
Sbjct: 61  HIQDGHSVHLVKSQ-PKPQTASAAGANNATATGAAAGTGATPNMSSGQSAGFNPLADLTS 119

Query: 120 ARYAGYANLPSADMFGPDGGLTN--APNSDEILNMLDNPIVQSQMNEMLSNPQMVDFMIQ 177
           ARYAGY N+PSADMFGPDGG  N  + N DE+L M++NPI QSQMNEMLSNPQM+DFMIQ
Sbjct: 120 ARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQ 179

Query: 178 QNPQLQAMGPRARELLQSDYFRQMMTNPDMIRQSMQFARXXXXXXXXXXXXX-------- 229
            NPQLQAMGP+AR++LQS  FRQM+TNPDMIRQSMQFAR                     
Sbjct: 180 SNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNAGMGSAGGAASAFPAP 239

Query: 230 -----XXXXXXXXQTASTEGGPAGTTASPSTTGNGSANSEAANPFASLFNGQANPFASMF 284
                         ++S  G  AGT A     G  +  + AANPFASL N   NPFA+  
Sbjct: 240 GGDAPEEGSNTNTTSSSNTGNNAGTNA-----GTNAGANTAANPFASLLNPALNPFANA- 293

Query: 285 PNGRA-----PQFDPSLLSSFLGGNTAAPGQQQQPQDNRPPEERYEQQLRQLNDMGFFDF 339
             G A     P FDP+LL+S        P Q  Q +D RPPEERYE QLRQLNDMGFFDF
Sbjct: 294 --GNAASTGMPAFDPALLASMF----QPPVQASQAEDTRPPEERYEHQLRQLNDMGFFDF 347

Query: 340 DRNVAALRRSGGSVQGALDALLNGDV 365
           DRNVAALRRSGGSVQGALD+LLNGDV
Sbjct: 348 DRNVAALRRSGGSVQGALDSLLNGDV 373

>Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar to
           Ashbya gossypii ABL129W
          Length = 406

 Score =  386 bits (991), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 217/411 (52%), Positives = 260/411 (63%), Gaps = 51/411 (12%)

Query: 1   MSITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESY 60
           MSI+LH+KSGQNKW VS +P++++  LK+ I++VS IP  NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60

Query: 61  KIADDHAVHLVR-----------SGGPKPAASKXXXXXXXXXXXXXXXXXXXXXXXGQTG 109
           KIAD H++HLVR           + G    + +                       GQ G
Sbjct: 61  KIADGHSIHLVRSGGGKVSGSSGATGGASGSVEAVGSGGRNSTAGSGSTVPNNITAGQMG 120

Query: 110 GFNPLADLTGARYAGYANLPSADMFGPDGGLTNAPNSDEILNMLDNPIVQSQMNEMLSNP 169
           GFNPLADLTGARYAGYANLPS DMFGPDGGL +A   +EIL MLDNPI QSQ+NEML+NP
Sbjct: 121 GFNPLADLTGARYAGYANLPSTDMFGPDGGLNSAIGQEEILGMLDNPIFQSQVNEMLANP 180

Query: 170 QMVDFMIQQNPQLQAMGPRARELLQSDYFRQMMTNPDMIRQSMQFARXXXXXXXXXXXXX 229
           QM+DF+IQQ+P LQAMGP ARE+LQS +FRQMMTNPD+IRQ  +F +             
Sbjct: 181 QMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRF-QMDMGAANGQSTND 239

Query: 230 XXXXXXXXQTASTEGGPAGTTASPSTTGNGSANSEAANPFASLFNGQANPFASMF----- 284
                    +A+T G  A  T++ + T   +A   AANP  SLFN Q+NPFA+MF     
Sbjct: 240 FPAPGSANNSATTSGDNATLTSTGTGTNTNAA---AANPLTSLFNAQSNPFAAMFAPPAN 296

Query: 285 ----PNGRA--------------------------PQFDPSLLSSFLGGNTAAPGQQQQP 314
               P   A                          P  DP++LS+ L G   A G+QQ  
Sbjct: 297 SGPNPGTNAGATNSTTNPAAAFGADSQQPSRGFSLPPLDPAMLSALLSGGFTATGRQQT- 355

Query: 315 QDNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLNGDV 365
           +DNRPPEERY+QQL QLN+MGF DFDRNVAALRRSGGSVQGAL+ALLNGDV
Sbjct: 356 EDNRPPEERYQQQLEQLNEMGFVDFDRNVAALRRSGGSVQGALNALLNGDV 406

>Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {ON}
           complement(21199..22344) [1146 nt, 382 aa]
          Length = 381

 Score =  380 bits (976), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 209/385 (54%), Positives = 246/385 (63%), Gaps = 24/385 (6%)

Query: 1   MSITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESY 60
           M I +HIKSGQNKW+V+++ +NTV++LKE I+KVSEIP  NQRLIYSGKILKDDQ +E Y
Sbjct: 1   MGIKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60

Query: 61  KIADDHAVHLVRSGGPKPAASKXXXXXXXXXXXXXXXXXX---XXXXXGQTGGFNPLADL 117
           KI D+H++HLV+SGG     +                           GQ+GGFNPL+DL
Sbjct: 61  KIQDEHSIHLVKSGGASKTNTSASAAAASTSTATNSDSNAPLPSNIAAGQSGGFNPLSDL 120

Query: 118 TGARYAGYA-NLPSADMFGPDGGLTNAPNSDEILNMLDNPIVQSQMNEMLSNPQMVDFMI 176
           T ARYAGY  NLPSADMFGPDGG+ + PN D++L ML+NP+ QSQMNEMLSNPQM+DFMI
Sbjct: 121 TSARYAGYGLNLPSADMFGPDGGMNSMPNQDDMLRMLENPVFQSQMNEMLSNPQMIDFMI 180

Query: 177 QQNPQLQAMGPRARELLQSDYFRQMMTNPDMIRQSMQFARXXXXXXXXXXXXXXXXXXXX 236
           Q NPQLQAMGP AR++ QS +FRQM+TNP+MIRQSMQ A                     
Sbjct: 181 QSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIRQSMQMANMMGGNGQFGANAAASSFPAP 240

Query: 237 XQTASTEGGPAGTTASPSTTGNGSANSEAANPFASLFNGQANPF---------------- 280
            +T +T      T  + +    G+A +   NPFASLFN   NPF                
Sbjct: 241 GETDTTAAAETNTETTSTPAATGAAAAGQQNPFASLFNPAMNPFAAMMNNNAAAAAGAGA 300

Query: 281 ASMFPNGRAPQFDPSLLSSFLGGNTAAPGQQQQPQDNRPPEERYEQQLRQLNDMGFFDFD 340
                    P FDPSL +S            QQ QDNRPPEERYE QLRQLNDMGFFDFD
Sbjct: 301 TGAAGATGTPAFDPSLFASMFQPPQQQ----QQEQDNRPPEERYESQLRQLNDMGFFDFD 356

Query: 341 RNVAALRRSGGSVQGALDALLNGDV 365
           RNVAALRRSGGSVQGALDALL+ DV
Sbjct: 357 RNVAALRRSGGSVQGALDALLSNDV 381

>ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 369

 Score =  377 bits (969), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 209/378 (55%), Positives = 243/378 (64%), Gaps = 25/378 (6%)

Query: 2   SITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYK 61
           +IT+ IKSGQNKW+V+++P +TV   KE ISKVSEIP ++QRLIYSGKILKDDQT++ Y 
Sbjct: 3   TITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYN 62

Query: 62  IADDHAVHLVRSGGP--------------KPAASKXXXXXXXXXXXXXXXXXXXXXXXGQ 107
           + D H+VHLV+S                    +                         GQ
Sbjct: 63  LQDGHSVHLVKSSKAPGNASGGSSSTAAATAGSGASAVPPSGNASTTPTTGAPSNLSAGQ 122

Query: 108 TGGFNPLADLTGARYAGYANLPSADMFGPDGGLTNAPNSDEILNMLDNPIVQSQMNEMLS 167
           +GGFNPLADLT ARYAG+ +LPSADMFGPDGG TN PN +++LNMLDNPI QSQMNEMLS
Sbjct: 123 SGGFNPLADLTSARYAGFTSLPSADMFGPDGGATNMPNQEDLLNMLDNPIFQSQMNEMLS 182

Query: 168 NPQMVDFMIQQNPQLQAMGPRARELLQSDYFRQMMTNPDMIRQSMQFARXXXXXXXXXXX 227
           NPQMVDFMIQ NPQLQAMGP+AR++ QS +FRQM+TNP MIRQSMQFAR           
Sbjct: 183 NPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQSMQFARMMNPGGGENDA 242

Query: 228 XXXXXXXXXXQTASTEGGPAGTTASPSTTGNGSANSEAANPFASLFNGQANPFASMFPNG 287
                      T       A    +P+     +    A NPFA+L  G            
Sbjct: 243 ANAFPAPGNENTEGESAAGANDGGNPAAAATNAGAPPAGNPFAALLGGGGP-------LQ 295

Query: 288 RAPQFDPSLLSSFLGGNTAAPGQQQQPQDNRPPEERYEQQLRQLNDMGFFDFDRNVAALR 347
           +    DP LL+S LG    AP QQQQPQDNRPPEERYE QLRQLN+MGFFDFDRNVAALR
Sbjct: 296 QPGGLDPQLLASMLG----APSQQQQPQDNRPPEERYETQLRQLNEMGFFDFDRNVAALR 351

Query: 348 RSGGSVQGALDALLNGDV 365
           RSGGSVQGALD+LLNGDV
Sbjct: 352 RSGGSVQGALDSLLNGDV 369

>Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276W
           (REAL)
          Length = 366

 Score =  370 bits (951), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 218/371 (58%), Positives = 255/371 (68%), Gaps = 11/371 (2%)

Query: 1   MSITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESY 60
           MS+ +++KSGQ+KW+VS+ P +TV++ KEAIS+ + IP ANQRLIYSGKILKDDQTVESY
Sbjct: 1   MSLNVYVKSGQDKWEVSVAPESTVLQFKEAISEANGIPVANQRLIYSGKILKDDQTVESY 60

Query: 61  KIADDHAVHLVRSG-GPKPAASKXXXXXXXXXXXXXXXXXXXXXXXGQTGGFNPLADLTG 119
            I D H+VHLV+S   P+  A+                        GQ+ GFNPLADLT 
Sbjct: 61  HIQDGHSVHLVKSQPRPQAGAATGAGGDAGASATNASVSATPNMSSGQSAGFNPLADLTS 120

Query: 120 ARYAGYANLPSADMFGPDGGLTN--APNSDEILNMLDNPIVQSQMNEMLSNPQMVDFMIQ 177
           ARYAGY N+PSADMFGPDGG  N  + N DE+L M+DNPI QSQMNEMLSNPQM+DFMIQ
Sbjct: 121 ARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMDNPIFQSQMNEMLSNPQMLDFMIQ 180

Query: 178 QNPQLQAMGPRARELLQSDYFRQMMTNPDMIRQSMQFARXXXXXXXXXXXXXXXXXXXXX 237
            NPQLQAMGP+AR++LQS  FRQM+TNPDMIRQSMQFAR                     
Sbjct: 181 SNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNAGNGSAGGAASAF--- 237

Query: 238 QTASTEGGPAGTTASPSTTGNGSANSEAANPFASLFNGQANPFASMFPNGRA---PQFDP 294
             A     P  TT + +   + +  + AANPFASL N   NPFA+   +  A   P FDP
Sbjct: 238 -PAPGGDAPEETTDTDAAPSSNAGANAAANPFASLLNPALNPFANAGNSAAATGMPAFDP 296

Query: 295 SLLSSFLGGNTAAPGQQQQPQDNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRSGGSVQ 354
           +LL+S      AA  Q  QP+D RPPEERYEQQLRQLNDMGFFDFDRNVAALRRSGGSVQ
Sbjct: 297 ALLASMFQPQQAA-AQAPQPEDTRPPEERYEQQLRQLNDMGFFDFDRNVAALRRSGGSVQ 355

Query: 355 GALDALLNGDV 365
           GALD+LLNGDV
Sbjct: 356 GALDSLLNGDV 366

>TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837
           YMR276W
          Length = 377

 Score =  363 bits (933), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 209/384 (54%), Positives = 252/384 (65%), Gaps = 26/384 (6%)

Query: 1   MSITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESY 60
           MSI++ IKSGQNKWDV++EP+NT++E KE ISK S+IP  NQRLIYSGKILKD +TVESY
Sbjct: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60

Query: 61  KIADDHAVHLVRSGGPKPAASKXXXXXXXXXXXXXXXXXXXX---XXXGQTGGFNPLADL 117
           KI D H++HLV+SG     A+K                          GQT GFNPLADL
Sbjct: 61  KIQDGHSIHLVKSGDASANAAKSSTAAAATANAAAGSAESAVPTNITSGQTNGFNPLADL 120

Query: 118 TGARYAGY-ANLPSADMFGPDGGLTNAPNSDEILNMLDNPIVQSQMNEMLSNPQMVDFMI 176
           T ARYAGY   +PSADMFGPDGG+TN PN D++L+ML+NP+ QSQMNEMLSNPQMV++MI
Sbjct: 121 TSARYAGYNLPMPSADMFGPDGGMTNMPNQDDMLSMLENPVFQSQMNEMLSNPQMVEYMI 180

Query: 177 QQNPQLQAMGPRARELLQSDYFRQMMTNPDMIRQSMQFARXXXXXXXXXXXXXXXXXX-- 234
             NPQLQA+GP+ARE+ QS +FRQM+TNPDMIRQSM+ AR                    
Sbjct: 181 NSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARMMGGEGVGIGGGLNGDSSFP 240

Query: 235 XXXQTASTEGGPAGTTASPSTTGNGSANSEAANPFASLFNGQANPFASMFPNGRA----- 289
              +T++         A+ +      A +  ANPFA+LFN   NPFA +     A     
Sbjct: 241 APGETSTESATAEDNAAARNPAATNPAAANPANPFAALFNPGMNPFAGLGNPAAAGSTGA 300

Query: 290 ------PQFDPSLLSSFLGGNTAAPGQQQQP--QDNRPPEERYEQQLRQLNDMGFFDFDR 341
                 P F+PS+L+S L        Q +QP  +D RPPE RYE QLRQLNDMGFF+FDR
Sbjct: 301 PGTPQYPGFNPSMLASML-------QQPRQPAQEDTRPPEVRYESQLRQLNDMGFFEFDR 353

Query: 342 NVAALRRSGGSVQGALDALLNGDV 365
           N+AALRRSGGSVQGALDALLN DV
Sbjct: 354 NIAALRRSGGSVQGALDALLNNDV 377

>ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR276W (DSK2)
          Length = 345

 Score =  362 bits (929), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 205/368 (55%), Positives = 241/368 (65%), Gaps = 26/368 (7%)

Query: 1   MSITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESY 60
           M+I + +KSGQN+W+VS+E + +V ELK+ I+KVSEIP  NQRLIYSGKILKDDQTVESY
Sbjct: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60

Query: 61  KIADDHAVHLVRSGGPKPAASKXXXXXXXXXXXXXXXXXXXXXXXGQTGGFNPLADLTGA 120
           KIAD HA+HLV+SGG K A +                        GQ+GGFNPLADLTGA
Sbjct: 61  KIADGHAIHLVKSGGAKAAPAASAAGGESTGAAAGAGAVPSSISAGQSGGFNPLADLTGA 120

Query: 121 RYAGYANLPSADMFGPDGGLTNAPNSDEILNMLDNPIVQSQMNEMLSNPQMVDFMIQQNP 180
           RYAGY NLPS DMFGPDGGL +A   +EI+ ML+NPI QSQMNEML+NPQM+DF+IQQ+P
Sbjct: 121 RYAGYTNLPSTDMFGPDGGLNSAVGQEEIIGMLENPIFQSQMNEMLNNPQMIDFLIQQHP 180

Query: 181 QLQAMGPRARELLQSDYFRQMMTNPDMIRQSMQFARXXXXXXXXXXXXXXXXXXXXXQTA 240
            LQAMGP ARE+LQS +FRQM+TNPD+IRQ  +                           
Sbjct: 181 HLQAMGPAAREMLQSPFFRQMLTNPDIIRQMSRLQMGMGG------------------AG 222

Query: 241 STEGGPAGTTASPSTTGNGSANSEAANPFASLFNGQANPFASMFPNGRA---PQFDPSLL 297
           + +G       S +T    +           L  G ANP  +  P  R    P  DP++L
Sbjct: 223 AEQGTDFPAPGSAATPDAAAPAPNPLAAILGLQPGAANPLGAA-PADRGLAMPPLDPAML 281

Query: 298 SSFLGGNTAAPGQQQQPQDNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRSGGSVQGAL 357
           SS  G   A+      P DNRPPEERYEQQLRQLNDMGFFDFDRNVAALRR+GGSVQGAL
Sbjct: 282 SSLFGAGAAS----PAPADNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRAGGSVQGAL 337

Query: 358 DALLNGDV 365
           DALLNGDV
Sbjct: 338 DALLNGDV 345

>TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {ON}
           Anc_8.837 YMR276W
          Length = 375

 Score =  344 bits (882), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 192/378 (50%), Positives = 240/378 (63%), Gaps = 23/378 (6%)

Query: 1   MSITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESY 60
           M+I++HIKSGQN WDV IE ++T+ + K+ I+ VSEIP  NQRLIYSGKILKDDQT+ESY
Sbjct: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60

Query: 61  KIADDHAVHLVRSGGPKPAASKXXXXXXXXXXXXXXXXXXXXXXXGQTGGFNPLADLTGA 120
           KI D H++H+V+SG    A+S                        G+  GFNPL+DLT A
Sbjct: 61  KIQDGHSIHMVKSGAHATASSTTNSMTTTNTTAPQNNNGSSGMSTGRGSGFNPLSDLTSA 120

Query: 121 RYAGYANLPSADMFGPDGGLTNAPNSDEILNMLDNPIVQSQMNEMLSNPQMVDFMIQQNP 180
           RYAGY NLPSADMFGPDGG   + + D++L+ML+NP+ QSQMNEMLSNP++VDF+I  NP
Sbjct: 121 RYAGYTNLPSADMFGPDGGSFASQSQDDMLHMLENPVFQSQMNEMLSNPEIVDFLINSNP 180

Query: 181 QLQAMGPRARELLQSDYFRQMMTNPDMIRQSMQFARXXXXXXXXXXXXX----------- 229
           QLQ++GP+AR + QS  FRQM+TNPDMIRQSM+ A+                        
Sbjct: 181 QLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRMAQMMNGGEGTASASSFPAPGDSTTTT 240

Query: 230 ----XXXXXXXXQTASTEGGPAGTTASPSTTGNGSANSEAANPFASLFNGQANPF--ASM 283
                        T +T       T  P TT +G+A   AANPFA+LF+   NP+     
Sbjct: 241 QPTSTNIDSDTNATNNTNNATNTPTDVPGTTNSGTA---AANPFAALFDPSMNPYAALGG 297

Query: 284 FPNGRAPQFDPSLLSSFLGGNTAAPGQQQQPQDNRPPEERYEQQLRQLNDMGFFDFDRNV 343
                   F+P+  +       AA    Q+P+DNRPPEERYE QLRQLNDMGFFDFD+NV
Sbjct: 298 GNGNANNMFNPAAFAQ---ALQAAAPHTQEPEDNRPPEERYEHQLRQLNDMGFFDFDKNV 354

Query: 344 AALRRSGGSVQGALDALL 361
           AALRRSGGSVQGA++ALL
Sbjct: 355 AALRRSGGSVQGAVNALL 372

>KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON}
           Anc_8.837 YMR276W
          Length = 367

 Score =  327 bits (839), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 210/379 (55%), Positives = 242/379 (63%), Gaps = 26/379 (6%)

Query: 1   MSITLHIKSGQNKWDVSI--EP-TNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTV 57
           M IT+ +K GQN+WDV++  EP   TV + KE ++ V+ +P  NQRLIYSGKILKD QT+
Sbjct: 1   MGITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTL 60

Query: 58  ESYKIADDHAVHLVRSGGPKPAASKXXXXXXXXXXXXXXXXXXXXXXX--GQTGGFNPLA 115
           E YKI D H VHLV+SGG K A S                          GQ  GFNPLA
Sbjct: 61  EEYKITDGHTVHLVKSGGAKSAGSSSSSSEATTAAGTAGTAPAAGASMAAGQQPGFNPLA 120

Query: 116 DLTGARYAGY-ANLPSADMFGPDGGLTNAPNS------DEILNMLDNPIVQSQMNEMLSN 168
           DLT ARYAGY   +PSADMFGPDGGLT+          +EIL+ML+NPI QSQMNEM SN
Sbjct: 121 DLTSARYAGYNLPMPSADMFGPDGGLTSGGGPGGPQSQEEILSMLENPIFQSQMNEMFSN 180

Query: 169 PQMVDFMIQQNPQLQAMGPRARELLQSDYFRQMMTNPDMIRQSMQFARXXXXXXXXXXXX 228
           PQMVDF+IQ NPQLQAMGP+ARE+LQS  FRQM+TNPDM+RQSMQF++            
Sbjct: 181 PQMVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVRQSMQFSQMMQGSGAGAGGA 240

Query: 229 XXXXXXXXXQTASTEGGPAGTTASPSTTGNGSANSEA-ANPFASLFNGQANPFASMFPNG 287
                      A    G   T A  +T+ N SA   A ANPF+SLF G   P A  F + 
Sbjct: 241 DP--------NAFPAPGGDDTGAPTNTSTNASAAGPAGANPFSSLFGGAPAPAAQPFQS- 291

Query: 288 RAPQFDPSLLSSFLGGNTA-APGQQQQPQDNRPPEERYEQQLRQLNDMGFFDFDRNVAAL 346
            AP FD +     +  N A AP     PQD RPPEERYEQQLRQLNDMGF DFDRNVAAL
Sbjct: 292 -APGFDAAAFMQAMSRNGATAPA--AAPQDTRPPEERYEQQLRQLNDMGFSDFDRNVAAL 348

Query: 347 RRSGGSVQGALDALLNGDV 365
           RR+GGS+QGALDALLNGDV
Sbjct: 349 RRAGGSLQGALDALLNGDV 367

>NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {ON}
           Anc_8.837 YMR276W
          Length = 404

 Score =  268 bits (686), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 157/216 (72%), Gaps = 6/216 (2%)

Query: 2   SITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYK 61
           +I++HIKSGQN W VSI+ T ++  LK+ I+KVSEIP  NQRLIYSGKILKDDQ V+ Y 
Sbjct: 3   TISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYN 62

Query: 62  IADDHAVHLVRSGGPKPAASKXXXXXXXXXXXXXXXXXXXXXXXGQTGGFNPLADLTGAR 121
           I D H+VHLVRSG      S                        GQTGGFNPLADLT AR
Sbjct: 63  IQDGHSVHLVRSG----KKSTPTPATTNTTTNASNNTVPSNISAGQTGGFNPLADLTSAR 118

Query: 122 YAGY-ANLPSADMFGPDGGLT-NAPNSDEILNMLDNPIVQSQMNEMLSNPQMVDFMIQQN 179
           YAGY  NLPSAD FGPDGG+  +  N DE L+MLDNPIVQSQMNEMLSNPQM+DFMIQ N
Sbjct: 119 YAGYNLNLPSADAFGPDGGMNQSGTNPDEFLSMLDNPIVQSQMNEMLSNPQMIDFMIQSN 178

Query: 180 PQLQAMGPRARELLQSDYFRQMMTNPDMIRQSMQFA 215
           PQLQAMGP+AR++ QS  FRQM+TNPDMIRQSMQ A
Sbjct: 179 PQLQAMGPQARQMFQSPMFRQMLTNPDMIRQSMQLA 214

>TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.837
           YMR276W
          Length = 284

 Score = 58.5 bits (140), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 56/219 (25%), Positives = 94/219 (42%), Gaps = 16/219 (7%)

Query: 3   ITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKI 62
           I+++IK  + K+ +  E    + ++   I    +IPP NQRLIYSG+IL  ++T++ Y  
Sbjct: 2   ISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNF 61

Query: 63  ADDHAVHLVRSGGPKPAASKXXXXXXXXXXXXXXXXXXXXXXXGQT--GGFNPLADLTGA 120
            D H + ++     K                              T  G  N +   T  
Sbjct: 62  KDGHCIIVIIHKEEKNNLHPPPNNTTNLNPNNSVYPASNTPINSPTPFGEGNIITITTT- 120

Query: 121 RYAGYANLPSADMFGPDGGLTNAPNSD-EILNMLDNPIVQSQMNEMLSNPQ-MVDFMIQQ 178
                    S D +G      + P  + E+L +LD+P    Q NEML N Q ++ F+IQ 
Sbjct: 121 ---------SPDPYGVRSNEVHDPEVERELLQVLDHP-RSFQENEMLLNNQNLLRFLIQT 170

Query: 179 NPQLQAMGPR-ARELLQSDYFRQMMTNPDMIRQSMQFAR 216
           NP L+ M    AR++L+    ++   + + + Q +   R
Sbjct: 171 NPHLRHMDINGARQVLRDPRLQRAFMDVNFLNQQISLRR 209

>Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [234
          bp, 77 aa] {ON}
          complement(173662..173746,173844..173992) [234 nt, 78
          aa]
          Length = 77

 Score = 53.1 bits (126), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 37/56 (66%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          V I+ ++ V  +KE + +   IPP+ QRLI+ GK + D+QTV+S K+ D   +HLV
Sbjct: 15 VEIQGSDKVYHIKELLEEKEGIPPSQQRLIFQGKQIDDEQTVDSAKLTDGMQLHLV 70

>SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 50.1 bits (118), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 36/56 (64%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          +S+E    V  +KE + +   IPP+ QRLI+ GK ++DDQTV+S  ++    +HLV
Sbjct: 15 ISLESHEKVYRIKELLEEKEGIPPSQQRLIFQGKQIEDDQTVDSANLSSGMQLHLV 70

>NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234
          bp, 77 aa] {ON}
          Length = 77

 Score = 49.3 bits (116), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 35/56 (62%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          V I+ T+ V  +KE + +   IPP+ QRLI+ GK + D+QTV S  + D   +HLV
Sbjct: 15 VDIQGTDPVYRIKEMLEEKEGIPPSQQRLIFQGKQIDDEQTVSSANLIDGMQLHLV 70

>TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 48.1 bits (113), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 36/56 (64%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + ++ ++ V  +K+ + +   IPP+ QRLI+ GK + D+QTVES  + D   +HLV
Sbjct: 15 IEVQGSDKVFHIKDLLEEKEGIPPSQQRLIFQGKQIDDEQTVESANLIDGMQLHLV 70

>KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 47.0 bits (110), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 24/71 (33%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 1  MSITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESY 60
          M +T+   +G+ +  V ++P + V  +KE + +   IPP  QRLI+ GK + DD++V S 
Sbjct: 1  MKLTVKTLTGK-EIPVVVDPDDKVYRIKEYLEEKEGIPPTQQRLIFQGKQIDDDKSVSSA 59

Query: 61 KIADDHAVHLV 71
           ++    +HLV
Sbjct: 60 NLSSGMQLHLV 70

>TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16
          YLL039C
          Length = 77

 Score = 47.0 bits (110), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa]
          {ON} similar to uniprot|Q03919 Saccharomyces cerevisiae
          YDR139C RUB1 Ubiquitin-like protein with similarity to
          mammalian NEDD8
          Length = 77

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 33/56 (58%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          V +   + +  +KE + +   IPP+ QRLI+ GK + D QTV S K+ D   +HLV
Sbjct: 15 VELNGEDPIYRIKELLEEKEGIPPSQQRLIFQGKQIDDQQTVSSAKLVDGMQLHLV 70

>NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON}
          Anc_4.16
          Length = 77

 Score = 46.6 bits (109), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234
          bp, 77 aa] {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 46.2 bits (108), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          V ++    +  +K+ + +   IPP+ QRLI+ GK + D QT+E+ K+ D   +HLV
Sbjct: 15 VELKSDAPIYRIKQLLEEKEGIPPSQQRLIFQGKQIDDRQTLEAAKLVDGMVLHLV 70

>NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 45.4 bits (106), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          V I     V  +KE + +   IPP+ QRLI+ GK + D+Q+V S  + D   +HLV
Sbjct: 15 VEISGNEPVYRIKELLEEKEGIPPSQQRLIFQGKQIDDEQSVSSANLVDGMQLHLV 70

>Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON}
          YLL039C (REAL)
          Length = 62

 Score = 45.1 bits (105), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 1  LEVEYSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 56

>KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 45.1 bits (105), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          V ++ + TV  +KE + +   IPP+ Q+LI+ GK + D+ T+ S  + D   +HLV
Sbjct: 15 VDVQSSETVYHIKELLEEKEGIPPSQQKLIFQGKQIDDNATIGSADLQDGSLLHLV 70

>KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa]
          {ON} Anc_1.480 YEL037C
          Length = 379

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 42/73 (57%), Gaps = 1/73 (1%)

Query: 11 QNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIAD-DHAVH 69
          + K  V +E ++T+++ K  ++ +        +LI+SGK+LKDDQTV S  + D D  + 
Sbjct: 10 KEKIPVELESSSTILDAKNKLASIKSCDIDQIKLIFSGKVLKDDQTVSSCGLKDNDQVIM 69

Query: 70 LVRSGGPKPAASK 82
          ++      P+A+K
Sbjct: 70 MISKKKATPSATK 82

>Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128
          aa] {ON} ANNOTATED BY YGOB -
          Length = 128

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C
          (REAL)
          Length = 125

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 12 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 67

>Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa]
          {ON} YKR094C (REAL)
          Length = 125

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 12 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 67

>AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YEL037C (RAD23)
          Length = 413

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 50/89 (56%), Gaps = 9/89 (10%)

Query: 1  MSITLHIKS-GQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVES 59
          M+IT+H K   + +  + + P+ T+ E K+ +++  +   +  ++I+SGK+L+D  T+E 
Sbjct: 1  MNITIHFKDFKKERLPLQLSPSATIAEAKQMLARAKQCDESQLKMIFSGKVLQDGNTLEG 60

Query: 60 YKIAD-DHAVHLV-------RSGGPKPAA 80
           K+ D D  + ++       R   P+PA+
Sbjct: 61 CKLKDGDQVIFMISKKKAETRVSEPEPAS 89

>ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128
          aa] {ON} highly similar to uniprot|P14796 Saccharomyces
          cerevisiae YKR094C RPL40B
          Length = 128

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa]
          {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa]
          {ON} 
          Length = 128

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387
          bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387
          bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}
          RPL40AFusion protein, identical to Rpl40Bp, that is
          cleaved to yield ubiquitin and a ribosomal protein of
          the large (60S) ribosomal subunit with similarity to
          rat L40; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes
          Length = 128

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,
          128 aa] {ON}  RPL40BFusion protein, identical to
          Rpl40Ap, that is cleaved to yield ubiquitin and a
          ribosomal protein of the large (60S) ribosomal subunit
          with similarity to rat L40; ubiquitin may facilitate
          assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128
          aa] {ON} highly similar to uniprot|P61864 Saccharomyces
          cerevisiae YKR094c RPL40B and highly similar to
          uniprot|P61864 Saccharomyces cerevisiae YIL148w RPL40A
          Length = 128

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C
          (REAL)
          Length = 124

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 11 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 66

>Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa]
          {ON} complement(145335..145721) [387 nt, 129 aa]
          Length = 128

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212)
          [387 bp, 128 aa] {ON} highly similar to uniprot|P61864
          Saccharomyces cerevisiae YLR167W RPS31 and highly
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YIL148W and highly similar to uniprot|P04838
          Saccharomyces cerevisiae YKR094C and highly similar to
          uniprot|P04838 Saccharomyces cerevisiae YLL039C Fusion
          proteins that are cleaved to yield a ribosomal protein
          of the small (40S) subunit and ubiquitin
          Length = 128

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa]
          {ON} highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YKR094C RPL40B Fusion protein, identical to
          Rpl40Ap, that is cleaved to yield ubiquitin and a
          ribosomal protein of the large (60S) ribosomal subunit
          with similarity to rat L40; ubiquitin may facilitate
          assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa]
          {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083)
          [387 bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387
          bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387
          bp, 128 aa] {ON} highly similar to uniprot|P04838
          Saccharomyces cerevisiae YKR094c UBI2 ubiquitin and
          highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YIL148w UBI1 ubiquitin
          Length = 128

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037c RAD23 nucleotide excision repair protein
          Length = 392

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 43/72 (59%), Gaps = 1/72 (1%)

Query: 11 QNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHL 70
          + K+ + +E + +++ +KEA+S+     P+  +LI+SGK+LKD  +VES    D + V  
Sbjct: 11 KEKYPLDLESSQSIVAVKEALSEKLSCDPSQIKLIFSGKVLKDGDSVESCNFKDGNEVIF 70

Query: 71 VRSGGPKPAASK 82
          + S   K  A+K
Sbjct: 71 MVS-AKKATATK 81

>NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634)
          [387 bp, 128 aa] {ON} Anc_5.701
          Length = 128

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa]
          {ON} Anc_5.701
          Length = 128

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa]
          {ON} Anc_5.701
          Length = 128

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}
          similar to Ashbya gossypii AFR285C 1-intron
          Length = 128

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa]
          {ON} 
          Length = 128

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp,
          128 aa] {ON} Syntenic homolog of Saccharomyces
          cerevisiae YKR094C (RPL40B) and YIL148W (RPL40A);
          1-intron
          Length = 128

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387
          bp, 128 aa] {ON} 
          Length = 128

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W
          (REAL)
          Length = 144

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 39/67 (58%), Gaps = 3/67 (4%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV---R 72
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV   R
Sbjct: 31 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLR 90

Query: 73 SGGPKPA 79
           G  +P+
Sbjct: 91 GGIIEPS 97

>KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.16
          YLL039C
          Length = 153

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

>TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to
          Ashbya gossypii ACL062C
          Length = 153

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

>TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.16
          YLL039C
          Length = 153

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

>Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON}
          YALI0E18986g (REAL)
          Length = 151

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

>CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa]
          {ON} highly similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139c RUB1
          Length = 77

 Score = 42.7 bits (99), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 33/56 (58%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          V +   + V  +KE + +   IP + QRLI+ GK + +D T+ + K++D   +HLV
Sbjct: 15 VEVSGEDKVYHIKELLEEKEGIPASQQRLIFHGKQINNDDTISTAKLSDGMQLHLV 70

>NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON}
          similar to Ashbya gossypii AGL128W
          Length = 152

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON}
          YLR167W (RPS31) - Ribosomal protein S31 (S37) (YS24)
          [contig 251] FULL
          Length = 150

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa]
          {ON} YEL037C (RAD23) - ubiquitin-like protein [contig
          41] FULL
          Length = 381

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 38/57 (66%), Gaps = 1/57 (1%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIAD-DHAVHLV 71
          + +E ++TV E K+ +++  E   +  +LIYSGKIL+DD+T+  YK+ D D  + ++
Sbjct: 16 LELELSSTVNEAKQKLAENKECDDSQIKLIYSGKILQDDRTIGDYKLKDGDQVIFMI 72

>ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar
          to uniprot|P05759 Saccharomyces cerevisiae YLR167W
          RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes interacts genetically
          with translation factor eIF2B
          Length = 152

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 150

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON}
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes; interacts genetically
          with translation factor eIF2B
          Length = 150

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON}
          Anc_8.386 YLR167W
          Length = 152

 Score = 44.3 bits (103), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YLR167W (RPS31)
          Length = 152

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 and similar to uniprot|P04838
          Saccharomyces cerevisiae YIL148W and similar to
          uniprot|P04838 Saccharomyces cerevisiae YKR094C and
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039C Fusion proteins that are cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 154

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa] {ON}
           YLL039C (UBI4) - 1:1 [contig 144] FULL
          Length = 231

 Score = 45.1 bits (105), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 37/64 (57%), Gaps = 2/64 (3%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV--RS 73
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV    
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLR 226

Query: 74  GGPK 77
           GG K
Sbjct: 227 GGKK 230

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

>NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}
          Anc_1.480 YEL037C
          Length = 427

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 40/62 (64%), Gaps = 1/62 (1%)

Query: 11 QNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIAD-DHAVH 69
          + K  + +EP+NT++++K  +++      +  ++IYSGK+L+D QTVE  ++ + D  + 
Sbjct: 11 KEKIPLDLEPSNTILDVKSQLAQAKACEESQIKIIYSGKVLQDGQTVEECQLKEGDQIIF 70

Query: 70 LV 71
          ++
Sbjct: 71 MI 72

>NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Smik_12.18 Chr12 complement(49088..49552,49091..49552,49091..49546)
           [1383 bp, 460 aa] {ON} YLL039C (REAL)
          Length = 460

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (58%), Gaps = 3/63 (4%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV---R 72
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV   R
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLR 150

Query: 73  SGG 75
            GG
Sbjct: 151 GGG 153

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (58%), Gaps = 3/63 (4%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV---R 72
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV   R
Sbjct: 245 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLR 304

Query: 73  SGG 75
            GG
Sbjct: 305 GGG 307

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 169 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 224

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 323 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 378

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 399 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 454

>TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.386
          YLR167W
          Length = 150

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusion
          protein that is cleaved to yield a ribosomal protein of
          the small (40S) subunit and ubiquitin; ubiquitin may
          facilitate assembly of the ribosomal protein into
          ribosomes; interacts genetically with translation
          factor eIF2B
          Length = 152

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16
          YLL039C
          Length = 229

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON} 
          Length = 229

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.701
          YIL148W
          Length = 229

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304)
          [450 bp, 149 aa] {ON} 
          Length = 149

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 39/67 (58%), Gaps = 3/67 (4%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV---R 72
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV   R
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLR 74

Query: 73 SGGPKPA 79
           G  +P+
Sbjct: 75 GGIIEPS 81

>KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YLL039c UBI4 ubiquitin
          Length = 409

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 119 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 174

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 195 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 250

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 271 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 326

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 347 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 402

>CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly
          similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167w UBI3 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 152

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}
          complement(10263..10721) [459 nt, 153 aa]
          Length = 152

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON}
          complement(58683..59141) [459 nt, 153 aa]
          Length = 152

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON}
          YEL037C (REAL)
          Length = 409

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 42/71 (59%), Gaps = 2/71 (2%)

Query: 3  ITLHIKS-GQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYK 61
          ++L  K+  + K  + +EP+NT+ E K  +++ S    +  +LIYSGK+L+D +TV    
Sbjct: 2  VSLTFKNFKKEKVPLDLEPSNTIFEAKTKLAQSSSCEESQIKLIYSGKVLQDSKTVSECG 61

Query: 62 IAD-DHAVHLV 71
          + D D  V ++
Sbjct: 62 LKDGDQVVFMI 72

>YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp,
          77 aa] {ON}  RUB1Ubiquitin-like protein with similarity
          to mammalian NEDD8; conjugation (neddylation)
          substrates include the cullins Cdc53p, Rtt101p, and
          Cul3p; activated by Ula1p and Uba3p (E1 enzyme pair);
          conjugation mediated by Ubc12p (E2 enzyme)
          Length = 77

 Score = 41.6 bits (96), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 32/56 (57%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          V ++ ++ V  +KE + +   IPP+ QRLI+ GK + D  TV    + +   +HLV
Sbjct: 15 VELKESDLVYHIKELLEEKEGIPPSQQRLIFQGKQIDDKLTVTDAHLVEGMQLHLV 70

>Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON}
          YLL039C (REAL)
          Length = 254

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highly
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039c UBI4 ubiquitin
          Length = 305

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

>TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.386
          YLR167W
          Length = 152

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 400

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 43/71 (60%), Gaps = 2/71 (2%)

Query: 3  ITLHIKS-GQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYK 61
          IT++ K   + K  + ++PT+TV++ K+ ++          +LI+SGK+L+D +T+E  K
Sbjct: 2  ITINFKDFKKEKLPLELDPTSTVLQAKQQLASTKSCDEDQIKLIFSGKVLQDGKTLEECK 61

Query: 62 IAD-DHAVHLV 71
          + D D  + ++
Sbjct: 62 LKDGDQVIFMI 72

>YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}
          RAD23Protein with ubiquitin-like N terminus, subunit of
          Nuclear Excision Repair Factor 2 (NEF2) with Rad4p that
          binds damaged DNA; enhances protein deglycosylation
          activity of Png1p; also involved, with Rad4p, in
          ubiquitylated protein turnover
          Length = 398

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 37/62 (59%), Gaps = 1/62 (1%)

Query: 11 QNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIAD-DHAVH 69
          + K  + +EP+NT++E K  +++      +  +LIYSGK+L+D +TV    + D D  V 
Sbjct: 11 KEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVF 70

Query: 70 LV 71
          +V
Sbjct: 71 MV 72

>Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa]
          {ON} similar to Ashbya gossypii AFR358W
          Length = 443

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 44/73 (60%), Gaps = 2/73 (2%)

Query: 1  MSITLHIKS-GQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVES 59
          M IT++ K   + K  + + PT T+ E K+ ++K  +   +  ++I+SGK+L+D  T+++
Sbjct: 1  MHITINFKDFKKEKLPLQLSPTATIAEAKQLLAKEKQCDESQLKMIFSGKVLQDGHTLDA 60

Query: 60 YKIAD-DHAVHLV 71
           K+ D D  + ++
Sbjct: 61 CKLKDGDQVIFMI 73

>Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,
          381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}
          UBI4Ubiquitin, becomes conjugated to proteins, marking
          them for selective degradation via the ubiquitin-26S
          proteasome system; essential for the cellular stress
          response; encoded as a polyubiquitin precursor
          comprised of 5 head-to-tail repeats
          Length = 381

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701
          Length = 187

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 46/88 (52%), Gaps = 9/88 (10%)

Query: 1   MSITLHIKSGQNK------WDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDD 54
           + + +HIK    K        + +E ++T+  +K  I     IPP  QRLI++GK L+D 
Sbjct: 53  LLLHIHIKYSFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDG 112

Query: 55  QTVESYKIADDHAVHLV---RSGGPKPA 79
           +T+  Y I  +  +HLV   R G  +P+
Sbjct: 113 RTLSDYNIQKESTLHLVLRLRGGIIEPS 140

>Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YLL039C
          (UBI4)
          Length = 382

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>Suva_10.30 Chr10
          complement(67747..67841,68061..68288,68558..69013,
          69256..69622) [1146 bp, 381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 33/56 (58%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++ K L+D +T+  Y I  +  +HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAEKQLEDGRTLSDYNIQKESTLHLV 374

>KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON}
          highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YLL039c UBI4 ubiquitin
          Length = 381

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 42/71 (59%), Gaps = 2/71 (2%)

Query: 3  ITLHIKS-GQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYK 61
          ++L  K+  + K  + +EP+NT+ E+K  +++      +  +LIYSGK+L+D +TV    
Sbjct: 2  VSLTFKNFKKEKVPLDLEPSNTIFEVKSKLAQSISCEESQIKLIYSGKVLQDSKTVSECG 61

Query: 62 IAD-DHAVHLV 71
          + D D  V +V
Sbjct: 62 LKDGDQVVFMV 72

>Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON}
          complement(16980..18581) [1602 nt, 534 aa]
          Length = 533

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 395 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 450

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 471 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 526

>NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON} 
          Length = 388

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa]
          {ON} highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YLL039c UBI4 ubiquitin
          Length = 460

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 395 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 450

>CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} similar
          to uniprot|P04838 Saccharomyces cerevisiae YLL039c UBI4
          ubiquitin
          Length = 533

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 395 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 450

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 471 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 526

>KAFR0C03000 Chr3 (597127..598320) [1194 bp, 397 aa] {ON} Anc_8.142
           YGL181W
          Length = 397

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 33/49 (67%)

Query: 312 QQPQDNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDAL 360
           Q+  D+   E  Y +Q+RQL +MGF D ++N+ AL++S G++  A+D L
Sbjct: 178 QEVSDDDRYESDYRRQVRQLKEMGFSDSEKNLKALKKSNGNMNRAIDVL 226

>Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 42/71 (59%), Gaps = 2/71 (2%)

Query: 3  ITLHIKS-GQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYK 61
          ++L  K+  + K  + +EP+NT+ E K  +++ +    +  +LIYSGK+L+D +TV    
Sbjct: 2  VSLTFKNFKKEKVPLDLEPSNTIFEAKTKLAQSTSCEESQIKLIYSGKVLQDSKTVSECG 61

Query: 62 IAD-DHAVHLV 71
          + D D  V ++
Sbjct: 62 LKDGDQVVFMI 72

>KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 391

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 37/57 (64%), Gaps = 1/57 (1%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIAD-DHAVHLV 71
          + ++  +T+ E K+ +++  +   +  +LIYSGKIL+DD+T+  YK+ D D  + ++
Sbjct: 16 LELDSGSTISEAKQRLAENKDCDESQIKLIYSGKILQDDRTIADYKLNDGDQVIFMI 72

>NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON}
          Anc_1.480 YEL037C
          Length = 392

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 38/62 (61%), Gaps = 1/62 (1%)

Query: 11 QNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIAD-DHAVH 69
          + K  +++E TNTV++ K  +++      +  +LIYSGK+L+D +T+E   + D D  + 
Sbjct: 11 KEKIPLALESTNTVLDAKTQLAQNKSCEESQIKLIYSGKVLQDAKTLEDCGLKDGDQVIF 70

Query: 70 LV 71
          ++
Sbjct: 71 MI 72

>Ecym_4244 Chr4 complement(507884..508036) [153 bp, 50 aa] {ON}
          similar to Ashbya gossypii AGL185W
          Length = 50

 Score = 36.2 bits (82), Expect = 0.006,   Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 22/34 (64%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGK 49
          + +EP + V  +KE + +   IPPA QRLI+ GK
Sbjct: 15 IDVEPEDRVYSIKELLEEKEGIPPAQQRLIFQGK 48

>NCAS0B04590 Chr2 complement(835478..836821) [1344 bp, 447 aa] {ON}
           Anc_8.142 YGL181W
          Length = 447

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 23/38 (60%)

Query: 323 RYEQQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDAL 360
           +Y +QLR L DMGF D D NV AL    G++   ++ L
Sbjct: 155 KYSRQLRSLKDMGFNDVDNNVEALNICNGNINKTINIL 192

>TBLA0D02210 Chr4 (555236..556927) [1692 bp, 563 aa] {ON} Anc_8.142
           YGL181W
          Length = 563

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 25/38 (65%)

Query: 323 RYEQQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDAL 360
           +Y +QL++LNDMGF + D N  AL  S G +  ALD L
Sbjct: 219 KYSRQLKELNDMGFTNTDNNAEALSISRGDINRALDLL 256

>NDAI0B01850 Chr2 complement(440321..441532) [1212 bp, 403 aa] {ON} 
          Length = 403

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 28/44 (63%), Gaps = 2/44 (4%)

Query: 323 RYEQQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALL--NGD 364
           +Y ++LR+L +MGF D D N  AL  + G + GA+D L   NGD
Sbjct: 166 KYSRELRRLQNMGFRDIDINTEALVLARGDLNGAIDILTQDNGD 209

>CAGL0L06028g Chr12 complement(677581..679098) [1518 bp, 505 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181w GTS1
          Length = 505

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 26/38 (68%)

Query: 323 RYEQQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDAL 360
           +Y ++LRQL ++GF +  +N+ A+  S G V GALD L
Sbjct: 211 KYGRELRQLRELGFTNEQKNIDAITYSHGDVNGALDYL 248

>Kwal_56.23883 s56 complement(755602..755760) [159 bp, 52 aa] {ON}
          YDR139C (RUB1) - ubiquitin-like protein [contig 171]
          FULL
          Length = 52

 Score = 34.7 bits (78), Expect = 0.021,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 1  MSITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGK 49
          M +T+   +G+ +  V ++P++ V  +KE + +   IPP  Q+LI+ GK
Sbjct: 1  MKLTVKTLTGK-EIAVVVDPSDKVYRIKEYLEEKEGIPPTQQKLIFQGK 48

>SAKL0H24772g Chr8 complement(2155837..2157081) [1245 bp, 414 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181W GTS1 Contains a zinc-finger in the N-
           terminus and a long Gln-rich region in the C-terminus
           regulates ultradian rhythm cell size cell cycle lifespan
           sporulation heat tolerance and multidrug transport
          Length = 414

 Score = 37.7 bits (86), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 323 RYEQQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLNGDV 365
           R+  QLR L ++G+ D D NV AL  + G +  ALD +L  DV
Sbjct: 184 RHSHQLRNLKELGYLDTDSNVEALVLARGDINLALD-ILEADV 225

>TDEL0B04690 Chr2 (832571..833899) [1329 bp, 442 aa] {ON} Anc_8.142
           YGL181W
          Length = 442

 Score = 37.4 bits (85), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%)

Query: 323 RYEQQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDAL 360
           RY ++LR L +MG+ D D N  AL  + G +  A+D L
Sbjct: 193 RYSRELRTLKEMGYDDIDHNAEALSHAHGDLNRAIDIL 230

>Smik_7.91 Chr7 (152642..153637,153905..154108) [1200 bp, 399 aa]
           {ON} YGL181W (REAL)
          Length = 399

 Score = 37.4 bits (85), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 26/38 (68%)

Query: 323 RYEQQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDAL 360
           RY +QL +L DMGF D ++N+ AL  + G++  A+D L
Sbjct: 196 RYSRQLLELRDMGFSDANKNLDALSSAHGNINRAIDYL 233

>YGL181W Chr7 (157906..159096) [1191 bp, 396 aa] {ON}  GTS1Protein
           involved in Arf3p regulation and in transcription
           regulation; localizes to the nucleus and to endocytic
           patches; contains an N-terminal Zn-finger and ArfGAP
           homology domain, a C-terminal glutamine-rich region, and
           a UBA (ubiquitin associated) domain; gts1 mutations
           affect budding, cell size, heat tolerance, sporulation,
           life span, ultradian rhythms, endocytosis; expression
           oscillates in a pattern similar to metabolic
           oscillations
          Length = 396

 Score = 37.4 bits (85), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 26/38 (68%)

Query: 323 RYEQQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDAL 360
           RY +QL +L DMGF D ++N+ AL  + G++  A+D L
Sbjct: 194 RYSRQLAELKDMGFGDTNKNLDALSSAHGNINRAIDYL 231

>AGL185W Chr7 (350325..350477) [153 bp, 50 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YDR139C (RUB1)
          Length = 50

 Score = 32.7 bits (73), Expect = 0.095,   Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 21/34 (61%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGK 49
          + + P + V  +KE + +   IPP+ QRLI+ GK
Sbjct: 15 IDVAPEDKVYRIKELLEEQEGIPPSQQRLIFQGK 48

>TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.480
          YEL037C
          Length = 369

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 36/62 (58%), Gaps = 1/62 (1%)

Query: 11 QNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIAD-DHAVH 69
          + K  + +  ++TV+  K+ +++  E   +  +LIYSGK+L+D  ++E   + D D  + 
Sbjct: 11 KQKISLDLPASSTVLHAKKQLAEQKECDDSQIKLIYSGKVLQDSNSIEGCGLKDGDQVIF 70

Query: 70 LV 71
          ++
Sbjct: 71 MI 72

>Suva_2.300 Chr2 complement(528809..528920,529056..529204) [261
          bp, 86 aa] {ON} YDR139C (REAL)
          Length = 86

 Score = 33.9 bits (76), Expect = 0.11,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 24/38 (63%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKD 53
          V ++ ++ V  +KE + +   IPP+ QRLI+ GK + D
Sbjct: 15 VELKESDLVYHIKELLEEKEGIPPSQQRLIFQGKQIVD 52

>Suva_7.81 Chr7 (153418..154434,154933..155121) [1206 bp, 401 aa]
           {ON} YGL181W (REAL)
          Length = 401

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 26/38 (68%)

Query: 323 RYEQQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDAL 360
           RY +QL +L DMGF D ++N+ AL  + G++  A+D L
Sbjct: 194 RYSRQLAELRDMGFNDKNKNLDALSSAHGNLSRAIDYL 231

>NCAS0C04090 Chr3 (833393..834583) [1191 bp, 396 aa] {ON} Anc_8.142
          Length = 396

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 311 QQQPQDNRPPEERYEQQLRQLNDMGF-FDFDRNVAALRRSGGSVQGALDAL 360
           +  P D+R    +Y +QL +L DMG+  D  R   AL R+ G +  +LD +
Sbjct: 186 RHHPHDSRHGRFKYSRQLNELRDMGYSTDTQRIKDALERTHGDINRSLDII 236

>Skud_4.398 Chr4
          complement(705294..705386,705390..705431,
          705435..705581) [282 bp, 94 aa] {ON} YDR139C (REAL)
          Length = 94

 Score = 32.7 bits (73), Expect = 0.28,   Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 22/34 (64%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGK 49
          V ++ ++ V  +KE + +   IPP+ QRLI+ GK
Sbjct: 9  VELKESDLVYHIKELLEEKEGIPPSQQRLIFQGK 42

>Kpol_370.6 s370 (10094..11308) [1215 bp, 404 aa] {ON}
          (10094..11308) [1215 nt, 405 aa]
          Length = 404

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 40/71 (56%), Gaps = 4/71 (5%)

Query: 11 QNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIAD-DHAVH 69
          + K  + +E + TV++ K+ I+   +   +  +LIYSGK+L++D T+    + D D  + 
Sbjct: 11 KEKIPLDLEGSVTVLDAKKQIAVKKDCEDSQIKLIYSGKVLQNDSTIGDCGLKDGDQVIF 70

Query: 70 LV---RSGGPK 77
          ++   +S G K
Sbjct: 71 MISKKKSTGTK 81

>KAFR0B05670 Chr2 complement(1169417..1169441,1169546..1169694)
          [174 bp, 57 aa] {ON} Anc_8.311 YDR139C
          Length = 57

 Score = 31.6 bits (70), Expect = 0.29,   Method: Composition-based stats.
 Identities = 12/34 (35%), Positives = 21/34 (61%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGK 49
          V ++  + +  +KE + +   IPP+ QRLI+ GK
Sbjct: 15 VELDENDRIYHIKELLEEKEGIPPSQQRLIFQGK 48

>KAFR0I02780 Chr9 (560687..561331) [645 bp, 214 aa] {ON} Anc_1.480
          YEL037C
          Length = 214

 Score = 34.3 bits (77), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 2/61 (3%)

Query: 22 NTVIELKEAISKVSEIPPANQR--LIYSGKILKDDQTVESYKIADDHAVHLVRSGGPKPA 79
          +TV +LK  I K  ++        LIYSGK+L+DD T+ S  + D+  + ++    P P 
Sbjct: 22 DTVRDLKHHIVKSHKLVCHTDEISLIYSGKLLQDDATLNSLHLKDNAQIVMLIRRRPSPI 81

Query: 80 A 80
          +
Sbjct: 82 S 82

>Suva_10.31 Chr10 complement(68008..68199) [192 bp, 64 aa] {ON}
          YLR167W (REAL)
          Length = 64

 Score = 31.6 bits (70), Expect = 0.43,   Method: Composition-based stats.
 Identities = 14/36 (38%), Positives = 22/36 (61%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKIL 51
          + +E ++T+  +K  I     IPP  QRLI++GK L
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQL 50

>TBLA0H01310 Chr8 (293921..294136) [216 bp, 71 aa] {ON} Anc_8.311
          YDR139C
          Length = 71

 Score = 31.6 bits (70), Expect = 0.45,   Method: Composition-based stats.
 Identities = 12/34 (35%), Positives = 20/34 (58%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGK 49
          + + P + V  +KE + +   IPP+  RLI+ GK
Sbjct: 15 IEVLPEDKVFHIKELLEQKEGIPPSQLRLIFQGK 48

>Smik_4.383 Chr4 complement(694349..694483,694487..694651) [300
          bp, 100 aa] {ON} YDR139C (REAL)
          Length = 100

 Score = 32.3 bits (72), Expect = 0.47,   Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 21/34 (61%)

Query: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGK 49
          V +  ++ V  +KE + +   IPP+ QRLI+ GK
Sbjct: 15 VELRESDLVYHIKELLEEKEGIPPSQQRLIFQGK 48

>KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 383

 Score = 33.9 bits (76), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 35/72 (48%)

Query: 11 QNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHL 70
          + K  + +    T+   KE I++  +   +  +LIY+GKIL+D +TV    + +   V  
Sbjct: 10 KEKLPIELADDATISHAKELIAEQKQCDASQIKLIYAGKILQDPKTVSGCNLKEGDQVIF 69

Query: 71 VRSGGPKPAASK 82
          + S   K A  K
Sbjct: 70 MISKTKKKADVK 81

>TBLA0B02160 Chr2 complement(496901..498115) [1215 bp, 404 aa]
          {ON} Anc_1.480 YEL037C
          Length = 404

 Score = 33.5 bits (75), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 23/36 (63%), Gaps = 1/36 (2%)

Query: 43 RLIYSGKILKDDQTVESYKIAD-DHAVHLVRSGGPK 77
          +LIYSGKILK+D T+ +  + D DH + ++     K
Sbjct: 43 KLIYSGKILKNDATILNSGLKDNDHIIFMISKKKKK 78

>TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa]
          {ON} Anc_1.480 YEL037C
          Length = 368

 Score = 33.5 bits (75), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 14/62 (22%), Positives = 37/62 (59%), Gaps = 1/62 (1%)

Query: 11 QNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIAD-DHAVH 69
          + K  + ++ +++V++ K  +++  E      +LIYSGK+L+D ++++   + D D  + 
Sbjct: 11 KEKIPLDLDLSSSVLDAKVQLAQKKECEEGQIKLIYSGKVLQDSKSLQESGLKDGDQVIF 70

Query: 70 LV 71
          ++
Sbjct: 71 MI 72

>Kwal_47.18433 s47 (823782..826184) [2403 bp, 800 aa] {ON} YML029W
           (USA1) -  [contig 195] FULL
          Length = 800

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 6/49 (12%)

Query: 12  NKWDVSIEPTNTVIELKEAISKVS----EIPPANQRLIYSGKILKDDQT 56
           N+  VS E   TV+E+KE I  V      + PA+ +LIY G++L D  T
Sbjct: 244 NQMKVSTE--TTVLEMKEFICTVYGHALRLIPADVKLIYKGQLLHDTNT 290

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
          bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 28/47 (59%)

Query: 2  SITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSG 48
          ++  ++K   N + +SI  + TV ELKE + +++ +P + Q+ +  G
Sbjct: 5  TLEFNVKHSGNVYPISITSSTTVQELKEQVQELTNVPVSRQKFMVKG 51

>Skud_7.90 Chr7 (163529..164719) [1191 bp, 396 aa] {ON} YGL181W
           (REAL)
          Length = 396

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 25/38 (65%)

Query: 323 RYEQQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDAL 360
           RY +QL +L DMG+ D  +N+ AL  + G++  ++D L
Sbjct: 194 RYSRQLIELRDMGYNDTAKNLDALSFAHGNINRSIDYL 231

>KNAG0G00510 Chr7 complement(85742..86869) [1128 bp, 375 aa] {ON}
          Anc_1.480 YEL037C
          Length = 375

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 37/74 (50%), Gaps = 2/74 (2%)

Query: 7  IKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQT-VESYKIADD 65
           K  +   DV +E   +V ++KE ++   +      +LI+SGK+L+D +   E+    +D
Sbjct: 9  FKKNKETLDVDLE-HESVKDVKEKLAAARDCDAEQIKLIFSGKVLQDAKPFAETGLKEND 67

Query: 66 HAVHLVRSGGPKPA 79
          H + +V      PA
Sbjct: 68 HVIMMVSKKKSVPA 81

>TPHA0H00400 Chr8 (77122..78522) [1401 bp, 466 aa] {ON} Anc_8.142
           YGL181W
          Length = 466

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 21/38 (55%)

Query: 323 RYEQQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDAL 360
           +Y + ++ L  MG+ D D N  AL  + G +  A+D L
Sbjct: 227 KYSRHIKNLEQMGYTDIDNNAEALSIAHGDINQAIDIL 264

>Kpol_541.50 s541 complement(162130..163665) [1536 bp, 511 aa] {ON}
           complement(162130..163665) [1536 nt, 512 aa]
          Length = 511

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 22/38 (57%)

Query: 323 RYEQQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDAL 360
           RY ++L +L +MGF D D N  A+  + G +  A+  L
Sbjct: 233 RYSRELNRLREMGFNDIDNNAEAMSLANGDISRAITIL 270

>ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 384

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 14/62 (22%), Positives = 35/62 (56%), Gaps = 1/62 (1%)

Query: 11 QNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIAD-DHAVH 69
          + K  + ++P+++V + K  ++       +  +LIYSGK+L+D + ++   + D D  + 
Sbjct: 11 KEKISLELDPSSSVKDAKVRLATEKSCEESQIKLIYSGKVLQDAKNLQESGLKDGDQVIF 70

Query: 70 LV 71
          ++
Sbjct: 71 MI 72

>AGR326C Chr7 complement(1338531..1339139) [609 bp, 202 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR011C
          Length = 202

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 41/69 (59%), Gaps = 5/69 (7%)

Query: 128 LPSADMFGPDGGLTNAPNSDEILNMLDNPIVQSQMNEMLSNPQMVDFM-IQQNPQLQAMG 186
           L S  M  P   +T+A + D+++  L+   V+SQ +E+L++PQ VD   +   P LQ +G
Sbjct: 37  LESLPMTEPVNAVTSA-DRDQLVQWLEA--VKSQFHELLADPQSVDCRGVIDRPMLQGLG 93

Query: 187 PRARELLQS 195
            R ++ +Q+
Sbjct: 94  -RIKDKMQA 101

>AAL082W Chr1 (202080..202093,202146..202761) [630 bp, 209 aa]
          {ON} syntenic homolog of Saccharomyces cerevisiae
          YHR041C (SRB2); 1-intron
          Length = 209

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 31/56 (55%), Gaps = 10/56 (17%)

Query: 3  ITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKIL-KDDQTV 57
          ++ H+ + Q KW           ELK   S +  +PP++ +++YS ++  +D+QTV
Sbjct: 24 LSTHVLAIQEKWS---------FELKTFRSSIKNLPPSDTKVLYSLQLTHRDNQTV 70

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.130    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,090,315
Number of extensions: 1420917
Number of successful extensions: 8862
Number of sequences better than 10.0: 205
Number of HSP's gapped: 8869
Number of HSP's successfully gapped: 275
Length of query: 365
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 254
Effective length of database: 40,753,473
Effective search space: 10351382142
Effective search space used: 10351382142
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 66 (30.0 bits)