Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0D01518g8.838ON57457425830.0
Kwal_27.102728.838ON5514299471e-121
KLTH0C03916g8.838ON5703539121e-115
ABL128W8.838ON4743688381e-105
Ecym_46098.838ON5203797969e-99
KLLA0D01617g8.838ON5623856595e-78
TDEL0B005908.838ON5413606157e-72
ZYRO0G14146g8.838ON5074496076e-71
Kpol_1068.108.838ON6173565534e-62
TPHA0I002308.838ON6143635173e-57
NCAS0B003108.838ON5643454645e-50
Suva_13.298.838ON5093673922e-40
Smik_13.208.838ON5103553886e-40
YML114C (TAF8)8.838ON5103583861e-39
Skud_13.278.838ON5143583861e-39
NDAI0E003008.838ON6644293717e-37
KAFR0A028208.838ON4533323487e-35
TBLA0D032508.838ON6834573461e-33
CAGL0B02299g8.838ON6432292607e-23
KNAG0G034108.838ON5262602275e-19
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0D01518g
         (574 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {...   999   0.0  
Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {...   369   e-121
KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {...   355   e-115
ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic ho...   327   e-105
Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar...   311   9e-99
KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {...   258   5e-78
TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {O...   241   7e-72
ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weak...   238   6e-71
Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {O...   217   4e-62
TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838...   203   3e-57
NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}...   183   5e-50
Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}...   155   2e-40
Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}...   154   6e-40
YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}  T...   153   1e-39
Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}...   153   1e-39
NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}...   147   7e-37
KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.8...   138   7e-35
TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.8...   137   1e-33
CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some s...   104   7e-23
KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.8...    92   5e-19

>SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 574

 Score =  999 bits (2583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/574 (87%), Positives = 501/574 (87%)

Query: 1   MTTEEASHKDAPAPSRKQIRLKKLPTLHAAPHDSLEQPMHKILSQAVAIRLKPMNKDVAM 60
           MTTEEASHKDAPAPSRKQIRLKKLPTLHAAPHDSLEQPMHKILSQAVAIRLKPMNKDVAM
Sbjct: 1   MTTEEASHKDAPAPSRKQIRLKKLPTLHAAPHDSLEQPMHKILSQAVAIRLKPMNKDVAM 60

Query: 61  SQFAFENLVQLVSENLSFMLTTLHRFVDIQRRREISKKDXXXXXKGYDLSNSELMRELES 120
           SQFAFENLVQLVSENLSFMLTTLHRFVDIQRRREISKKD     KGYDLSNSELMRELES
Sbjct: 61  SQFAFENLVQLVSENLSFMLTTLHRFVDIQRRREISKKDLLLLLKGYDLSNSELMRELES 120

Query: 121 SQYIVSNHPEKVNKIAQXXXXXXXXXXXPMTEKELLNSAHSEFFFKDMDILDLVPPTNKN 180
           SQYIVSNHPEKVNKIAQ           PMTEKELLNSAHSEFFFKDMDILDLVPPTNKN
Sbjct: 121 SQYIVSNHPEKVNKIAQKSKELKSKLLKPMTEKELLNSAHSEFFFKDMDILDLVPPTNKN 180

Query: 181 NQYIPKWLPEFPPDHTYRFTSQYNKPVVDERQLRRKLVEEGKQSERALVNLLKHHDSTNQ 240
           NQYIPKWLPEFPPDHTYRFTSQYNKPVVDERQLRRKLVEEGKQSERALVNLLKHHDSTNQ
Sbjct: 181 NQYIPKWLPEFPPDHTYRFTSQYNKPVVDERQLRRKLVEEGKQSERALVNLLKHHDSTNQ 240

Query: 241 DLGNNERVEKRSLYEETQEETFLIFGPERKKSHTTENSHELLRTLPLKNFSVEEYARNRV 300
           DLGNNERVEKRSLYEETQEETFLIFGPERKKSHTTENSHELLRTLPLKNFSVEEYARNRV
Sbjct: 241 DLGNNERVEKRSLYEETQEETFLIFGPERKKSHTTENSHELLRTLPLKNFSVEEYARNRV 300

Query: 301 EIARRKVLEYEQYQLRLQKNPFIKAANLCSPLKKSTMSRKAIDKELKSMLQRSYIGLLRS 360
           EIARRKVLEYEQYQLRLQKNPFIKAANLCSPLKKSTMSRKAIDKELKSMLQRSYIGLLRS
Sbjct: 301 EIARRKVLEYEQYQLRLQKNPFIKAANLCSPLKKSTMSRKAIDKELKSMLQRSYIGLLRS 360

Query: 361 VPKLNEVKXXXXXXXXXXXXXXXXKLNEERQRQAEAXXXXXXXXXXXXXXXXXXAGFDSS 420
           VPKLNEVK                KLNEERQRQAEA                  AGFDSS
Sbjct: 361 VPKLNEVKARERELANERRREMLEKLNEERQRQAEAGGGDEVLDLNNLNEDPLLAGFDSS 420

Query: 421 DSEGEDGEAKALAGNAQHTELEQVEPSQTKSSQEQEQILFEEGEDKRXXXXXXXXXXXXP 480
           DSEGEDGEAKALAGNAQHTELEQVEPSQTKSSQEQEQILFEEGEDKR            P
Sbjct: 421 DSEGEDGEAKALAGNAQHTELEQVEPSQTKSSQEQEQILFEEGEDKRQSQSQSQSQSQQP 480

Query: 481 YVSPIQTQEAGTLLQSSSEAHTTNLSPQLATVAETQIEASISDVSSDYQDGPGAATTAQP 540
           YVSPIQTQEAGTLLQSSSEAHTTNLSPQLATVAETQIEASISDVSSDYQDGPGAATTAQP
Sbjct: 481 YVSPIQTQEAGTLLQSSSEAHTTNLSPQLATVAETQIEASISDVSSDYQDGPGAATTAQP 540

Query: 541 KPSNQELSXXXXXXXXXXXYLFEDVVTNDDSIVF 574
           KPSNQELS           YLFEDVVTNDDSIVF
Sbjct: 541 KPSNQELSDDDDDENDGGGYLFEDVVTNDDSIVF 574

>Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {ON}
           YML114C (TAF8) - TAF65, subunit of transcription factor
           TFIID [contig 37] FULL
          Length = 551

 Score =  369 bits (947), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 193/429 (44%), Positives = 275/429 (64%), Gaps = 9/429 (2%)

Query: 19  IRLKKLPTLHAAPHDSLEQPMHKILSQAVAIRLKPMNKDVAMSQFAFENLVQLVSENLSF 78
           ++LK LPTLH  P   ++ P+ K+L +A+AI+LK +N D ++SQ AFENL+ LV E LS 
Sbjct: 19  VQLKNLPTLHEIPKADMDDPLKKLLEKAIAIQLKSINADASISQLAFENLIILVEEMLSN 78

Query: 79  MLTTLHRFVDIQRRREISKKDXXXXXKGYDLSNSELMRELESSQYIVSNHPEKVNKIAQX 138
           ML  LH+  +IQRR  ISKKD     +GY+LS+S+LM ELE S+Y+ S H E++ K+ + 
Sbjct: 79  MLMDLHKMANIQRRHCISKKDLLLIIEGYNLSSSDLMLELERSRYVRSRHLEQIKKVEED 138

Query: 139 XXXXXXXXXXPMTEKELLNSAHSEFFFKDMDILDLVPPTNKNNQYIPKWLPEFPPDHTYR 198
                     P+T+ ELL+S H EFF  D D+L LVPP+ K+ +++P+WLP+FPPDHTYR
Sbjct: 139 SKYVEKQEHTPLTQNELLSSTHPEFFVLDKDVLTLVPPSVKDTKHVPRWLPDFPPDHTYR 198

Query: 199 FTSQYNKPVVDERQLRRKLVEEGKQSERALVNL--LKHHDSTNQDLGNNERVEKRSLYEE 256
           FT+QYNKP+ DER ++RKL EE   SE+AL++L  L H ++++  + ++      ++YEE
Sbjct: 199 FTAQYNKPITDERLMKRKLAEEANLSEKALIHLSMLSHEEASSGPIDSD------TIYEE 252

Query: 257 TQEETFLIFGPERKKSHTTENS-HELLRTLPLKNFSVEEYARNRVEIARRKVLEYEQYQL 315
            Q+ET L+FGP +KK     N  ++LLRTLP +NFSVEEYARNRVEIARR+V EYE++QL
Sbjct: 253 AQQETQLLFGPVKKKKTAAINEVNDLLRTLPQQNFSVEEYARNRVEIARRRVNEYERHQL 312

Query: 316 RLQKNPFIKAANLCSPLKKSTMSRKAIDKELKSMLQRSYIGLLRSVPKLNEVKXXXXXXX 375
           +LQK  FIKAA+L SP  K   S K ++KE++++L RS IGLL+S P L E +       
Sbjct: 313 QLQKGAFIKAAHLLSPFSKKRTSCKQVEKEIRTLLHRSRIGLLKSAPSLKERRKREIALA 372

Query: 376 XXXXXXXXXKLNEERQRQAEAXXXXXXXXXXXXXXXXXXAGFDSSDSEGEDGEAKALAGN 435
                    KL +ER+ ++++                   G  SSDSE E  + +     
Sbjct: 373 EENRRLRDEKLRKEREARSKSSNEFDVLDLNNLNEDPFFGGLGSSDSEDEQQQEEKATDG 432

Query: 436 AQHTELEQV 444
              +E +Q+
Sbjct: 433 VSESEKQQI 441

>KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 570

 Score =  355 bits (912), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 182/353 (51%), Positives = 251/353 (71%), Gaps = 10/353 (2%)

Query: 17  KQIRLKKLPTLHAAPHDSLEQPMHKILSQAVAIRLKPMNKDVAMSQFAFENLVQLVSENL 76
           K ++L+ LP L   P  +L+ P+ K+L +AVAI+LK +N +V++SQFAFENL+ LV + L
Sbjct: 17  KGVQLRHLPNLEEIPRTALDDPLRKLLEKAVAIQLKAVNSNVSISQFAFENLIILVEQML 76

Query: 77  SFMLTTLHRFVDIQRRREISKKDXXXXXKGYDLSNSELMRELESSQYIVSNHPEKVNKIA 136
           S ML  LH+ V+IQRR  ISKKD      GY+L+ ++LM ELE SQY+ S++ E+V K+ 
Sbjct: 77  SNMLVDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADLMVELERSQYVRSHNLERVRKVR 136

Query: 137 QXXXXXXXXXXXPMTEKELLNSAHSEFFFKDMDILDLVPPTNKNNQYIPKWLPEFPPDHT 196
           +           P++EKELL S H EFF +D +IL LVPPT KN +Y+P+WLPEFPPDHT
Sbjct: 137 EESEVVEAKEKTPLSEKELLESKHLEFFIQDKEILTLVPPTPKNTKYVPRWLPEFPPDHT 196

Query: 197 YRFTSQYNKPVVDERQLRRKLVEEGKQSERALVNL--LKHHDSTNQDLGNNERVEKRSLY 254
           YRFTSQ+N+P+ DER ++RKL EE   SE+AL++L  L H +S ++   ++E      ++
Sbjct: 197 YRFTSQFNRPITDERLMKRKLAEEADLSEKALIHLSKLSHEESPSEGADSDE------IF 250

Query: 255 EETQEETFLIFGPERK-KSHTTENSHELLRTLPLKNFSVEEYARNRVEIARRKVLEYEQY 313
           +E+Q++T LIFGP +K K      + +LLRTLP +N++VEEYARNRVEIARRKV EYE++
Sbjct: 251 KESQQDTQLIFGPAKKTKIAAINGASDLLRTLPQQNYNVEEYARNRVEIARRKVEEYERH 310

Query: 314 QLRLQKNPFIKAANLCSPLKKSTMSRKAIDKELKSMLQRSYIGLLRSVPKLNE 366
           QL LQK  FIKAA+L SP  K     K ++KE++++L RSYIGLL+S P L E
Sbjct: 311 QLLLQKGAFIKAAHLLSPFAKKRNC-KQVEKEVRTLLHRSYIGLLKSAPLLRE 362

>ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML114C (TAF65)
          Length = 474

 Score =  327 bits (838), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 167/368 (45%), Positives = 234/368 (63%), Gaps = 15/368 (4%)

Query: 1   MTTEEASHKDAPAPSRKQIRLKKLPTLHAAPHDSLEQPMHKILSQAVAIRLKPMNKDVAM 60
           MT  E +     A +++ I+LKKLP L      +   PM K+L+QAV + LK M  DV +
Sbjct: 1   MTNGECNGIHNRAGAKEGIQLKKLPDLTEV---TKSNPMQKLLAQAVGLHLKTMRSDVGI 57

Query: 61  SQFAFENLVQLVSENLSFMLTTLHRFVDIQRRREISKKDXXXXXKGYDLSNSELMRELES 120
           +Q  FENLVQ V   L  ML  LHRF ++QRR E+S KD      G  +    L  E   
Sbjct: 58  TQLGFENLVQFVELQLDDMLQILHRFANVQRRNEVSLKDVRLFLHGCGVEEESLYEEYVR 117

Query: 121 SQYIVSNHPEKVNKIAQXXXXXXXXXXXPMTEKELLNSAHSEFFFKDMDILDLVPPTNKN 180
           SQY+   H   V  I +           PM+E+ELL+S+H+EFFFKD+DIL+LVPPTN N
Sbjct: 118 SQYVRQQHAGAVRSIEEQSASLMGHWHQPMSEEELLSSSHAEFFFKDVDILNLVPPTNNN 177

Query: 181 NQYIPKWLPEFPPDHTYRFTSQYNKPVVDERQLRRKLVEEGKQSERALVNLLKHHDSTNQ 240
           N Y+PKWLPEFPPDHTY+FTS YN+P+ DERQ++RKL EE K SE+AL+++L    +T +
Sbjct: 178 NHYVPKWLPEFPPDHTYKFTSIYNQPITDERQMKRKLFEESKLSEKALLHMLG--TATKK 235

Query: 241 DLGNNERVEKRSLYEETQEETFLIFGPERKKSHTTENSHELLRTLPLKNFSVEEYARNRV 300
              ++ ++ +  +  + Q+E  LI+GPER++              P + F++E+YAR RV
Sbjct: 236 PRADDAQLPQ--IISDGQQENLLIYGPERRRLAP--------EPAPTRGFNIEDYARCRV 285

Query: 301 EIARRKVLEYEQYQLRLQKNPFIKAANLCSPLKKSTMSRKAIDKELKSMLQRSYIGLLRS 360
           E+ARR+V E+EQ +L++QKNPFI+AA  CSP   + +SRKAI++E   +L RSYIG+L +
Sbjct: 286 ELARRRVEEFEQQKLQVQKNPFIRAAAACSPYATTRLSRKAIEREFGVLLHRSYIGVLHA 345

Query: 361 VPKLNEVK 368
           +P+L   K
Sbjct: 346 IPRLRRTK 353

>Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar to
           Ashbya gossypii ABL128W
          Length = 520

 Score =  311 bits (796), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 162/379 (42%), Positives = 244/379 (64%), Gaps = 17/379 (4%)

Query: 1   MTTEEASHKDAPAPSRKQIRLKKLPTLH-AAPHDSLEQPMHKILSQAVAIRLKPMNKDVA 59
           MTT+  S   +   +++ I+LKKLP L   A H+    PM  +LSQ+VA++LK M  D +
Sbjct: 1   MTTDIKSSDGSTEGAKEFIQLKKLPGLQEVAKHN----PMQILLSQSVALQLKTMKSDFS 56

Query: 60  MSQFAFENLVQLVSENLSFMLTTLHRFVDIQRRREISKKDXXXXXKGYDLSNSELMRELE 119
           +++  F N++Q +   ++ M   LHRF +IQRR EIS KD     KG  +    L  E E
Sbjct: 57  ITELGFNNMMQFIEMQMNDMFQILHRFANIQRRNEISIKDLKLFLKGTGIEVQSLYDEFE 116

Query: 120 SSQYIVSNHPEKVNKIAQXXXXXXXXXXXPMTEKELLNSAHSEFFFKDMDILDLVPPTNK 179
            S+YI   +  +   I +           P+ ++ELL+S H+EFFFKD+DIL+LVPPTN 
Sbjct: 117 KSRYIKKTYEAEFKNIERQSLDLVEKWQKPLRDEELLSSNHAEFFFKDVDILNLVPPTNI 176

Query: 180 NNQYIPKWLPEFPPDHTYRFTSQYNKPVVDERQLRRKLVEEGKQSERALVNLLKHHDSTN 239
           NN Y+P WLPEFPPDHTY+FT+ YNKP+ DERQ++R L EEGK SE+AL+N+L    +  
Sbjct: 177 NNSYVPTWLPEFPPDHTYKFTAIYNKPISDERQMKRMLFEEGKLSEKALLNMLGSAQAKM 236

Query: 240 QDLGNNERVEKRSLYEETQEETFLIFGPERKK---------SHTTENSHELLRTLPLKNF 290
             + + E + +   Y+E+QEET LI+G E+++          ++T N    L +   K F
Sbjct: 237 LKVEDEETIAQT--YKESQEETQLIYGVEKQRPRRENAYVGGNSTNNDDLPLNSSHSKGF 294

Query: 291 SVEEYARNRVEIARRKVLEYEQYQLRLQKNPFIKAANLCSPLKKS-TMSRKAIDKELKSM 349
           +++EYAR+R+ +ARRKV E+E ++L+ QKNPFI+A+++CSP   +   +RKA ++E   +
Sbjct: 295 NIQEYARSRIGLARRKVEEFENHKLQAQKNPFIRASSICSPYGNAQKTTRKAAEREFNIL 354

Query: 350 LQRSYIGLLRSVPKLNEVK 368
           L+RSY+G+L+S+PKL ++K
Sbjct: 355 LRRSYVGVLKSIPKLRQLK 373

>KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 562

 Score =  258 bits (659), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 149/385 (38%), Positives = 233/385 (60%), Gaps = 23/385 (5%)

Query: 2   TTEEASHKDAPAPS-RKQIRLKKLPTLHAAPHDSLEQPMHKILSQAVAIRLKPMNKDVAM 60
           T+E+    DA   + ++++RL KLP L+  PH     PM ++ +QAV ++LK +NK+V +
Sbjct: 3   TSEDKDKNDAKIETDQRRVRLDKLPNLNEVPH---ANPMERLFAQAVLLQLKTLNKNVVI 59

Query: 61  SQFAFENLVQLVSENLSFMLTTLHRFVDIQRRREISKKDXXXXXKGYDLSNSELMRELES 120
           SQ AF++L  +    L  +L +L +   +QRR +ISK D     KG  +   +L  ++E 
Sbjct: 60  SQLAFDDLCYVSLLQLDDLLQSLKKITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEI 119

Query: 121 SQYIVSNHPEKVNKIAQXXXXXXXXXXXPMTEKELLNSAHSEFFFKDMDILDLVPPTNKN 180
           S ++     ++ N + +            + EKELL+S HSEFF +D+DIL+L+P +NK+
Sbjct: 120 SNFVHGKFKDEANALNETVLKVKQQFMKELEEKELLSSKHSEFFVQDVDILNLLPSSNKS 179

Query: 181 NQYIPKWLPEFPPDHTYRFTSQYNKPVVDERQLRRKLVEEGKQSERALVNLLKHHDSTNQ 240
           N+Y+P WLPE PPDHTY+FTS Y +P+ DER +++KL+EEG+ SE+AL+N+L      NQ
Sbjct: 180 NKYVPSWLPELPPDHTYKFTSLYKRPITDERLMKKKLLEEGRLSEKALLNMLSQ--VVNQ 237

Query: 241 D------LGNNERVEKRSLYE---ETQEETFLIFGPER-----KKSHTTENSH--ELLRT 284
           D        +++     +L E   E+Q ET LIF P +     K+  TT   H  E    
Sbjct: 238 DPLVALNKDSDQSANNAALSEHIKESQLETDLIFDPHKTIPTDKEWGTTTVLHGIESFNL 297

Query: 285 LPLKNFSVEEYARNRVEIARRKVLEYEQYQLRLQKNPFIKAANLCSPL-KKSTMSRKAID 343
            P+KNF+V EY + R  I +R+    E      ++NPFI+ A +CSP  + ST SRK+++
Sbjct: 298 SPVKNFNVLEYCKKRDAIVKRRAERAENQVSNKRRNPFIRGAMICSPYGQGSTKSRKSVE 357

Query: 344 KELKSMLQRSYIGLLRSVPKLNEVK 368
            +LK+ML+RSY+GL+ S+P++ EV+
Sbjct: 358 NQLKTMLRRSYLGLIDSIPRVKEVR 382

>TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {ON}
           Anc_8.838 YML114C
          Length = 541

 Score =  241 bits (615), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 146/360 (40%), Positives = 221/360 (61%), Gaps = 33/360 (9%)

Query: 17  KQIRLKKLPTLHAAPHDSLEQPMHKILSQAVAIRLKPMNKDVAMSQFAFENLVQLVSENL 76
           + I+L  LPTL    H   E  + KILS+AVA++LKPM  D+  S+FAFE+L+ L+ + L
Sbjct: 8   RHIQLTHLPTLDEIDHGKTEAAVVKILSKAVALQLKPMKADI--SKFAFEHLMILIDDQL 65

Query: 77  SFMLTTLHRFVDIQRRREISKKDXXXXXKGYDLSNSELMRELESSQYIVSNHPEKVNKIA 136
           + M+  LHRF ++QRR  I+K D     +GY+L+ ++L ++ ++SQY    + ++ + + 
Sbjct: 66  NDMIGQLHRFSNVQRRESIAKGDVHLFLQGYNLTPADLDKQHQASQYYSKTYGKEFDSL- 124

Query: 137 QXXXXXXXXXXXPMTEKELLNSAHSEFFFKDMDILD-LVPPTNKNNQYIPKWLPEFPPDH 195
                         + KE    A  +      D+++ LV P N   +YIPKW+P FPPDH
Sbjct: 125 -------------HSLKETFTDAVVDEDNGSEDVINELVRPNNPLIRYIPKWMPAFPPDH 171

Query: 196 TYRFTSQYNKPVVDERQLRRKLVEEGKQSERALVNLLKHHD----STNQDLGNNERVEKR 251
           TY+FT QYN+P+ DE  +RR++V+EGKQSE AL++LLK+ +    S++ D  +       
Sbjct: 172 TYKFTPQYNQPITDETIIRRRIVDEGKQSEVALLHLLKNMNPPTPSSDADGAS------- 224

Query: 252 SLYEE--TQEETFLIFGPERKK-SHTTENSHELLRTLPLKNFSVEEYARNRVEIARRKVL 308
             Y+E   +EET  I+G E+KK      +S +LL  LP  NFS+EEYAR+RVEIAR+KV+
Sbjct: 225 --YDEALVREETAAIYGNEQKKRKKNASSSSDLLSKLPQTNFSIEEYARSRVEIARKKVV 282

Query: 309 EYEQYQLRLQKNPFIKAANLCSPLKKSTMSRKAIDKELKSMLQRSYIGLLRSVPKLNEVK 368
           EYE+ Q++LQ+NPFIK + +          R+   +E+ SMLQRS   L++S+P+L   K
Sbjct: 283 EYEERQMKLQRNPFIKYSKIALSNSSDKSGRRQATREIHSMLQRSLQHLIKSIPELQMTK 342

>ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weakly
           similar to uniprot|Q03750 Saccharomyces cerevisiae
           YML114C TAF8 TFIID subunit (65 kDa) involved in RNA
           polymerase II transcription initiation
          Length = 507

 Score =  238 bits (607), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 158/449 (35%), Positives = 243/449 (54%), Gaps = 36/449 (8%)

Query: 19  IRLKKLPTLHAAPHDSLEQPMHKILSQAVAIRLKPMNKDVAMSQFAFENLVQLVSENLSF 78
           I++ KLPTL    H+  E  + K+L+++VA++LKPMN  +  +QFAF+ L+QLV   L+ 
Sbjct: 5   IQITKLPTLQELQHEDREPNVVKVLAKSVALQLKPMNAQI--TQFAFDRLLQLVDGQLND 62

Query: 79  MLTTLHRFVDIQRRREISKKDXXXXXKGYDLSNSELMRELESSQYIVSNHPEKVNKIAQX 138
           M++ LHR  ++QRR  I+K D     +G+++S S +  +   S++    + ++ N +   
Sbjct: 63  MISQLHRMSNLQRRETIAKGDISMLMEGFNISPSSIELQSRISEFYSQKYFKEFNHLH-- 120

Query: 139 XXXXXXXXXXPMTEKELLNS-AHSEFFFKDMDILD------LVPPTNKNNQYIPKWLPEF 191
                       + ++L +S AH    F+D + +       LVPPTN    ++PKWLP+F
Sbjct: 121 ------------SLRDLQSSLAHEMVPFEDQEAVRQNVSTVLVPPTNPLQDFLPKWLPDF 168

Query: 192 PPDHTYRFTSQYNKPVVDERQLRRKLVEEGKQSERALVNLLKHHDSTNQDLGNNERVEKR 251
           PPDHTY+FT QY+ P+ DE  +RR++VEE KQSE AL +L +  + T+ D+ N      R
Sbjct: 169 PPDHTYKFTPQYSHPITDETTIRRQIVEEAKQSELALSHLSQKKNPTD-DIVN------R 221

Query: 252 SLY--EETQEETFLIFGPE---RKKSHTTENSHELLRTLPLKNFSVEEYARNRVEIARRK 306
           S Y  E  ++ET  I+G +   RK  H   NS +LL  LP  NFSVEEYA NR+E+AR+K
Sbjct: 222 SQYDSELAEQETLAIYGSQLKKRKTQHPQANSADLLSKLPQTNFSVEEYAHNRIEVARKK 281

Query: 307 VLEYEQYQLRLQKNPFIKAANLCSPLKKSTMSRKAIDKELKSMLQRSYIGLLRSVPKLNE 366
           VLE+E+ QL+ Q++PF+K + +         ++K + +E +  LQRS+I L++S+P+L  
Sbjct: 282 VLEFEERQLQSQQDPFLKLSRIAFTQCNDKFTKKQVHREFQLALQRSFIHLVKSIPELER 341

Query: 367 VKXXXXXXXXXXXXXXXXKLNEERQRQAEAXXXXXXXXXXXXXXXXXXAGFDSSDSE-GE 425
            K                +L  +R+ Q +                      +SSD E  E
Sbjct: 342 NKLETEEKAKEERSKRLQELRAQREEQEKKGERDVLDLDELDQNQEDFFAMESSDEEVME 401

Query: 426 DGEAKALAGNAQHTELEQVEPSQTKSSQE 454
               K      Q TE  Q EP Q +  QE
Sbjct: 402 PTVDKPPLEQPQQTETAQNEPQQPELIQE 430

>Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {ON}
           complement(18964..20817) [1854 nt, 618 aa]
          Length = 617

 Score =  217 bits (553), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 133/356 (37%), Positives = 203/356 (57%), Gaps = 29/356 (8%)

Query: 17  KQIRLKKLPTLHAAPHDSLEQPMHKILSQAVAIRLKPMNKDVAMSQFAFENLVQLVSENL 76
           K I+L +LPTL    ++  E  + KIL++AVA++LK MN D ++++FAFE+L+ LV   +
Sbjct: 7   KYIQLTELPTLTEYKYEETEPAIEKILAKAVALQLKSMNCDTSITKFAFEHLMSLVVGQI 66

Query: 77  SFMLTTLHRFVDIQRRREISKKDXXXXXKGYDLSNSELMRELESSQYIVSNHP---EKVN 133
             M+  LHR   +QRR  ++K D     +G++L+  +L  + + SQY+   +    E + 
Sbjct: 67  DDMVLELHRLSSLQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYLSKLYDKDYESLT 126

Query: 134 KIAQXXXXXXXXXXX-PMTEKELLNSAHSEFFFKDMDILDLVPPTNKNNQYIPKWLPEFP 192
           KIA              +T K+   +  S+          LVP +N   + IP WLP+FP
Sbjct: 127 KIATTTTRTLSTYQKLDLTHKDTSTAQTSK----------LVPISNPLQKLIPSWLPDFP 176

Query: 193 PDHTYRFTSQYNKPVVDERQLRRKLVEEGKQSERALVNLLK--HHDSTNQDLGNNERVEK 250
           PD+TY+FT QYN P+ DE  +RRK+VEEGKQSE+AL+NLL+    D  ++DL  +     
Sbjct: 177 PDYTYKFTPQYNTPITDETIIRRKVVEEGKQSEKALLNLLRGGQEDRISRDLKFS----- 231

Query: 251 RSLYEETQEETFLIFGPERKKSHTTENSH--ELLRTLPLKN-FSVEEYARNRVEIARRKV 307
            S  E   EET   +      + T  N H        P++N  +VEEYAR RVEI R+KV
Sbjct: 232 SSEMELATEETLATYS-----AITLRNKHLTSFFEKEPIQNSLNVEEYARTRVEIERKKV 286

Query: 308 LEYEQYQLRLQKNPFIKAANLCSPLKKSTMSRKAIDKELKSMLQRSYIGLLRSVPK 363
           L YE+ QL++Q+NPF+K + L S    + +S+   + E++  L+RS +  + S+PK
Sbjct: 287 LGYEERQLQIQRNPFLKISRLISANNDNKVSKSVANTEIRKYLKRSLLNFIHSIPK 342

>TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838
           YML114C
          Length = 614

 Score =  203 bits (517), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 122/363 (33%), Positives = 201/363 (55%), Gaps = 19/363 (5%)

Query: 16  RKQIRLKKLPTLHAAPHDSLEQPMHKILSQAVAIRLKPMNKDVAMSQFAFENLVQLVSEN 75
           +K ++L KLPTL    ++  + PM  IL++A+A++LK MN+D  +++FAF +L  LV E 
Sbjct: 43  KKYVQLTKLPTLTEFKYEDTKGPMEVILAKAIALQLKLMNRDTTITKFAFTHLTSLVDEQ 102

Query: 76  LSFMLTTLHRFVDIQRRREISKKDXXXXXKGYDLSNSELMRELESSQYIVSNHPEKV--- 132
           LS M+  + +   +QRR+E++KKD     +G++L  S+L    + S+YI   +  +V   
Sbjct: 103 LSDMVNQMEKLAALQRRKEVAKKDIDLWLRGFNLQPSDLTITHQQSEYIKEKYGGEVTLL 162

Query: 133 NKIAQXXXXXXXXXXXPMTEKELLNSAHSEFFFKDMDILDLVPPTNKNNQYIPKWLPEFP 192
           N++A              T+K L + +        ++ L LVP TN     IP WLP FP
Sbjct: 163 NRLATDTNEVLTVFKK--TDKTLKDDST-------LETLKLVPITNTLENIIPDWLPSFP 213

Query: 193 PDHTYRFTSQYNKPVVDERQLRRKLVEEGKQSERALVNLLKHHDSTNQDLGNNERVEKRS 252
           PD+TY+FT Q+NK + D   +R+K+  EGK+SE+AL++LL+    T   L N ++ +   
Sbjct: 214 PDYTYKFTPQFNKHITDATVIRKKVAAEGKKSEKALLHLLESEKITTSKLLNLDKFDSDD 273

Query: 253 LYEETQEETFLIFGP---ERKKSHTTENSHELL----RTLPLKNFSVEEYARNRVEIARR 305
           +     E   L  G     +K++   E+  + +           F +E+Y   R+ I R 
Sbjct: 274 MDTAKLEMDALYSGGSCDRKKRTAFFEDEEDRMVDEHGNSTSNKFDIEKYVHKRINIVRN 333

Query: 306 KVLEYEQYQLRLQKNPFIKAANLCSPLKKSTMSRKAIDKELKSMLQRSYIGLLRSVPKLN 365
           KV +YE  QLRLQ +PF+K   L S      +SR+ I+  ++++L+RS++ L+ S+P LN
Sbjct: 334 KVKQYEDKQLRLQNDPFLKMTALLSEQTDKKVSREVINTNIENVLKRSFLQLINSIPTLN 393

Query: 366 EVK 368
           + K
Sbjct: 394 QNK 396

>NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}
           Anc_8.838 YML114C
          Length = 564

 Score =  183 bits (464), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 120/345 (34%), Positives = 192/345 (55%), Gaps = 28/345 (8%)

Query: 31  PHDSLEQPMHKILSQAVAIRLKPMNKDVAMSQFAFENLVQLVSENLSFMLTTLHRFVDIQ 90
           P +S ++ + K+L++++A++LKP+N  + +SQ AF  L  LV++ L F+++ LHR   IQ
Sbjct: 40  PSNSSDEQVRKLLNKSIALQLKPLN--LELSQLAFNELSLLVNDQLDFLISELHRMSVIQ 97

Query: 91  RRREISKKDXXXXXKGYDLSNSELMRELESSQYIVSNHPEKVNKIAQXXXXXXXXXXXPM 150
           RR   +K D     +G +L+ SEL  +L+ S ++ S + +  + + +             
Sbjct: 98  RRNAAAKTDIELLLRGLNLNMSELHYQLQVSNFMKSKNGKDYDTLIKDSSTIFD------ 151

Query: 151 TEKELLNSAHSEFFFKDMDILDLVPPTNKNNQYIPKWLPEFPPDHTYRFTSQYNKPVVDE 210
           +   + N  H        +IL  + P N     IP WLP FPPDHTY+FT Q+NKP+ D+
Sbjct: 152 SSDTMANPGHDSMVNNPSNIL--IKPNNPFEISIPNWLPAFPPDHTYKFTPQFNKPITDQ 209

Query: 211 RQLRRKLVEEGKQSERALVNLLKHHDSTNQDLGNNERVEKRSLYEETQEETFLIFGPE-- 268
             +++KL+EEGK+SE++L+NLL  +D T Q    NE        E  +EE   I+G +  
Sbjct: 210 VLIKQKLIEEGKKSEKSLLNLL--NDITEQSSIENEETSNFD-SELAREENIAIYGYDAM 266

Query: 269 -RKKS--------HTTENSHELLRTLPLKNFSVEEYARNRVEIARRKVLEYEQYQLRLQK 319
            RKK         H TE +         K+F+V  YA  RVE+ R++V E+E  QL+ +K
Sbjct: 267 SRKKRKPPHLISIHDTEQNF-FNHPQGSKHFNVGNYAHFRVELTRKRVEEFELEQLKWEK 325

Query: 320 NPFIKAANLCSPLKKSTMSRKAIDKELKSMLQRSYIGLLRSVPKL 364
           NPF++ + + +  K   +SR  +  E+K+ LQRSY  + R+ PKL
Sbjct: 326 NPFLRLSRMINDKK---VSRSDLKLEIKNSLQRSYKSIFRNYPKL 367

>Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}
           YML114C (REAL)
          Length = 509

 Score =  155 bits (392), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 104/367 (28%), Positives = 189/367 (51%), Gaps = 24/367 (6%)

Query: 6   ASHKDAPAPSRKQIRLKKLPTLHAAPHDSLEQPMHKILSQAVAIRLKPMNKDVAMSQFAF 65
           A+ +     S+  ++L  LP L    H  ++ P+ +IL ++V  +L  +N  + +S FA 
Sbjct: 4   ATPESGSGASQTMVQLTNLPDLTEVSHLEIDAPVLEILKKSVLFQLNSLN--ICISNFAL 61

Query: 66  ENLVQLVSENLSFMLTTLHRFVDIQRRREISKKDXXXXXKGYDLSNSELMRELESSQYIV 125
           + +V LV+  +  M   LH    +QRR ++S+ D     + ++L+++ L ++L+ S++I 
Sbjct: 62  DEMVNLVAVQMDGMFRNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQQLQISEHIK 121

Query: 126 SNHPEKVNKIAQXXXXXXXXXXXPMTEKELLNSAHSEFFFKDMDILDLVPPTNKNNQYIP 185
           S H  +  K+ +              E E+ N    +      +I  L+PP+N   + IP
Sbjct: 122 SKHSVEYEKLVKSSSFTAVSHIEDDEEDEINNIEEQQ-----NEINVLLPPSNPLEKLIP 176

Query: 186 KWLPEFPPDHTYRFTSQYNKPVVDERQLRRKLVEEGKQSERALVNLLKHHDSTNQDLGNN 245
            WLP FPPDHTY+FT ++N P+ D + ++R++V+E  +SERAL+NL             N
Sbjct: 177 SWLPNFPPDHTYKFTPEFNHPITDLKTIKREIVKESGESERALLNL-------------N 223

Query: 246 ERVEKRSLYEETQEETFLIFGPERKKSHTTENS-HELLRTLPLKNF---SVEEYARNRVE 301
           +R+ + S    T            ++     N+ HE    +  K+F   ++E+YA+ R+E
Sbjct: 224 KRLFRISSASHTPSPRLPDASDASERLEIWGNTLHERKPAIIAKSFNEKNIEQYAKYRIE 283

Query: 302 IARRKVLEYEQYQLRLQKNPFIKAANLCSPLKKSTMSRKAIDKELKSMLQRSYIGLLRSV 361
           +AR +V ++E  QL+  KNPF+K +      K    S K I + +   L++S    + ++
Sbjct: 284 LARERVSKFEVNQLKRTKNPFLKISESLYSFKNPHQSHKVIQRSIDLQLRKSVTLFMHNL 343

Query: 362 PKLNEVK 368
           PK+ ++K
Sbjct: 344 PKVQKLK 350

>Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}
           YML114C (REAL)
          Length = 510

 Score =  154 bits (388), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 104/355 (29%), Positives = 183/355 (51%), Gaps = 25/355 (7%)

Query: 19  IRLKKLPTLHAAPHDSLEQPMHKILSQAVAIRLKPMNKDVAMSQFAFENLVQLVSENLSF 78
           ++L++LP L    H  ++ P+ +IL + V  +L  +N  + +S FA + LV LV+  +  
Sbjct: 17  VQLRRLPDLTEISHLEIDAPVVEILKKTVLFQLNSLN--ICISNFALDELVNLVAVQMDG 74

Query: 79  MLTTLHRFVDIQRRREISKKDXXXXXKGYDLSNSELMRELESSQYIVSNHPEKVNKIAQX 138
           M   LH    +QRR E S+ D     + +++  + L ++ + S++I SNH  +  K+ + 
Sbjct: 75  MFRNLHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVSEFIKSNHAVEYGKLVRL 134

Query: 139 XXXXXXXXXXPMTEKELLNSAHSEFFFKDMDILDLVPPTNKNNQYIPKWLPEFPPDHTYR 198
                        E EL N    +      +I  L+PP+N   + IP WLP FPPDHTY+
Sbjct: 135 SSFPALAHNEEDEEDELSNIEEQQ-----SEINVLLPPSNPLEKLIPSWLPNFPPDHTYK 189

Query: 199 FTSQYNKPVVDERQLRRKLVEEGKQSERALVNLLKH--HDSTNQDLGNNERVEKRSLYEE 256
           FT ++N P+ D + +++++V+E ++SE+AL+NL K   H S+         ++     E+
Sbjct: 190 FTPEFNHPITDLKTIKKEIVKESEESEKALLNLNKRLSHLSSASHTSPPPVLDDADATEQ 249

Query: 257 TQEETFLIFG---PERKKSHTTENSHELLRTLPLKNFSVEEYARNRVEIARRKVLEYEQY 313
             E    I+G    ERK + T  +         L   ++E+YA+ RVE+AR +V ++E  
Sbjct: 250 QLE----IWGNALQERKPTITATS---------LNESNIEQYAKYRVELARERVAKFELN 296

Query: 314 QLRLQKNPFIKAANLCSPLKKSTMSRKAIDKELKSMLQRSYIGLLRSVPKLNEVK 368
           QL+  KNPF+K +      +    S K I   +    ++S    + ++PK+ ++K
Sbjct: 297 QLKRTKNPFLKLSETLYFSEGPHQSHKTIQSAIDLQFRKSMTLFMHNLPKVQKLK 351

>YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}
           TAF8TFIID subunit (65 kDa), involved in RNA polymerase
           II transcription initiation
          Length = 510

 Score =  153 bits (386), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 107/358 (29%), Positives = 184/358 (51%), Gaps = 31/358 (8%)

Query: 19  IRLKKLPTLHAAPHDSLEQPMHKILSQAVAIRLKPMNKDVAMSQFAFENLVQLVSENLSF 78
           ++L+ LP L    H  ++ P+ +IL + V  +L  +N  + +S FA + LV LV+  +  
Sbjct: 17  VQLRNLPDLTEISHLEIDAPVVEILKKTVLFQLNSLN--ICISNFALDELVNLVTVQMDG 74

Query: 79  MLTTLHRFVDIQRRREISKKDXXXXXKGYDLSNSELMRELESSQYIVSNHPEKVNKIAQX 138
           M   LH    +QRR + S+ D     + ++L    L ++ ++S++I S H  +  K+   
Sbjct: 75  MFRNLHNLTLLQRRSQASQADLKLLLREFNLDAPSLYQQFQASEFIKSKHSTEYEKLMSW 134

Query: 139 XXXXXXXXXXPMTEKELLNSAHSEFFFKDMDILDLVPPTNKNNQYIPKWLPEFPPDHTYR 198
                        E EL N    +      +I  L+PP+N   + IP WLP FPPDHTY+
Sbjct: 135 SSLAALPHNEEDEEDELNNIEEQQ-----NEINVLLPPSNPLEKQIPSWLPNFPPDHTYK 189

Query: 199 FTSQYNKPVVDERQLRRKLVEEGKQSERALVNL---LKHHDS---TNQDLGNNERVEKRS 252
           FT ++N P+ D + +++++V+E ++SE+AL+NL   L H  S   T Q  G ++      
Sbjct: 190 FTPEFNHPITDLKTIKKEIVKESQESEKALLNLNKSLSHISSASNTPQPPGLDD------ 243

Query: 253 LYEETQEETFLIFGP--ERKKSHTTENSHELLRTLPLKNFSVEEYARNRVEIARRKVLEY 310
             E+  E+   I+G   E +K   TE S            ++E+YA+ RVE+AR +V ++
Sbjct: 244 --EDAIEQQLEIWGNALEERKPTITEKS--------FNENNIEQYAKYRVELARERVTKF 293

Query: 311 EQYQLRLQKNPFIKAANLCSPLKKSTMSRKAIDKELKSMLQRSYIGLLRSVPKLNEVK 368
           E  QL+  KNPF+K +      +    S K I K ++   ++S    + ++PK+ ++K
Sbjct: 294 EVNQLKRTKNPFLKISETLYLPESPHQSHKTIQKTIELQFRKSMTLFMHNLPKVQKLK 351

>Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}
           YML114C (REAL)
          Length = 514

 Score =  153 bits (386), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 106/358 (29%), Positives = 186/358 (51%), Gaps = 25/358 (6%)

Query: 16  RKQIRLKKLPTLHAAPHDSLEQPMHKILSQAVAIRLKPMNKDVAMSQFAFENLVQLVSEN 75
           R  ++LK LP L    H  ++ P+ +IL + V  +L  +  D+ +S FA + LV LV+  
Sbjct: 14  RTLVQLKNLPDLTEISHLKIDAPVVEILRKTVLFQLNSL--DICISNFALDELVNLVAVQ 71

Query: 76  LSFMLTTLHRFVDIQRRREISKKDXXXXXKGYDLSNSELMRELESSQYIVSNHPEKVNKI 135
           +  M   LH    +QRR   ++ D     K ++L  + L ++L+ S++I SNH  +  K+
Sbjct: 72  MDGMFRNLHNLALLQRRSRATQADLKLLFKEFNLDPASLYQQLQISEFIKSNHSVEYEKL 131

Query: 136 AQXXXXXXXXXXXPMTEKELLNSAHSEFFFKDMDILDLVPPTNKNNQYIPKWLPEFPPDH 195
                           E EL N    +      +I  L+PP+N   + +P WLP FPPDH
Sbjct: 132 VSSSSFSASSHNEEDEEDELNNIEEQQ-----NEISVLLPPSNPLEKLMPSWLPNFPPDH 186

Query: 196 TYRFTSQYNKPVVDERQLRRKLVEEGKQSERALVNLLKH--HDSTNQDLGNNERVEKRSL 253
           TYRFT ++N P+ D + ++R++V+E K+SE+AL+NL K   H S    L ++    +   
Sbjct: 187 TYRFTPEFNHPITDLKTIKREIVKESKESEKALLNLNKRLLHIS----LASHAPPPRLPD 242

Query: 254 YEETQEETFLIFG---PERKKSHTTENSHELLRTLPLKNFSVEEYARNRVEIARRKVLEY 310
             +  E+   I+G    E K++  +++ +E          ++E+YA+ RVE+AR +V ++
Sbjct: 243 DADAGEQQLEIWGNALQEEKRTAISKSFNE---------NNIEQYAKYRVELARERVSKF 293

Query: 311 EQYQLRLQKNPFIKAANLCSPLKKSTMSRKAIDKELKSMLQRSYIGLLRSVPKLNEVK 368
           E  QL+  KNPF++ +      K      +AI + +    ++S +    ++PK+ ++K
Sbjct: 294 EVNQLKRTKNPFLRISETLYSSKSPHQPHRAIQRAIDLQFRKSMMLFAHNLPKVQKLK 351

>NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}
           Anc_8.838 YML114C
          Length = 664

 Score =  147 bits (371), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 121/429 (28%), Positives = 195/429 (45%), Gaps = 98/429 (22%)

Query: 32  HDSLEQPMHKILSQAVAIRLKPMNKDVAMSQFAFENLVQLVSENLSFMLTTLHRFVDIQR 91
           H+ ++  + K+L +++AI+LK    D   S+ AF  L  LV + L+ ++T LHR   +QR
Sbjct: 23  HNHMDMQIEKLLQKSIAIQLKAFKVD--FSKLAFNQLTLLVDDQLNSLITELHRLSLLQR 80

Query: 92  RREISKKDXXXXXKGYDLSNSELMRELESSQYIVSNHPEKVNKIAQXXXXXXXXXXXPMT 151
           R  ++K D     +G++++ S+L  + ESS+YI      K  +I +            + 
Sbjct: 81  RNSMAKVDLELWMRGFNINPSDLNYQYESSKYIQEKLSGKEYRILRDLNEEVVKQRTHIM 140

Query: 152 EKELLNSAH--SEFFFKDMDILD----LVPPTNK-NNQYIPKWLPEFPPDHTYRFTSQYN 204
           E    +  +  ++ F    D  D    L+ PTN      I  WLP FPPDHTY+FT Q+N
Sbjct: 141 ESSTSDDNYDLTKQFRNISDATDSSNILIKPTNPFKGINISSWLPSFPPDHTYKFTPQFN 200

Query: 205 KPVVDERQLRRKLVEEGKQSERALVNLLKHHDSTNQDLG------------NNE------ 246
            P+ DE+ +++KLVEEG +SE+AL+N LK+  +  +               +NE      
Sbjct: 201 NPITDEKLIKQKLVEEGTKSEKALLNFLKNISNAKKGTSIAPMTIPPSPSLSNEGPITDT 260

Query: 247 -------RVEKRSLYEET------------QEETFLIFGPERKKSHTTENSHELLRTLPL 287
                  + EK    E+T             EET  I+G + +      +S      + +
Sbjct: 261 DEEEKQAKNEKEKEQEDTVIIPKDIDMNLANEETLAIYGTKSQSYEIERDSSSKPNIISI 320

Query: 288 ---------------KNFSVEEYARNRVEIARRKVLEYEQYQLRLQKNPFIKAANL-C-- 329
                          K F V +Y+ +RVE+ R+KV  +E  +LRL+KNPF+K + L C  
Sbjct: 321 HDEKIVNFFGHSSSDKKFDVNKYSHHRVELVRKKVEAFENKKLRLEKNPFLKLSKLVCLE 380

Query: 330 ------------------------------SPLKKSTMSRKAIDKELKSMLQRSYIGLLR 359
                                         SP++K    R  I+ E+ S L+RS+  +L 
Sbjct: 381 KEDYYDYDNDEDDLEERKNYNNNNDNDNRLSPIRK----RAQINNEIISNLKRSFYSILN 436

Query: 360 SVPKLNEVK 368
           + PKL + K
Sbjct: 437 NYPKLKKAK 445

>KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.838
           YML114C
          Length = 453

 Score =  138 bits (348), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 104/332 (31%), Positives = 168/332 (50%), Gaps = 43/332 (12%)

Query: 39  MHKILSQAVAIRLKPMNKDVAMSQFAFENLVQLVSENLSFMLTTLHRFVDIQRRR-EISK 97
           +  +L ++VA+RLKP+N    +   AF+ L+ L+   L+ ++  L R   +QRR    +K
Sbjct: 26  LDNLLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMDVQLNDLIKQLGRLSLLQRRNSNATK 85

Query: 98  KDXXXXXKGYDLSNSELMRELESSQYIVSNHPEKVNKIAQXXXXXXXXXXXPMTEKELLN 157
            D     KG++LS SEL  ELE S +I   + E   K               ++E  +  
Sbjct: 86  SDILLLLKGFNLSESELNTELEISNHIKRLYSEDEKK---------------LSEDSIHY 130

Query: 158 SAHSEFFFK-DMDILDLVPPTNKNNQYIPKWLPEFPPDHTYRFTSQYNKPVVDERQLRRK 216
           + H++F    +     L+ PTN     IP W P  PPDHTY+FT +YN  + D + +++K
Sbjct: 131 NQHTDFVGPVETSSFQLLNPTNPLKDAIPSWFPSLPPDHTYKFTPKYNNFINDPKIIKQK 190

Query: 217 LVEEGKQSERALVNLLKHHDSTNQDLGNNERVEKRSLYEET--QEETFLIFGPERKKSHT 274
             +E K  + AL NL+   +S      N ER +    Y+ET  + E+  +FG   +K +T
Sbjct: 191 RFDESKTVKTALFNLINKIES------NEERNDLH--YDETLAKLESQALFGTVEEKMNT 242

Query: 275 TENSHELLRTL--PLKNFSVEEYARNRVEIARRKVLEYEQYQLRLQKNPFIKAANLCSPL 332
            +  ++ L ++  P+  F +EEY+  RV IAR KV ++E   L L+ NPFI   N  +  
Sbjct: 243 NKKVYKSLNSIIVPITKFDIEEYSHKRVNIARNKVSKFENKMLALKYNPFINLINDQT-- 300

Query: 333 KKSTMSRKAIDKELKSMLQRSYIGLLRSVPKL 364
                       ++KS L RS+  ++ S+P+L
Sbjct: 301 ------------DVKSYLNRSFQLMINSIPEL 320

>TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.838
           YML114C
          Length = 683

 Score =  137 bits (346), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 129/457 (28%), Positives = 198/457 (43%), Gaps = 128/457 (28%)

Query: 12  PAPSRKQIRLKKLPTLHAAPHDSLEQPMHKILSQAVAIRLKPMNKDVAMSQFAFENLVQL 71
           P  S  Q+ LK LP L  +P+      + ++L++++A++LKPMN + ++S  AF  L+ L
Sbjct: 34  PTSSNTQL-LKNLPDLIQSPNRLESSCIGQLLAKSIALQLKPMNDNTSISTVAFNRLLTL 92

Query: 72  VSENLSFMLTTLHRFVDIQRRREISKKDXXXXXKGYDLSNSELMRELESSQYIVSNHPEK 131
           V   L+ M+  L R    QRR  I+  D     + ++L+ S+L   LE S +I S   + 
Sbjct: 93  VDLQLNDMIYQLARLSITQRRLTIASNDLSLWLRSFNLNPSDLTLYLEESNFIKSKFNKD 152

Query: 132 VNKIAQXXXXXXXXXXXPMTEKELLNSAHSE--FFFKD-----MDILD----------LV 174
            N +                  ELL   ++E    FK+      D+L+          +V
Sbjct: 153 YNLLY-----------------ELLRDYNTETNHNFKNPNYSTSDLLNNKSSESSSSRIV 195

Query: 175 PPTNKNNQYIPKWLPEFPPDHTYRFTSQYNKPVVDERQLRRKLVEEGKQSERALVNLL-- 232
           PP+N   + +P+WLP  PPDHTY+FT  YN+P+ DE  +++ LV EGK +E AL+ LL  
Sbjct: 196 PPSNTILRSMPEWLPSLPPDHTYKFTPLYNEPITDETVMKKILVNEGKLAESALIKLLEA 255

Query: 233 ---------------KHHD---------------------STNQDLGNNERVEKRSLYEE 256
                          + +D                     S N+    NER+    L   
Sbjct: 256 STTSEINSLPTPETDRENDLEQNINIDTNTNGNSMTLKSVSENEKTNTNERLNDELL--- 312

Query: 257 TQEETFLIFGPE---RK----------KSHTTENSHELLRTLPLKNFSVEEYARNRVEIA 303
            Q+ET  I+G     RK              T+ S E +       F+VEEYAR +V+  
Sbjct: 313 AQDETKAIYGSALQVRKIKKRFELMIDPKAETQLSEEFVYP---STFNVEEYARKQVQKI 369

Query: 304 RRKVLEYEQYQLRLQKNPFIKAANLC---------------------------------- 329
           R +VL YE+ QL+ QKNPF K + +                                   
Sbjct: 370 REQVLFYEEKQLQAQKNPFWKYSKMIVGPSQFHHGPHHHHHHHHHHHRRYSNSSTSSVSS 429

Query: 330 --SPLKKSTMSRKAIDKELKSMLQRSYIGLLRSVPKL 364
             SP     +S+K I+ +++ M  RS   L+ S+P L
Sbjct: 430 SPSPGLFGGVSKKQINHDIQQMFNRSLNNLINSLPNL 466

>CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some
           similarities with uniprot|Q03750 Saccharomyces
           cerevisiae YML114c TAF65 TBP Associated Factor
          Length = 643

 Score =  104 bits (260), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 68/229 (29%), Positives = 109/229 (47%), Gaps = 42/229 (18%)

Query: 39  MHKILSQAVAIRLKPMNKDVAMSQFAFENLVQLVSENLSFMLTTLHRFVDIQRRREISKK 98
           M ++L +AV ++L+ ++KDV +++ A + LV    + L+ ++  LHR   +QRR+ I+  
Sbjct: 34  MGELLKRAVGVQLQTIDKDVTVTRMAMDQLVLFAEDQLNALVDGLHRISLLQRRQSIAVS 93

Query: 99  DXXXXXKGYDLSNSELMRELESSQYIVSNHPEKVNKIAQXXXXXXXXXXXPMTEK----- 153
           D     +GY+L  S+L    E S++I  N+    + + +           PM        
Sbjct: 94  DLEIWMRGYNLLPSDLYMTAEESKFIRENYRNDTSVVFKDINIDN-----PMESALGRIN 148

Query: 154 -------------------------ELLNSAHSEFFFKDMDILDLVPPTNKNNQYIPKWL 188
                                    EL   A  + F  D           +N +Y P WL
Sbjct: 149 IQNKENIEPTDNDVDIDEDDDYELIELQQHAMEQLFKTDT-------GRGRNLRYKPGWL 201

Query: 189 PEFPPDHTYRFTSQYNKPVVDERQLRRKLVEEGKQSERALVNLLKHHDS 237
           P+FPPDHTY++T  Y   V  E ++R+KLVEEG+ SE+ALV L+ + DS
Sbjct: 202 PDFPPDHTYKYTPSYVNVVKPETEIRQKLVEEGRLSEKALVKLMSNLDS 250

 Score = 53.5 bits (127), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 47/83 (56%), Gaps = 4/83 (4%)

Query: 284 TLPLKNFSVEEYARNRVEIARRKVLEYEQYQLRLQKNPFIKAANLCSPLKKSTMSRKAID 343
           T  LK+F VE YAR R+EIARRKV+++E  QL L+ NP ++ A     +K         +
Sbjct: 392 TSKLKDFDVEAYARQRIEIARRKVVDFEYEQLYLKYNPLLRLAK----MKYYDAEESDFE 447

Query: 344 KELKSMLQRSYIGLLRSVPKLNE 366
            E +  ++R+     R++P + E
Sbjct: 448 TEYQKCIKRTMDRFKRNIPIIKE 470

>KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.838
           YML114C
          Length = 526

 Score = 92.0 bits (227), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 74/260 (28%), Positives = 125/260 (48%), Gaps = 21/260 (8%)

Query: 77  SFMLTTLHRFVDIQRRREISKKDXXXXXKGYDLSNSELMRELESSQYIVSNHPE-KVNKI 135
           S M+T LHR   +QRR+  +  D     +G+ L+  ++  ++  S+ I  N  +    + 
Sbjct: 79  SGMVTELHRIATVQRRQHATHDDVALLLQGFQLTPEDIEEQMYLSKKIGYNRMQVPREQT 138

Query: 136 AQXXXXXXXXXXXPMTEKELLNSAHSEFFFKDMDILDLVPPTNKNNQYIPKWLPEFPPDH 195
            Q            + E + L ++         D+   +P   K    IP WLP+ PP+H
Sbjct: 139 VQLQDATGSYDRFKLVENQQLIASG----LSGSDMSQELPIAEK----IPAWLPKLPPNH 190

Query: 196 TYRFTSQYNKPVVDERQLRRKLVEEGKQSERALVNLLKHHDSTNQDLGNNERVEKRSLYE 255
           TY+FT++YNK + DE+ L+ K+++E  + E +L NL+++ D  + D   +ER  +    E
Sbjct: 191 TYKFTTEYNKLLNDEKVLKEKIIKESMEIEVSLSNLVRNCDR-DADTKVDERARETPPEE 249

Query: 256 --ETQEETFLIFGPERKKSHTTENSHELLRTLPL---KNFSVEEYARNRVEIARRKVLEY 310
                +E   ++GP  + +   E      RT PL   K+F V+ Y+  RV++AR  V  +
Sbjct: 250 LKRIDDEIVALYGPLEEIAERHEGPRTKRRT-PLYLKKSFDVQAYSLGRVKLARNAVQRF 308

Query: 311 EQYQLRLQKNPFIKAANLCS 330
           E       +NPF     LCS
Sbjct: 309 EWETKYRPRNPF-----LCS 323

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.126    0.342 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,780,426
Number of extensions: 2153090
Number of successful extensions: 7085
Number of sequences better than 10.0: 49
Number of HSP's gapped: 7308
Number of HSP's successfully gapped: 53
Length of query: 574
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 459
Effective length of database: 40,294,809
Effective search space: 18495317331
Effective search space used: 18495317331
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 68 (30.8 bits)