Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0D01496g8.839ON68866431440.0
KLTH0C03894g8.839ON74562123520.0
Kwal_27.102638.839ON74362623490.0
Ecym_46108.839ON75163722880.0
ABL127W8.839ON72863322120.0
KLLA0D01595g8.839ON71963420780.0
TDEL0B005808.839ON71363119680.0
NCAS0C004208.839ON72563719420.0
CAGL0M02959g8.839ON75859519260.0
ZYRO0G14168g8.839ON76463919080.0
KAFR0B039108.839ON72459918860.0
TBLA0D032608.839ON76863118840.0
Kpol_1068.98.839ON74558518500.0
TPHA0I002408.839ON73260018410.0
NDAI0K004208.839ON77869018150.0
Smik_13.4908.839ON73265117670.0
YMR277W (FCP1)8.839ON73265117660.0
KNAG0J002808.839ON74264617670.0
Skud_13.4498.839ON73465517580.0
Suva_13.4658.839ON73265317470.0
NDAI0D018605.202ON51451970.005
SAKL0G12870g5.202ON39960960.006
Kpol_1050.635.94ON1058113960.008
NCAS0A068005.202ON47351900.031
Ecym_20665.94ON88072880.063
Kpol_1010.615.94ON93263870.077
YLR019W (PSR2)5.202ON39745860.080
YLL010C (PSR1)5.202ON42742860.100
TPHA0E030705.202ON49451860.10
Smik_12.825.202ON39245850.11
Smik_12.535.202ON41442850.11
KAFR0E021405.94ON95176860.11
Skud_12.875.202ON39245850.11
Suva_10.655.202ON41542850.12
NDAI0C032305.94ON103488850.14
ZYRO0B10428g5.202ON48240820.25
Skud_12.575.202ON41540800.43
SAKL0H20592g4.156ON50874800.48
SAKL0G15620g5.94ON87998800.58
TBLA0C060905.202ON48451790.65
TPHA0N006705.202ON45241770.99
Suva_10.995.202ON38542771.1
Ecym_72764.156ON593102771.3
KLLA0F15620g5.202ON41460761.3
TPHA0A051105.94ON106570771.4
KNAG0M017405.202ON48145761.5
NDAI0I021705.202ON39140742.2
TPHA0H010705.94ON101579742.8
KAFR0A065604.156ON55549742.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0D01496g
         (688 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {...  1215   0.0  
KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {...   910   0.0  
Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {...   909   0.0  
Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar...   885   0.0  
ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic ho...   856   0.0  
KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {...   805   0.0  
TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {O...   762   0.0  
NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}...   752   0.0  
CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} simil...   746   0.0  
ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} simi...   739   0.0  
KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.8...   731   0.0  
TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.8...   730   0.0  
Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON...   717   0.0  
TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839...   713   0.0  
NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON...   703   0.0  
Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277...   685   0.0  
YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}  FCP1Carbo...   684   0.0  
KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON...   685   0.0  
Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277...   681   0.0  
Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277...   677   0.0  
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202     42   0.005
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...    42   0.006
Kpol_1050.63 s1050 (138268..141444) [3177 bp, 1058 aa] {ON} (138...    42   0.008
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    39   0.031
Ecym_2066 Chr2 complement(110523..113165) [2643 bp, 880 aa] {ON}...    39   0.063
Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932...    38   0.077
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...    38   0.080
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...    38   0.100
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...    38   0.10 
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...    37   0.11 
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...    37   0.11 
KAFR0E02140 Chr5 (426065..428920) [2856 bp, 951 aa] {ON} Anc_5.9...    38   0.11 
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...    37   0.11 
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...    37   0.12 
NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5....    37   0.14 
ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} simila...    36   0.25 
Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {O...    35   0.43 
SAKL0H20592g Chr8 complement(1805321..1806847) [1527 bp, 508 aa]...    35   0.48 
SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some...    35   0.58 
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...    35   0.65 
TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {...    34   0.99 
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...    34   1.1  
Ecym_7276 Chr7 complement(579526..581307) [1782 bp, 593 aa] {ON}...    34   1.3  
KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]...    34   1.3  
TPHA0A05110 Chr1 (1149460..1152657) [3198 bp, 1065 aa] {ON} Anc_...    34   1.4  
KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5....    34   1.5  
NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202     33   2.2  
TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5....    33   2.8  
KAFR0A06560 Chr1 complement(1329583..1331250) [1668 bp, 555 aa] ...    33   2.9  

>SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 688

 Score = 1215 bits (3144), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 595/664 (89%), Positives = 595/664 (89%)

Query: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTSPNDTSTKPKKQR 60
           MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTSPNDTSTKPKKQR
Sbjct: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTSPNDTSTKPKKQR 60

Query: 61  VDLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDVTYGGLCVICGKSVEEY 120
           VDLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDVTYGGLCVICGKSVEEY
Sbjct: 61  VDLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDVTYGGLCVICGKSVEEY 120

Query: 121 SSNSASDPSQNKLTMSHTNTNIKISERQAAAIEETAXXXXXXXXXXXXXXXXXXTVIHCG 180
           SSNSASDPSQNKLTMSHTNTNIKISERQAAAIEETA                  TVIHCG
Sbjct: 121 SSNSASDPSQNKLTMSHTNTNIKISERQAAAIEETAQKQLRKLKKLVLVVDLDQTVIHCG 180

Query: 181 VDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMGPKPPARKCWYYVKLRPGLKE 240
           VDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMGPKPPARKCWYYVKLRPGLKE
Sbjct: 181 VDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMGPKPPARKCWYYVKLRPGLKE 240

Query: 241 FFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSITHKSLERLFPM 300
           FFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSITHKSLERLFPM
Sbjct: 241 FFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSITHKSLERLFPM 300

Query: 301 DQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINSNFLPRQQNSMLHLGRRHRKKAX 360
           DQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINSNFLPRQQNSMLHLGRRHRKKA 
Sbjct: 301 DQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINSNFLPRQQNSMLHLGRRHRKKAE 360

Query: 361 XXXXXXXXXXXXKKLQEKIDEEVKRQEEKLSKMTEEKQPEDTNSKEDLAKKLEHSASLEV 420
                       KKLQEKIDEEVKRQEEKLSKMTEEKQPEDTNSKEDLAKKLEHSASLEV
Sbjct: 361 EEELLTDILDTEKKLQEKIDEEVKRQEEKLSKMTEEKQPEDTNSKEDLAKKLEHSASLEV 420

Query: 421 QQQNRPLAELQKHLHNQKLLIDDDDELPHLSRILLQVHGKYYEDLSKHSSPPNIKNLMPQ 480
           QQQNRPLAELQKHLHNQKLLIDDDDELPHLSRILLQVHGKYYEDLSKHSSPPNIKNLMPQ
Sbjct: 421 QQQNRPLAELQKHLHNQKLLIDDDDELPHLSRILLQVHGKYYEDLSKHSSPPNIKNLMPQ 480

Query: 481 LKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFGAKTTADIDEATTHIITKTPGTFKA 540
           LKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFGAKTTADIDEATTHIITKTPGTFKA
Sbjct: 481 LKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFGAKTTADIDEATTHIITKTPGTFKA 540

Query: 541 RLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYELLIEQPVSXXXXXXXXXXXXXXXXXA 600
           RLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYELLIEQPVS                 A
Sbjct: 541 RLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYELLIEQPVSEEELDDFKKKLENEKKDA 600

Query: 601 QIQEEVDRVSSDEINLLAGNDSWLXXXXXXXXXXXXXXXXXXXXXVSNKRTLPDGEESEN 660
           QIQEEVDRVSSDEINLLAGNDSWL                     VSNKRTLPDGEESEN
Sbjct: 601 QIQEEVDRVSSDEINLLAGNDSWLDNDDDEMDEFLNDDDEDDEKEVSNKRTLPDGEESEN 660

Query: 661 KRVH 664
           KRVH
Sbjct: 661 KRVH 664

>KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 745

 Score =  910 bits (2352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/621 (69%), Positives = 501/621 (80%), Gaps = 3/621 (0%)

Query: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTSPNDTSTKPKKQR 60
           MTT ++LP NLP+P+TIA+LC STGD +KKGQRLF YKYWE QD++T+PN+ + K KK+R
Sbjct: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIITAPNEEAPK-KKRR 59

Query: 61  VDLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDVTYGGLCVICGKSVEEY 120
           VDLIGTFDSPVEG LVS N+ LGDEFVN  +V+AE+ Q C+H+VTYGGLCV+CGK+VEE 
Sbjct: 60  VDLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEVTYGGLCVVCGKTVEED 119

Query: 121 SSN-SASDPSQNKLTMSHTNTNIKISERQAAAIEETAXXXXXXXXXXXXXXXXXXTVIHC 179
             N S +  S +KLT++H NTNIK+SERQAA IE+TA                  TVIHC
Sbjct: 120 DQNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREHKKLVLVVDLDQTVIHC 179

Query: 180 GVDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMGPKPPARKCWYYVKLRPGLK 239
           GVDPTI EW+ DP NPNY+ALK++K+F+L E+PILPPFYMGP+PP RKC YYVKLRPGL+
Sbjct: 180 GVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGPRPPPRKCQYYVKLRPGLQ 239

Query: 240 EFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSITHKSLERLFP 299
           EFF+KIAPHFELHIYTMATRAYALEIAKIIDP G+LFGDRILSRDENGS+THKSLERLFP
Sbjct: 240 EFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRILSRDENGSLTHKSLERLFP 299

Query: 300 MDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINSNFLPRQQNSMLHLGRRHRKKA 359
           MDQSMVVIIDDRGDVW+WCENLIKVVPY+FFVGVGDINSNFLPRQQNSMLHLGRR+RKKA
Sbjct: 300 MDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHLGRRNRKKA 359

Query: 360 XXXXXXXXXXXXXKKLQEKIDEEVKRQEEKLSKMTEEKQPEDTNSKEDLAKKLEHSASLE 419
                        KKLQEKID+EVK+QEEK +K+ EE QPE   SKEDL KKLEH+ASLE
Sbjct: 360 EEEELLTDIMDTEKKLQEKIDQEVKKQEEKFNKINEENQPERPISKEDLTKKLEHNASLE 419

Query: 420 VQQQNRPLAELQKHLHNQKLLIDDDDELPHLSRILLQVHGKYYEDLSKHSSPPNIKNLMP 479
           VQQQNRPLAELQKH++NQKLL DDDDELPHLS ILL VH  YY+ L++   PP+IK LMP
Sbjct: 420 VQQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILLNVHKTYYDKLAEQGQPPDIKTLMP 479

Query: 480 QLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFGAKTTADIDEATTHIITKTPGTFK 539
           Q+K +VF +C FVFSGLIPLGT+VR+ADI LWTSMFGA T+ D+DEATTH+ITKTPGTFK
Sbjct: 480 QMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMFGATTSVDVDEATTHVITKTPGTFK 539

Query: 540 ARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYELLIEQPVSXXXXXXXXXXXXXXXXX 599
           ARLAK +NP IKV+HPDWIFECLV W RV+EK YEL  EQ VS                 
Sbjct: 540 ARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYELTTEQDVSPEELEEFKKRLDKKKQS 599

Query: 600 AQ-IQEEVDRVSSDEINLLAG 619
            + + E + + ++ E+NLL G
Sbjct: 600 EKALSESIQQEATQELNLLTG 620

>Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {ON}
           YMR277W (FCP1) - TFIIF interacting component of CTD
           phosphatase [contig 37] FULL
          Length = 743

 Score =  909 bits (2349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/626 (68%), Positives = 509/626 (81%), Gaps = 3/626 (0%)

Query: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTSPNDTSTKPKKQR 60
           MTT ++LP NLP+PITIA+L  S G+ + KGQRLF YKYWE QDV+T+PN+ ++K KK+R
Sbjct: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQDVITAPNEEASK-KKRR 59

Query: 61  VDLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDVTYGGLCVICGKSVEEY 120
           VDLIGTFDSP+EG LVS  + +GDEFVN ++++AE++Q C+H+VTYG LCV+CGK+V+E 
Sbjct: 60  VDLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEVTYGALCVVCGKAVDED 119

Query: 121 SSN-SASDPSQNKLTMSHTNTNIKISERQAAAIEETAXXXXXXXXXXXXXXXXXXTVIHC 179
            SN S S  S  KLT++H NTNIK+SERQAA+IE+TA                  TVIHC
Sbjct: 120 DSNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRERKKLVLVVDLDQTVIHC 179

Query: 180 GVDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMGPKPPARKCWYYVKLRPGLK 239
           GVDPTI EW+ DP NPNY+ALK++K+F+L E+PILPPFYMGP+PP R+C YYVKLRPGL+
Sbjct: 180 GVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGPRPPPRRCQYYVKLRPGLQ 239

Query: 240 EFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSITHKSLERLFP 299
           EFF+K+APHFELHIYTMATRAYALEIAKIIDP   LFGDRILSRDENGS+THKSLERLFP
Sbjct: 240 EFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGDRILSRDENGSLTHKSLERLFP 299

Query: 300 MDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINSNFLPRQQNSMLHLGRRHRKKA 359
           MDQSMVVIIDDRGDVW+WCENLIKVVPY+FFVGVGDINSNFLPRQQNSMLH+GRRHRKKA
Sbjct: 300 MDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHMGRRHRKKA 359

Query: 360 XXXXXXXXXXXXXKKLQEKIDEEVKRQEEKLSKMTEEKQPEDTNSKEDLAKKLEHSASLE 419
                        KKLQEKID+EVK+QEEK +K++EE QP+ + SKEDL KKLEH+ASLE
Sbjct: 360 EEEELLTDIMDTEKKLQEKIDQEVKKQEEKFNKISEENQPDRSMSKEDLTKKLEHNASLE 419

Query: 420 VQQQNRPLAELQKHLHNQKLLIDDDDELPHLSRILLQVHGKYYEDLSKHSSPPNIKNLMP 479
           VQQQNRPLAELQKH++NQKLLIDDDDELPHLS ILL VH  YYE+L+K    P+IK LMP
Sbjct: 420 VQQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILLNVHRTYYEELAKTEVFPDIKLLMP 479

Query: 480 QLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFGAKTTADIDEATTHIITKTPGTFK 539
           Q+K +VF +C FVFSGLIPLGT++R ADI LWT+MFGA+T++DIDE TTH+ITKTPGTFK
Sbjct: 480 QMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNMFGAQTSSDIDENTTHVITKTPGTFK 539

Query: 540 ARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYELLIEQPVSXXXXXXXXXXXXXXXXX 599
           ARLAK++NP+IK+VHPDWIFECLV W R DEK YEL+IEQ VS                 
Sbjct: 540 ARLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYELIIEQEVSSDELEEFQRNLKKRQMA 599

Query: 600 AQ-IQEEVDRVSSDEINLLAGNDSWL 624
            +  +E + + + +E+NLLAGND WL
Sbjct: 600 EKAARESLQQETGEELNLLAGNDMWL 625

>Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar to
           Ashbya gossypii ABL127W
          Length = 751

 Score =  885 bits (2288), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/637 (66%), Positives = 500/637 (78%), Gaps = 13/637 (2%)

Query: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTSPNDTST--KPKK 58
           M+T ++LPDNLPYPIT+AQL  S GD +++GQRLFAYKYW+F+ +VTSP D S   K K+
Sbjct: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTSPGDESAGGKSKR 60

Query: 59  QRVDLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDVTYGGLCVICGKSVE 118
           QR+DL+GTFDSPV G +VS N++LGDEFVNS   VAEIKQ CTHDVTYGGLCV CG++VE
Sbjct: 61  QRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDVTYGGLCVQCGQTVE 120

Query: 119 EYSSNSASDPSQNKLTMSHTNTNIKISERQAAAIEETAXXXXXXXXXXXXXXXXXXTVIH 178
           +  ++ +   +Q KLTMSHTN NI+ISE+QA  +E++A                  TVIH
Sbjct: 121 DEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLREARKLVLVVDLDQTVIH 180

Query: 179 CGVDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMGPKPPARKCWYYVKLRPGL 238
           CGVDPTIGEWS+DP NPNYE+LKD++SF+L EEP+LPPFYMGPKPP RKCWYYVKLRPGL
Sbjct: 181 CGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMGPKPPTRKCWYYVKLRPGL 240

Query: 239 KEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSITHKSLERLF 298
           ++FF  IAPHFELHIYTMATR YALEIAKIIDPDG LFGDRILSRDENGS+T KSLERLF
Sbjct: 241 QDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGDRILSRDENGSLTQKSLERLF 300

Query: 299 PMDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINSNFLPRQQNSMLHLGRRHRKK 358
           PMDQSMVVIIDDRGDVWNWCENLIKVVPY FFVG+GDINSNFLPRQQNSMLHLGRR+RKK
Sbjct: 301 PMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPRQQNSMLHLGRRNRKK 360

Query: 359 AXXXXXXXXX-XXXXKKLQEKIDEEVKRQEEKLSKMTEEKQPEDTNSKEDLAKKLEHSAS 417
                          KKL+ KI EEVKRQEE++ K++EEK P+ T SKED+AKKLEH+AS
Sbjct: 361 LKQDEELLTDILDTEKKLKVKISEEVKRQEEEMQKLSEEKIPDHTTSKEDIAKKLEHNAS 420

Query: 418 LEVQQQNRPLAELQKHLHNQKLLIDDDDELPHLSRILLQVHGKYYEDL--SKHSS---PP 472
           LEVQQQNRPLAELQKHLHN++LLIDDDDELPHL+ ILL+VH  YY+ L  +KH +    P
Sbjct: 421 LEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTDILLRVHSAYYDQLEKNKHGATELSP 480

Query: 473 NIKNLMPQLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFGAKTTADIDEATTHIIT 532
           +IK+L+P LK+ VF  C+FVFSGLIPL T++ +ADI LWT+ FGAKTT +ID  TTH+IT
Sbjct: 481 DIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAKTTINIDYNTTHLIT 540

Query: 533 KTPGTFKARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYELLIEQPVSXX-----XXX 587
           KTPGT KARLA +FN +IK+VHPDWIFEC+VNWKRVDEK YEL++E+PVS          
Sbjct: 541 KTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEKPYELIVEEPVSKEYLENFKKE 600

Query: 588 XXXXXXXXXXXXAQIQEEVDRVSSDEINLLAGNDSWL 624
                       A I  +     +D + LL G+DSWL
Sbjct: 601 LEETEKSKNSVDANISSQKYETFNDAMILLGGSDSWL 637

>ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR277W (FCP1)
          Length = 728

 Score =  856 bits (2212), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/633 (65%), Positives = 496/633 (78%), Gaps = 20/633 (3%)

Query: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTSPNDT-STKPKKQ 59
           M+T ++LPD+LPYPITIAQL  STGD ++KGQRL AYKYW+  DV+T+P +  + K +KQ
Sbjct: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITAPGEEEAGKARKQ 60

Query: 60  RVDLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDVTYGGLCVICGKSVEE 119
           RVDL+GTFDSPV G +VS ++ +GDEFVNS   V EI+QAC HDVTYGGLCV CG++VE+
Sbjct: 61  RVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDVTYGGLCVQCGQAVED 120

Query: 120 YSSNSASDPSQNKLTMSHTNTNIKISERQAAAIEETAXXXXXXXXXXXXXXXXXXTVIHC 179
             + +A    Q KLT+SHTNT+I++SERQAA++ ++A                  TVIHC
Sbjct: 121 -EAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARKLVLVVDLDQTVIHC 179

Query: 180 GVDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMGPKPPARKCWYYVKLRPGLK 239
           GVDPTIGEWS+DP NPNYEALKD++SF+L EEP+LPPFYMGPKPP RKCWYYVKLRPGLK
Sbjct: 180 GVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPKPPTRKCWYYVKLRPGLK 239

Query: 240 EFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSITHKSLERLFP 299
           EFF KIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGS+T KSLERLFP
Sbjct: 240 EFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSLTQKSLERLFP 299

Query: 300 MDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINSNFLPRQQNSMLHLGRRHRKKA 359
           MDQSMVV+IDDRGDVWNWCENLIKVVPY FFVG+GDINSNFLP QQNSMLHLGRR+RKK 
Sbjct: 300 MDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPIQQNSMLHLGRRNRKKP 359

Query: 360 XXXXXXXXX-XXXXKKLQEKIDEEVKRQEEKLSKMTEEKQPEDTNSKEDLAKKLEHSASL 418
                         KKL+EKI+EEVKRQE+++ ++T+EK P+      D+AKKLEH+ASL
Sbjct: 360 KQEEELLTDILDTEKKLKEKINEEVKRQEDQMHRLTDEKLPD----TRDIAKKLEHNASL 415

Query: 419 EVQQQNRPLAELQKHLHNQKLLIDDDDELPHLSRILLQVHGKYYEDLSKHSSP----PNI 474
           EVQQQNRPLAELQKH+ N++LL DDDDELPHL  ILL+VH  YY+ L +++S     P+I
Sbjct: 416 EVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLKVHSAYYDQLQRYNSGEDPIPDI 475

Query: 475 KNLMPQLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFGAKTTADIDEATTHIITKT 534
           K LMP+LK+ VF  C FVFSGLIPL T++ +ADI LWT+MFGA TTA++D  TTH+IT+T
Sbjct: 476 KILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTNMFGASTTANLDYNTTHLITRT 535

Query: 535 PGTFKARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYELLIEQPVSXXXXXXXXXXXX 594
           PGT KARLAK+FNP IK+VHPDWIFECLV W+RV+E  YEL++E+PV             
Sbjct: 536 PGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESPYELIVEEPVG------EEYLEN 589

Query: 595 XXXXXAQIQEEVDRVSSD---EINLLAGNDSWL 624
                A+ Q++VD  + D    + LL GN SWL
Sbjct: 590 FKRDLAEAQKKVDPPAQDSRSSLLLLDGNGSWL 622

>KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase ,
          Length = 719

 Score =  805 bits (2078), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/634 (62%), Positives = 472/634 (74%), Gaps = 20/634 (3%)

Query: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTSPNDTSTKPKKQR 60
           + T +K+  +LPYPIT+AQL    GD ++KGQRLFAY+YW+FQDV+        K KKQR
Sbjct: 3   LETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVLVK---YEEKTKKQR 59

Query: 61  VDLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDVTYGGLCVICGKSVEEY 120
           VD + TFDSPV G +  ++ S+ DEF ++NH V  I+Q C HD+TYGGLCV CG +V+E 
Sbjct: 60  VDRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDCNHDITYGGLCVQCGNTVDE- 118

Query: 121 SSNSASDPSQNKLTMSHTNTNIKISERQAAAIEETAXXXXXXXXXXXXXXXXXXTVIHCG 180
                 D S+N LT+SH NTNIK+SE+QA  +E ++                  TVIHCG
Sbjct: 119 -----EDNSKN-LTISHVNTNIKVSEQQAETLERSSLTRLREEKKLVLVVDLDQTVIHCG 172

Query: 181 VDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMGPKPPARKCWYYVKLRPGLKE 240
           VDPTIGEW RDPKNPNY+AL+D+KSF L +EPI+P FY GPKPPARK WYYVKLRPGLKE
Sbjct: 173 VDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPKPPARKSWYYVKLRPGLKE 232

Query: 241 FFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSITHKSLERLFPM 300
           FFE ++PHFE+HIYTMATR+YA EIAKIIDP G+LFGDRILSRDENGS+T KSLERLFPM
Sbjct: 233 FFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRILSRDENGSLTTKSLERLFPM 292

Query: 301 DQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINSNFLPRQQNSMLHLGRRHRKKAX 360
           DQSMVV+IDDRGDVWNW ENLIKVVPYSFFVG+GDINSNFLPRQQNS+LHLGR HR+K  
Sbjct: 293 DQSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSNFLPRQQNSVLHLGRHHRRKQE 352

Query: 361 XXXXXXXXXXXXKKLQEKIDEEVKRQEEKLSKMTEEKQPEDTN--SKEDLAKKLEHSASL 418
                       KKL+EKIDEEVKRQEE +S + ++   ++    +KED++KKLEHSASL
Sbjct: 353 EEKLISDIIDNEKKLKEKIDEEVKRQEEIISHIGDDNTRKEGGPPNKEDISKKLEHSASL 412

Query: 419 EVQQQNRPLAELQKHLHNQKLLIDDDDELPHLSRILLQVHGKYYEDLSKH-SSPPNIKNL 477
           EVQQQNRPLAELQKHLHNQ LLIDDDDELPHLS+ILL+VH +Y+   ++   +PP+IK L
Sbjct: 413 EVQQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILLRVHKEYFNQYTEAPKNPPDIKYL 472

Query: 478 MPQLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFGAKTTADIDEATTHIITKTPGT 537
           +PQ+K +VF  C FVFSGLIPL TDVRKADI LWT MFGA T++DI+  TTHIIT T  T
Sbjct: 473 LPQMKYKVFQGCHFVFSGLIPLETDVRKADIVLWTDMFGATTSSDINYKTTHIITTTSRT 532

Query: 538 FKARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYELLIEQPVSXXXXXXXXXXXXXXX 597
           FKARLAK+FNP+IK+VHPDW+FECLV W+RV E  YELLI+ PV                
Sbjct: 533 FKARLAKSFNPDIKIVHPDWLFECLVQWERVKESPYELLIQDPVDEDKVKEFKEKLDKKI 592

Query: 598 XXA-------QIQEEVDRVSSDEINLLAGNDSWL 624
                     +   E + V  DE +LLAGNDSWL
Sbjct: 593 SNPSSSVNPFEDGNEDEEVLGDEFHLLAGNDSWL 626

>TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {ON}
           Anc_8.839 YMR277W
          Length = 713

 Score =  762 bits (1968), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/631 (59%), Positives = 455/631 (72%), Gaps = 13/631 (2%)

Query: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTSPNDTSTKPKKQR 60
           MTT +  P+ LPYPITI QL A  G  ++KGQRLFA+K+W   ++ +SP++     +K+ 
Sbjct: 1   MTTPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSPDENEGGHRKKT 60

Query: 61  V-DLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDVTYGGLCVICGKSVEE 119
           V + I  F++P EG L+S+N+ +GDE V  N  + EI + C HD+ YGGLC +CGK V+E
Sbjct: 61  VRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDIVYGGLCTLCGKEVDE 120

Query: 120 YSSNSASDPSQNKLTMSHTNTNIKISERQAAAIEETAXXXXXXXXXXXXXXXXXXTVIHC 179
                 S+     L +SHT+ N+K+S ++A  IE                     TVIHC
Sbjct: 121 ------SEQFNGNLAISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVVDLDQTVIHC 174

Query: 180 GVDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMGPKPPARKCWYYVKLRPGLK 239
           GVDPTIGEW RD  NPNYEALKD++SFAL EEPILP  YMGPKPP RKCWYYVK+RPGLK
Sbjct: 175 GVDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMGPKPPVRKCWYYVKVRPGLK 234

Query: 240 EFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSITHKSLERLFP 299
           EFF+K+AP FE+HIYTMATRAYALEIAKIIDPDG LFGDRILSRDENGSIT KSLERLFP
Sbjct: 235 EFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRDENGSITQKSLERLFP 294

Query: 300 MDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINSNFLPRQQNSMLHLGRRHRKKA 359
            DQSMVV+IDDRGDVWNWC NLIKVVPY+FFVGVGDINSNFLPRQQN+ML LGR  RKK 
Sbjct: 295 TDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQNTMLQLGRGARKKT 354

Query: 360 XXXXXX-XXXXXXXKKLQEKIDEEVKRQEEKLS-KMTEEKQPEDTNSKEDLAKKLEHSAS 417
                         KKLQEKIDEEVKRQEEKL+ +M   ++     SK+ LAKKLE+SAS
Sbjct: 355 QESDELITDIMDTEKKLQEKIDEEVKRQEEKLNHQMASGEEVPAPESKDQLAKKLEYSAS 414

Query: 418 LEVQQQNRPLAELQKHLHNQKLLIDDDDELPHLSRILLQVHGKYYEDLSKHSS-PPNIKN 476
           LEVQQQNRPLA LQKH+HNQ+LL+DDDDEL +L  IL +VH +YY+ L + S    +IK 
Sbjct: 415 LEVQQQNRPLATLQKHMHNQRLLVDDDDELNYLREILAKVHDEYYKTLGQDSEKKADIKT 474

Query: 477 LMPQLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFGAKTTADIDEATTHIITKTPG 536
           L+P +K +VF  C FVFSGLIPLGT++ +ADI LWT+MFGA+++ +ID++TTH+IT+TPG
Sbjct: 475 LLPLMKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSPEIDDSTTHVITRTPG 534

Query: 537 TFKARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYELLIEQPVSXXXXXXXXXXXXXX 596
           T+KAR+AKAFN  IKVVHPDW+FECLV+WK VDEK YEL++EQ  +              
Sbjct: 535 TYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTATDEELGDYKQKLARR 594

Query: 597 XXXAQIQE---EVDRVSSDEINLLAGNDSWL 624
                 QE    ++   +  INL AG  SWL
Sbjct: 595 SSALAEQEMELAMESAKNGTINLFAGGTSWL 625

>NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}
           Anc_8.839 YMR277W
          Length = 725

 Score =  752 bits (1942), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/637 (59%), Positives = 454/637 (71%), Gaps = 15/637 (2%)

Query: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTSP--NDTSTKP-- 56
           M+T +  P  LPYPITI QL    GD ++KG RL AYK+W   DV +SP  ND S+ P  
Sbjct: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFVVDVASSPDDNDVSSPPTA 60

Query: 57  -KKQRVDLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDVTYGGLCVICGK 115
            KK   + I  F+SP +G L+S+N+ +GDE  + N V+AEI + C HDV YGGLC +CG+
Sbjct: 61  GKKSIRESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDVVYGGLCTLCGE 120

Query: 116 SVEEYSSNSASDPSQNKLTMSHTNTNIKISERQAAAIEETAXXXXXXXXXXXXXXXXXXT 175
            V+E   N AS    N LT+SHT+TN+KIS R+A  I                      T
Sbjct: 121 EVDE-DDNDASGSGAN-LTISHTDTNLKISTREALDIGLNVRTRLRKEKKLVLVVDLDQT 178

Query: 176 VIHCGVDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMGPKPPARKCWYYVKLR 235
           VIHCGVDPTIGEW  DPKNPN+E LKD+K F+L EEPILP  YMGPKPP RKCWYYVK+R
Sbjct: 179 VIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPKPPLRKCWYYVKVR 238

Query: 236 PGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSITHKSLE 295
           PGLKEF EKIAP FE+HIYTMATRAYA EIAKIIDP+G LFGDRILSRDENGS+T KSLE
Sbjct: 239 PGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRILSRDENGSMTTKSLE 298

Query: 296 RLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINSNFLPRQQNSMLHLGRRH 355
           RLFP DQSMV++IDDRGDVWNW  NLIKVVPY+FFVGVGDINSNFLP+QQ +ML LGRR 
Sbjct: 299 RLFPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNFLPKQQATMLQLGRRS 358

Query: 356 RKKAXXXXXXX-XXXXXXKKLQEKIDEEVKRQEEKL---SKMTEEKQPEDTNSKEDLAKK 411
           R+K+              KKL+EKID+EVKRQEE+L   S  TEE       +KE+++KK
Sbjct: 359 REKSKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTEEPPTSAGENKEEISKK 418

Query: 412 LEHSASLEVQQQNRPLAELQKHLHNQKLLIDDDDELPHLSRILLQVHGKYYEDLSKHSS- 470
           +E+SASLEVQQQNRPLA LQKH H+Q+LLIDDDDEL HL   L+++H KYY  L K    
Sbjct: 419 IEYSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVRIHDKYYNVLKKDGEL 478

Query: 471 PPNIKNLMPQLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFGAKTTADIDEATTHI 530
             +IK +MP +K+ V   C FVFSGLIPLGTD+++ADI +WT+ FGA +T+DIDE TTH+
Sbjct: 479 KADIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAISTSDIDEKTTHV 538

Query: 531 ITKTPGTFKARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYELLIEQPVSXXXXXXXX 590
           ITKTPGT+KARLAK+FNP+IK++HPDW+FECL +WK VDEK YEL++EQPVS        
Sbjct: 539 ITKTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYELIVEQPVSETELEEFK 598

Query: 591 XXXXXXXXXAQIQEEV---DRVSSDEINLLAGNDSWL 624
                    A   E +   +  +S E+ L +G  SWL
Sbjct: 599 KKLAKRQLLATANENLSPANGTNSAELELFSGGMSWL 635

>CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277w FCP1
          Length = 758

 Score =  746 bits (1926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/595 (60%), Positives = 441/595 (74%), Gaps = 20/595 (3%)

Query: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTSPNDTST------ 54
           M+T +  P  LPYPIT+ +L    G  ++KGQRLFAYK+W   ++  SP+D         
Sbjct: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDDNDIDYEGPE 60

Query: 55  --KPKKQRVDLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDVTYGGLCVI 112
             K K++  + I  +++P EG L+S+N+   DE    N  V EIK+ C HD+ YGGLC +
Sbjct: 61  IEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDIVYGGLCTM 120

Query: 113 CGKSVEEYSSNSASDPSQNKLTMSHTNTNIKISERQAAAIEETAXXXXXXXXXXXXXXXX 172
           CGK V+EY    A+      LT+SHT+TN+++S ++A  +++                  
Sbjct: 121 CGKEVDEYDQVDAN------LTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLVVDL 174

Query: 173 XXTVIHCGVDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMGPKPPARKCWYYV 232
             TVIHCGVDPTIGEW  DP NPNYE LKD+K F+L EEPILP  YMGPKPP R CWYYV
Sbjct: 175 DQTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMGPKPPVRTCWYYV 234

Query: 233 KLRPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSITHK 292
           K+RPGLKEFFEKIAP +E+HIYTMATRAYALEIAKIIDPD  LFGDRILSRDENGS+T K
Sbjct: 235 KIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTQK 294

Query: 293 SLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINSNFLPRQQNSMLHLG 352
           SL RLFP DQSMVV+IDDRGDVWNWC NLIKVVPY+FFVGVGDINSNFLP+QQ +ML LG
Sbjct: 295 SLTRLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQQTTMLQLG 354

Query: 353 RRHRKKAXXXXXXXXX-XXXXKKLQEKIDEEVKRQEEKLS-KMTEEKQPEDTNSKEDLAK 410
           RR R+K               KKLQEKIDEEVKRQEEKL+ +M   ++  D  SKE +AK
Sbjct: 355 RRTRQKIKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMATAEESTDQESKEKIAK 414

Query: 411 KLEHSASLEVQQQNRPLAELQKHLHNQKLLIDDDDELPHLSRILLQVHGKYY---EDLSK 467
           KLE SASLEVQQQNRPLA+LQKHLH+Q+LLIDDDDEL +L   L  +H ++Y   ED S 
Sbjct: 415 KLEFSASLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHKEFYHLLEDASD 474

Query: 468 HSSPPNIKNLMPQLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFGAKTTADIDEAT 527
            +   +I  L+P+LKK+VF +C FVFSGLIPLGTD+++ADI +WTS+FGA++T+DIDE T
Sbjct: 475 QNE-ADITMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAESTSDIDEHT 533

Query: 528 THIITKTPGTFKARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYELLIEQPVS 582
           TH++TKTPGT+KARLAKAFNP+IKVVHPDWIFECL +WKR+DEK Y L++EQPVS
Sbjct: 534 THVVTKTPGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIVEQPVS 588

>ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277W FCP1
           Carboxy-terminal domain (CTD) phosphatase
          Length = 764

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/639 (56%), Positives = 447/639 (69%), Gaps = 21/639 (3%)

Query: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTSP-----NDTSTK 55
           M T +  P++LPYPITI QL A  G  +KKGQRLFAYK+W   ++ +SP     N  +  
Sbjct: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASSPDENDGNGGAQH 60

Query: 56  PKKQRVDLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDVTYGGLCVICGK 115
            KK   + I  F+SP EG LVS+ +  GDE  ++  V+ EI + C HDV YGGLC +CGK
Sbjct: 61  SKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDVVYGGLCTMCGK 120

Query: 116 SVEEYSSNSASDPSQNKLTMSHTNTNIKISERQAAAIEETAXXXXXXXXXXXXXXXXXXT 175
            V+E      +D  +  L +SHT+TN+K+S ++A  +E                     T
Sbjct: 121 EVDE------NDQMEANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLVVDLDQT 174

Query: 176 VIHCGVDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMGPKPPARKCWYYVKLR 235
           VIHCGVDPTIGEW +DP NPNYE LKD++ F+L EEPI+PP YMGP+ P RKCWY+VK+R
Sbjct: 175 VIHCGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMGPRLPERKCWYFVKVR 234

Query: 236 PGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSITHKSLE 295
           PGL+EFF ++AP +E+HIYTMATR YALEIAKIIDPDG LFGDRILSRDENGS+T KSLE
Sbjct: 235 PGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSRDENGSLTQKSLE 294

Query: 296 RLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINSNFLPRQQNSMLHLGRR- 354
           RLFP DQSMV++IDDRGDVWNWC NLIKVVPY+FFVGVGDINSNFLPRQQ+ +L LGRR 
Sbjct: 295 RLFPTDQSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQSGLLQLGRRT 354

Query: 355 HRKKAXXXXXXXXXXXXXKKLQEKIDEEVKRQEEKLS-KMTEEKQPEDTNSKEDLAKKLE 413
           H+K               K+LQEKIDEEVKRQEEKLS ++T   +P    SKE L KKLE
Sbjct: 355 HKKPQESDELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQLTTNDEPVQGESKEQLTKKLE 414

Query: 414 HSASLEVQQQNRPLAELQKHLHNQKLLIDDDDELPHLSRILLQVHGKYYEDLSK-HSSPP 472
           +SASLEVQQQNRPLA LQKH+HNQ+LL+DDDDEL +L   L ++H KYY+ L + + +  
Sbjct: 415 YSASLEVQQQNRPLATLQKHMHNQRLLVDDDDELYYLKDTLAKIHRKYYKLLDEGNENSA 474

Query: 473 NIKNLMPQLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFGAKTTADIDEATTHIIT 532
           +I++L+P +K +VF  C FVFSGLIPLGT++R+ADI LWT MFGA T+++IDE TTH+IT
Sbjct: 475 DIQSLVPTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITSSEIDENTTHVIT 534

Query: 533 KTPGTFKARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYELLIEQPVSXXXXXXXXXX 592
           KTPGT+KAR+AK FN  +KVVHPDW+FECLV W  VDEK YEL+I+ P +          
Sbjct: 535 KTPGTYKARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDPATEEEIQDFKRK 594

Query: 593 XXXXXXXAQIQEE-------VDRVSSDEINLLAGNDSWL 624
                   + + E       +       +NL AG  SWL
Sbjct: 595 IEQRHLIEEQRREQFESEALMKTAQDSTLNLFAGGTSWL 633

>KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.839
           YMR277W
          Length = 724

 Score =  731 bits (1886), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/599 (60%), Positives = 441/599 (73%), Gaps = 25/599 (4%)

Query: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTSPNDT-------- 52
           MTT +  P+ LPYPITI +L    G  I+KG RLFAYK+W   ++ +SP+D         
Sbjct: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDDNDPANTDTQ 60

Query: 53  STKPKKQRVDLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDVTYGGLCVI 112
           ++ PKK+  + I  FD+P EG L+S+N+ +GDE  +++ V+ EIK+ C HD+ YGGLC  
Sbjct: 61  ASHPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDIVYGGLCTQ 120

Query: 113 CGKSVEEYSSNSASDPSQ--NKLTMSHTNTNIKISERQAAAIEETAXXXXXXXXXXXXXX 170
           CGK V+E      S+ SQ  +  T+SHT+TN+KIS ++A  I E                
Sbjct: 121 CGKEVDE------SEQSQFGSNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVLVV 174

Query: 171 XXXXTVIHCGVDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMGPKPPARKCWY 230
               TVIHCGVDPTIGEW  DP NPNY+ LKD++ FAL EEP+LP  YMGPKP  RKCWY
Sbjct: 175 DLDQTVIHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGPKPTPRKCWY 234

Query: 231 YVKLRPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSIT 290
           YVK+RPGLKEFF+K+AP FE+HIYTMATRAYALEI KIIDP G+LFG+RILSRDENGS+T
Sbjct: 235 YVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILSRDENGSLT 294

Query: 291 HKSLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINSNFLPRQQNSMLH 350
            KSLERLFP DQSMV+IIDDRGDVWNW  NLIKVVPYSFFVGVGDINSNFLP+QQ +ML 
Sbjct: 295 SKSLERLFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLPKQQTTMLQ 354

Query: 351 LGRRHRKKAXXX-XXXXXXXXXXKKLQEKIDEEVKRQEEKLSKM---TEEKQPEDTNSKE 406
           LGRR R+KA              KKLQEKIDEEVKRQE+ LS     TEE    +T  KE
Sbjct: 355 LGRRSREKAKEADELLTDIMDTEKKLQEKIDEEVKRQEKNLSHQVVPTEESVSNET--KE 412

Query: 407 DLAKKLEHSASLEVQQQNRPLAELQKHLHNQKLLIDDDDELPHLSRILLQVHGKYY---E 463
           +  KKLEHSAS+EVQQQNRPLA LQ+HLHNQ+LLIDDDDEL  L   L +VH +YY   E
Sbjct: 413 EWTKKLEHSASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNEYYSILE 472

Query: 464 DLSKHSSPPNIKNLMPQLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFGAKTTADI 523
           + S   S  +IK +MP+LK+ VF  C FVFSGLIPL TD+R+ADI +WTSMFGA+++++I
Sbjct: 473 NKSLDESGADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGAESSSEI 532

Query: 524 DEATTHIITKTPGTFKARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYELLIEQPVS 582
           +E TTH+ITKTPGTFKARLAK+FN +IK+VHPDW+FECL+ W  VDEK Y L++E+P+S
Sbjct: 533 NEVTTHVITKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLIVEEPIS 591

>TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.839
           YMR277W
          Length = 768

 Score =  730 bits (1884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/631 (57%), Positives = 442/631 (70%), Gaps = 55/631 (8%)

Query: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTSPNDT-------- 52
           M+T +  P +LP+PITI QL    G  ++KGQRLFAYK+W   ++  SP++         
Sbjct: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTSENSS 60

Query: 53  ---------------STKPKKQRVDLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIK 97
                          ++  KK   + I  F+SP EG L+ +N+  GDE ++ N ++ +IK
Sbjct: 61  DLSGNNSDSNENGNNASHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDIK 120

Query: 98  QACTHDVTYGGLCVICGKSVEEYSSNSASDPSQNKLTMSHTNTNIKISERQAAAIEETAX 157
           + C HD+ Y G+C  CGK V++      SD     L++SHT+TN+KIS ++A  I++++ 
Sbjct: 121 RPCNHDIVYAGICTQCGKEVDD------SDIMDASLSISHTDTNLKISRKEARDIDQSSM 174

Query: 158 XXXXXXXXXXXXXXXXXTVIHCGVDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPF 217
                            TVIHCGVDPTIGEW  DPKNPNYE LKD++SF+L EEPILPP 
Sbjct: 175 SRLKKIKKLILVVDLDQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPPS 234

Query: 218 YMGPKPPARKCWYYVKLRPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFG 277
           YMGP+PP RKCWYYVK+RPGLKEFF KIAP +E+HIYTMATRAYALEIAKIIDPDG LFG
Sbjct: 235 YMGPRPPVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFG 294

Query: 278 DRILSRDENGSITHKSLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDIN 337
            RILSRDENGS+T KSLERLFP DQSMV+IIDDRGDVWNWC NLIKV+PY+FFVG+GDIN
Sbjct: 295 SRILSRDENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDIN 354

Query: 338 SNFLPRQQNSMLHLG-RRHRKKAXXXXXXXXX----------------------XXXXKK 374
           SNFLPRQQ++ML LG R H+KK                                    KK
Sbjct: 355 SNFLPRQQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEKK 414

Query: 375 LQEKIDEEVKRQEEKLSK--MTEEKQPEDTNSKEDLAKKLEHSASLEVQQQNRPLAELQK 432
           LQ+KIDEEV+RQE+KL K  M + K   D +S  +L+KK+E SASLEVQQQNRPLA LQ+
Sbjct: 415 LQKKIDEEVRRQEKKLIKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLATLQR 474

Query: 433 HLHNQKLLIDDDDELPHLSRILLQVHGKYYEDLSKHSSPP-NIKNLMPQLKKRVFCKCSF 491
           H  NQ+LLIDDDDEL +L  IL +VH  +YE L +  +   +I+ LMP+LK  VF   +F
Sbjct: 475 HRQNQRLLIDDDDELFYLKDILTEVHDTFYEQLDEDKNESVSIQTLMPRLKFSVFSGYNF 534

Query: 492 VFSGLIPLGTDVRKADIALWTSMFGAKTTADIDEATTHIITKTPGTFKARLAKAFNPEIK 551
           VFSGLIPLGTD+R+ADI LWT+MFGA +TADIDE TTH+ITKT GT+KARLAKAFNPEIK
Sbjct: 535 VFSGLIPLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFNPEIK 594

Query: 552 VVHPDWIFECLVNWKRVDEKAYELLIEQPVS 582
           VVHPDWIFECLV+WKR+ EK YEL+IEQP S
Sbjct: 595 VVHPDWIFECLVSWKRMPEKPYELIIEQPAS 625

>Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON}
           complement(15966..18203) [2238 nt, 746 aa]
          Length = 745

 Score =  717 bits (1850), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/585 (59%), Positives = 424/585 (72%), Gaps = 15/585 (2%)

Query: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTSPNDTST-----K 55
           M+T +  P  LPYPITI++L AS G  ++KGQRLFAYK+W   ++  SP++         
Sbjct: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKSPDENDDGVNDEH 60

Query: 56  PKKQRVDLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDVTYGGLCVICGK 115
            KK   + I  FDSP EG LVS+N+ +GDE V  N  + EI + C HD+ Y G+C +CGK
Sbjct: 61  SKKSIRESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDIVYAGICTMCGK 120

Query: 116 SVEEYSSNSASDPSQNKLTMSHTNTNIKISERQAAAIEETAXXXXXXXXXXXXXXXXXXT 175
            V+E    SA+      LT+SHT+TN+K+S R+A  I +                    T
Sbjct: 121 EVDESDQVSAN------LTISHTDTNLKVSRREANDIGQGIKKRLIREKKLILVVDLDQT 174

Query: 176 VIHCGVDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMGPKPPARKCWYYVKLR 235
           VIHCGVDPTI EW  DP NPN+E L+D+KSF L EEPILPP YMGPKPP  KCWYYVK+R
Sbjct: 175 VIHCGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPKPPTHKCWYYVKIR 234

Query: 236 PGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSITHKSLE 295
           PGLKEFFE+++  +E+HIYTMATR+YA EIAKIIDPDG LF DRILSR+ENGS+THKSLE
Sbjct: 235 PGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSRNENGSLTHKSLE 294

Query: 296 RLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINSNFLPRQQNSMLHLGRR- 354
           RLFP DQSMVV+IDDRGDVWNWC NLIKV PY+FFVG+GDINSNFLPRQQ +ML LGRR 
Sbjct: 295 RLFPTDQSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPRQQTTMLQLGRRN 354

Query: 355 HRKKAXXXXXXXXXXXXXKKLQEKIDEEVKRQEEKLSKMTEEKQPEDTNS--KEDLAKKL 412
           H+K               KKLQEKIDEEVKRQEE LS  +     E ++   KED+ KK+
Sbjct: 355 HKKTEDTDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGEEISSQVRKEDITKKI 414

Query: 413 EHSASLEVQQQNRPLAELQKHLHNQKLLIDDDDELPHLSRILLQVHGKYYEDLSKHSSPP 472
           E SASLEVQQQNRPLAELQKH+HNQ+LL DDDDEL +L  IL  V  KYYE+L K     
Sbjct: 415 EFSASLEVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDILKNVQQKYYEEL-KTDKEI 473

Query: 473 NIKNLMPQLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFGAKTTADIDEATTHIIT 532
            I+ LMP+LKK+V   C+FVFSGLIPLGT+++KADI LWT+MFGA+++ADI E TTH+IT
Sbjct: 474 QIQTLMPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQSSADITEDTTHVIT 533

Query: 533 KTPGTFKARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYELLI 577
           KTP T+KA++AKAF  +IKV+HPDW+FECL+NWK + E  YE  I
Sbjct: 534 KTPHTYKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYEYNI 578

>TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839
           YMR277W
          Length = 732

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/600 (57%), Positives = 425/600 (70%), Gaps = 26/600 (4%)

Query: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTSPNDTST------ 54
           M T +K PD +PYPITI++L A  G  I KG RLFAYK+W   ++  SP++         
Sbjct: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60

Query: 55  --KPKKQRVDLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDVTYGGLCVI 112
             + KK   + I  FD+P EG ++ +N+ +GDE V    +V E+K+ C HD+ Y G+C +
Sbjct: 61  GEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTM 120

Query: 113 CGKSVEEYSSNSASDPSQNKLTMSHTNTNIKISERQAAAIEETAXXXXXXXXXXXXXXXX 172
           CGK V+E    SA+      LT+SHT+TN+K+S ++A  I +T                 
Sbjct: 121 CGKEVDERDQVSAN------LTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVDL 174

Query: 173 XXTVIHCGVDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMGPKPPARKCWYYV 232
             TVIHCGVDPTI EW  DP NPNYE L+++KSF L EE ILPP YMGPKPP  KC YYV
Sbjct: 175 DQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYV 234

Query: 233 KLRPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSITHK 292
           K+RPGLKEFFEK+AP +E+HIYTMATRAYA EIAKIIDPDG LFG+RILSRDENGS+THK
Sbjct: 235 KVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTHK 294

Query: 293 SLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINSNFLPRQQNSMLHLG 352
           SLERLFP DQSMVVIIDDRGDVWNW  NLIKV PY+FFVG+GDINSNFLPRQQ +ML +G
Sbjct: 295 SLERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQMG 354

Query: 353 RRHRKKAXXXXXXXXXX---XXXKKLQEKIDEEVKRQEEKLS----KMTEEKQPEDTNSK 405
           RR+                    KKLQEKID+EVKRQE  L+     + EE   +  N  
Sbjct: 355 RRNHNAEKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRNG- 413

Query: 406 EDLAKKLEHSASLEVQQQNRPLAELQKHLHNQKLLIDDDDELPHLSRILLQVHGKYYEDL 465
            D+ KK+E SASLEVQQQNRPLAELQKH+HNQ+LL DDDDEL +L  IL  V  ++Y+ L
Sbjct: 414 -DITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKAL 472

Query: 466 ---SKHSSPPNIKNLMPQLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFGAKTTAD 522
              + +S   +I+ LMP+LK+ VF  C+FVFSGLIPLGTD++KADI LWT MFGA +T++
Sbjct: 473 ELKNGNSDDTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSN 532

Query: 523 IDEATTHIITKTPGTFKARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYELLIEQPVS 582
           I E TTH+ITKTPGT KAR+AK+FNP IKVVHPDW+FECL  WK VDEK++EL ++Q  S
Sbjct: 533 ITENTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVAS 592

>NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON}
           Anc_8.839 YMR277W
          Length = 778

 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/690 (52%), Positives = 451/690 (65%), Gaps = 71/690 (10%)

Query: 3   TALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTSP------------- 49
           T ++ P  LPYPITI +L    G  + K  RL AYK+W   ++ TSP             
Sbjct: 5   TVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIATSPDELEDDNDNDNDN 64

Query: 50  --------------------NDTSTKPKKQRV--------------DLIGTFDSPVEGAL 75
                               N  S +P  +                + I  FD P +G L
Sbjct: 65  DPDGDVDKNTINGNNVTNLTNRPSIEPISRNTITHAHKKKKKKTVRESIEFFDCPYDGIL 124

Query: 76  VSFNLSLGDEFVNSNHVVAEIKQACTHDVTYGGLCVICGKSVEEYSSNSASDPSQNKLTM 135
            S+ +  GD+ V  N  + EI++ C HDV YGGLC +CGK V+E   N   D S   LT+
Sbjct: 125 TSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDE---NDIDDLSGPNLTI 181

Query: 136 SHTNTNIKISERQAAAIEETAXXXXXXXXXXXXXXXXXXTVIHCGVDPTIGEWSRDPKNP 195
           SHT+TN+KIS R+A  I ++                   TVIHCGVDPTIGEW RDP NP
Sbjct: 182 SHTDTNLKISTREAVDIGQSVKKRLRDDKKLILVVDLDQTVIHCGVDPTIGEWKRDPTNP 241

Query: 196 NYEALKDIKSFALVEEPILPPFYMGPKPPARKCWYYVKLRPGLKEFFEKIAPHFELHIYT 255
           N+E LKD+K FAL EEPILP  YMGPKPPARKCWYYVK+RPGLK+FF+K+AP FE+HIYT
Sbjct: 242 NFETLKDVKEFALEEEPILPLMYMGPKPPARKCWYYVKVRPGLKDFFQKVAPLFEMHIYT 301

Query: 256 MATRAYALEIAKIIDPDGKLFGDRILSRDENGSITHKSLERLFPMDQSMVVIIDDRGDVW 315
           MATRAYA EIAKIIDP G LFG+RILSRDENGS+T KSLERLFP DQSMV+IIDDRGDVW
Sbjct: 302 MATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQSMVIIIDDRGDVW 361

Query: 316 NWCENLIKVVPYSFFVGVGDINSNFLPRQQNSMLHLGRRHRKKAXXXXXX------XXXX 369
           NW  NLIKV+PY+FFVGVGDINSNFLP+QQ +ML LGRR  +                  
Sbjct: 362 NWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKVSTKENDDLLTDIM 421

Query: 370 XXXKKLQEKIDEEVKRQEEKLS-KMTEEKQPEDT--NSKEDLAKKLEHSASLEVQQQNRP 426
              K LQ KI+EEVKRQEEKL+ ++   ++P  T   +KE+++KK+E+SASLEVQQ+NRP
Sbjct: 422 DTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKIEYSASLEVQQKNRP 481

Query: 427 LAELQKHLHNQKLLIDDDDELPHLSRILLQVHGKYYEDL-----SKHSSPPNIKNLMPQL 481
           LA LQKH H+Q+LLIDDD+EL HL   L ++H KYYE L     +K S  P+IK +MPQ+
Sbjct: 482 LATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENKDSIEPDIKYIMPQM 541

Query: 482 KKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFGAKTTADIDEATTHIITKTPGTFKAR 541
           K+ V   C FVFSGLIPLGT+++K+DI +WT+MFGA++TADIDE TTH+ITKTPGT+KAR
Sbjct: 542 KQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTTHVITKTPGTYKAR 601

Query: 542 LAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYELLIEQPVSXXXXXXXXXXXXXXXXXAQ 601
           LAK+++P+IK+VHPDW+FECL+ WK V+EK YELL+EQ VS                 ++
Sbjct: 602 LAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELADFNRKLERRIQLSE 661

Query: 602 IQEEV-------DRVSSDEINLLAGNDSWL 624
           +++E          +  +E+NL AG  SWL
Sbjct: 662 LKDEGLYNKLPDGNIDINEVNLFAGGTSWL 691

>Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/651 (53%), Positives = 434/651 (66%), Gaps = 34/651 (5%)

Query: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVT-----------SP 49
           MTT ++ P+ LPYPI I +L  S G  + +G RL  YK+W   +  +           SP
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASETGVDDNEHDASP 60

Query: 50  NDTS-----TKPKKQRVDLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDV 104
              +     + P KQ  + I  F+SP EG L+S+N+ +GDE   +N V+ EIK+ C HD+
Sbjct: 61  GGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120

Query: 105 TYGGLCVICGKSVEEYSSNSASDPSQNKLTMSHTNTNIKISERQAAAIEETAXXXXXXXX 164
            YGGLC  CGK V    S  A D     +     + +++ISE +A    +          
Sbjct: 121 VYGGLCTQCGKEV----SADAFDGVPLDVV---GDMDLQISETEAIRTGKALKEHLRRDK 173

Query: 165 XXXXXXXXXXTVIHCGVDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMGPK-- 222
                     T+IHCGVDPTI EW  DP NPN+E L+D+KSF L EE +LP  YM     
Sbjct: 174 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGS 233

Query: 223 ----PPARKCWYYVKLRPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGD 278
               PP RKCWYYVK+RPGLKEFF K+AP FE+HIYTMATRAYAL+IAKI+DP GKLFGD
Sbjct: 234 VLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGD 293

Query: 279 RILSRDENGSITHKSLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINS 338
           RILSRDENGS+T KSL +LFP DQSMVV+IDDRGDVWNWC NLIKVVPY+FFVGVGDINS
Sbjct: 294 RILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINS 353

Query: 339 NFLPRQQNSMLHLGRRHRKKAXXXXXXXXX-XXXXKKLQEKIDEEVKRQEEKLS-KMTEE 396
           NFLP+Q   ML LGR+ R+K+              KKLQEKID+EVKRQEEKL+ ++   
Sbjct: 354 NFLPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATA 413

Query: 397 KQPEDTNSKEDLAKKLEHSASLEVQQQNRPLAELQKHLHNQKLLIDDDDELPHLSRILLQ 456
           ++P    SKE+L KKLE+SASLEVQQQNRPLA+LQKHLH+QKLL+DDDDEL +L   L  
Sbjct: 414 EEPPANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSN 473

Query: 457 VHGKYYEDLSKHSSP-PNIKNLMPQLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMF 515
           +H  YY+ LS+ + P PN+  ++P LK++VF  C FVFSGLIPLGTD++++DI +WTS F
Sbjct: 474 IHMTYYQMLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTSTF 533

Query: 516 GAKTTADIDEATTHIITKTPGTFKARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYEL 575
           GA +T+DID  TTH+ITK P T+KARLAK FNPEIK+VHPDWIFECLVNWK+VDEK Y L
Sbjct: 534 GATSTSDIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKPYTL 593

Query: 576 LIEQPVSXXXXXXXXXXXXXXXXXAQIQEEVDRV--SSDEINLLAGNDSWL 624
           +++ P+S                  +  +E   +  S + +NL A   SWL
Sbjct: 594 IVDSPISDEELQNFQSQLQKRQEYLEENQEQQHMLTSQENLNLFATGTSWL 644

>YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}
           FCP1Carboxy-terminal domain (CTD) phosphatase, essential
           for dephosphorylation of the repeated C-terminal domain
           of the RNA polymerase II large subunit (Rpo21p)
          Length = 732

 Score =  684 bits (1766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/651 (53%), Positives = 432/651 (66%), Gaps = 34/651 (5%)

Query: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTSPNDTSTK----- 55
           MTT ++ P  LPYPI I +L  S G  + +G RL  YK+W   +  +   D   +     
Sbjct: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDDNEHDVSP 60

Query: 56  -----------PKKQRVDLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDV 104
                      P KQ  + I  F+SP EG L+S+N+ +GDE   +N V+ EIK+ C HD+
Sbjct: 61  GGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120

Query: 105 TYGGLCVICGKSVEEYSSNSASDPSQNKLTMSHTNTNIKISERQAAAIEETAXXXXXXXX 164
            YGGLC  CGK V    S  A D     +     + +++ISE +A    +          
Sbjct: 121 VYGGLCTQCGKEV----SADAFDGVPLDVV---GDVDLQISETEAIRTGKALKEHLRRDK 173

Query: 165 XXXXXXXXXXTVIHCGVDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMGPK-- 222
                     T+IHCGVDPTI EW  DP NPN+E L+D+KSF L EE +LP  YM     
Sbjct: 174 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGS 233

Query: 223 ----PPARKCWYYVKLRPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGD 278
               PP RKCWYYVK+RPGLKEFF K+AP FE+HIYTMATRAYAL+IAKI+DP G+LFGD
Sbjct: 234 MLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGD 293

Query: 279 RILSRDENGSITHKSLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINS 338
           RILSRDENGS+T KSL +LFP DQSMVV+IDDRGDVWNWC NLIKVVPY+FFVGVGDINS
Sbjct: 294 RILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINS 353

Query: 339 NFLPRQQNSMLHLGRRHRKKAXXXXXXXXX-XXXXKKLQEKIDEEVKRQEEKLS-KMTEE 396
           NFLP+Q   ML LGR+ R+K+              KKLQEKID+EVKRQEEKL+ ++   
Sbjct: 354 NFLPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATA 413

Query: 397 KQPEDTNSKEDLAKKLEHSASLEVQQQNRPLAELQKHLHNQKLLIDDDDELPHLSRILLQ 456
           ++P    SKE+L KKLE+SASLEVQQQNRPLA+LQKHLH+QKLL+DDDDEL +L   L  
Sbjct: 414 EEPPANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSN 473

Query: 457 VHGKYYEDLSKHSSP-PNIKNLMPQLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMF 515
           +H  YY+ LS+ + P PN+  ++P LK++VF  C FVFSGLIPLGTD++++DI +WTS F
Sbjct: 474 IHKTYYDMLSQQNEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTF 533

Query: 516 GAKTTADIDEATTHIITKTPGTFKARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYEL 575
           GA +T DID  TTH+ITK P T+KARLAK FNP+IK+VHPDWIFECLVNWK+VDEK Y L
Sbjct: 534 GATSTPDIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYTL 593

Query: 576 LIEQPVSXXXXXX-XXXXXXXXXXXAQIQEEVDRVSSDE-INLLAGNDSWL 624
           +++ P+S                   + QE+   ++S E +NL A   SWL
Sbjct: 594 IVDSPISDEELQNFQTQLQKRQEYLEETQEQQHMLTSQENLNLFAAGTSWL 644

>KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON}
           Anc_8.839 YMR277W
          Length = 742

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/646 (53%), Positives = 434/646 (67%), Gaps = 31/646 (4%)

Query: 10  NLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVT-------SPNDTSTKPKKQRVD 62
            LPYP+T+ +L    GD + +G RLFAYK+W   ++           + T T  KK   +
Sbjct: 14  GLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGVDAAAEGDSDGTGTTAKKSVRE 73

Query: 63  LIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDVTYGGLCVICGKSVEEYSS 122
            +  F+SP EG +VS+++  GDE       +  +++ C HDV Y GLC +CG+ V+EY  
Sbjct: 74  SVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVYNGLCTLCGREVDEYEI 133

Query: 123 NSASDPSQN---KLTMSHTNTNIKISERQAAAIEETAXXXXXXXXXXXXXXXXXXTVIHC 179
            +A+  S      LT+SH +TN++IS  +A  ++                     TV+HC
Sbjct: 134 QAAAAASGGVGPNLTVSHRDTNLQISRVEAQQLDLQLQQRLRAAQKLVLVVDLDQTVVHC 193

Query: 180 GVDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMGPKPPA-RKCWYYVKLRPGL 238
           GVDPTIGEW RDP+NPNYEAL+D++SFAL EEPILP  Y+G K PA RKCWYYVK+RPGL
Sbjct: 194 GVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVGGKRPAPRKCWYYVKVRPGL 253

Query: 239 KEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSITHKSLERLF 298
           K+FF+++AP FE+HIYTMATRAYALEIAKIIDPD  LFGDRILSRDENGS+THKSLERLF
Sbjct: 254 KQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTHKSLERLF 313

Query: 299 PMDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINSNFLPRQQNSMLHLGRR---- 354
           P DQSMV +IDDRGDVWNWC NLIKVVPY+FFVGVGDINSNFLP+QQ +ML +GRR    
Sbjct: 314 PTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDINSNFLPKQQPTMLQMGRRSKLN 373

Query: 355 ---HRKKAXXXXXX-----XXXXXXXKKLQEKIDEEVKRQEEKLSK--MTEEKQPEDTNS 404
              H  K                   K+LQEKID+EVKRQE KL+K     ++Q     S
Sbjct: 374 ERGHESKQQQDDVKDDLLLTDIMNTEKQLQEKIDQEVKRQEHKLNKGNAAGDEQQTPGQS 433

Query: 405 KEDLAKKLEHSASLEVQQQNRPLAELQKHLHNQKLLIDDDDELPHLSRILLQVHGKYYED 464
           KE+  KKLE SAS+EVQQ+NRPLA LQKHLHNQKLL+D+DDEL +L   L  +H +YY  
Sbjct: 434 KEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDNDDELFYLKDRLADLHKRYYST 493

Query: 465 LSKHSSPPNIKNLMPQLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFGAKTTADID 524
           L ++    NI+++M QLK RVF  C FVFSGLIPL T+V+ ADI +WT+ FGA TT D+D
Sbjct: 494 LKENPQDTNIQSIMTQLKTRVFQDCHFVFSGLIPLNTNVQAADIVIWTNKFGATTTNDLD 553

Query: 525 EATTHIITKTPGTFKARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYELLIEQPVSXX 584
           E TTH+ITKTPGT KARLAKAFNP+IK+VHPDWIFECL+ W+RVD K Y L++E PVS  
Sbjct: 554 ETTTHLITKTPGTNKARLAKAFNPDIKIVHPDWIFECLIKWERVDVKPYLLIVEDPVSEA 613

Query: 585 XXXXXXXXXXXXXXXAQIQEE------VDRVSSDEINLLAGNDSWL 624
                          A+ Q         ++ +  +I+L AG  SWL
Sbjct: 614 QVREFKEKLTRQKERAERQTSRTALLPANKPAEPDIDLFAGGISWL 659

>Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277W
           (REAL)
          Length = 734

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/655 (52%), Positives = 435/655 (66%), Gaps = 41/655 (6%)

Query: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTSPNDTSTK----- 55
           MTT ++ P+ LPYPI I +L  S G  + +G RL  YK+W    +V   +DT+       
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWY---LVERASDTTGDDDNEH 57

Query: 56  ---------------PKKQRVDLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQAC 100
                          P KQ  + I  F+SP EG L+S+N+ +GDE   +N V+ EIK+ C
Sbjct: 58  DATPGGGAGSGSVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPC 117

Query: 101 THDVTYGGLCVICGKSVEEYSSNSASDPSQNKLTMSHTNTNIKISERQAAAIEETAXXXX 160
            HD+ YGGLC  CGK V    S  A D     +     + +++ISE +A    E      
Sbjct: 118 NHDIVYGGLCTQCGKEV----SADAFDGVPLDVV---GDMDLQISETEAIRSGEALKEHL 170

Query: 161 XXXXXXXXXXXXXXTVIHCGVDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMG 220
                         T+IHCGVDPTI EW  DP NPN+E L+D+KSF L EE +LP  YM 
Sbjct: 171 RRDKKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMN 230

Query: 221 PK------PPARKCWYYVKLRPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGK 274
                   PP RKCWYYVK+RPGLKEFF+K+AP FE+HIYTMATRAYA++IAKI+DP G+
Sbjct: 231 EDGSVLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGE 290

Query: 275 LFGDRILSRDENGSITHKSLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVG 334
           LFGDRILSRDENGS+T KSL +LFP DQSMVV+IDDRGDVWNWC NLIKVVPY+FFVGVG
Sbjct: 291 LFGDRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVG 350

Query: 335 DINSNFLPRQQNSMLHLGRRHRKKAXXXXXXXXX-XXXXKKLQEKIDEEVKRQEEKLS-K 392
           DINSNFLP+Q   ML LGR+ R+K+              KKLQEKID+EVKRQEEKL+ +
Sbjct: 351 DINSNFLPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQ 410

Query: 393 MTEEKQPEDTNSKEDLAKKLEHSASLEVQQQNRPLAELQKHLHNQKLLIDDDDELPHLSR 452
           +   ++P    SKE+L KKLE+SASLEVQQQNRPLA+LQKHLH+QKLL+DDDDEL +L  
Sbjct: 411 LATAEEPSANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMG 470

Query: 453 ILLQVHGKYYEDLSKHSSP-PNIKNLMPQLKKRVFCKCSFVFSGLIPLGTDVRKADIALW 511
            L  +H  YY+ +S+ + P PN+  ++P LK++VF  C FVFSGLIPLGTD++++DI +W
Sbjct: 471 TLSNIHNTYYQMISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIW 530

Query: 512 TSMFGAKTTADIDEATTHIITKTPGTFKARLAKAFNPEIKVVHPDWIFECLVNWKRVDEK 571
           TS FGA +T+DID  TTH+ITK P T+KARLAK FNPEIK++HPDWIFECLVNWK+VDEK
Sbjct: 531 TSTFGATSTSDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEK 590

Query: 572 AYELLIEQPVSXXXXXXXXXXXXXXXXXAQIQEEVDRVSS--DEINLLAGNDSWL 624
            Y L+++ P+S                  +  ++   + +  + +NL A   SWL
Sbjct: 591 PYTLIVDSPISDEELQNFQKQLQKRQEYLEENQQQQHMLTPQENLNLFAAGTSWL 645

>Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/653 (53%), Positives = 430/653 (65%), Gaps = 39/653 (5%)

Query: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTSPNDTSTKPK--- 57
           MTT ++ P+ LPYPI I +L  S G  +++G RL  YK+W    +V  P+D         
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWY---LVERPSDAGDDDNDHD 57

Query: 58  ---------------KQRVDLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTH 102
                          KQ  + I  F+SP EG L+S+N+ +GDE   +N V+ EIK+ C H
Sbjct: 58  SSPGGGGGGSVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNH 117

Query: 103 DVTYGGLCVICGKSVEEYSSNSASDPSQNKLTMSHTNTNIKISERQAAAIEETAXXXXXX 162
           D+ YGGLC  CGK V    S  A D     +     + +++ISE +A             
Sbjct: 118 DIVYGGLCTQCGKEV----SADAFDGVPLDVV---GDMDLQISETEAIRTGRALKEHLRR 170

Query: 163 XXXXXXXXXXXXTVIHCGVDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMG-- 220
                       T+IHCGVDPTI EW  DP NPN+E L+D+KSF L EE +LP  YM   
Sbjct: 171 DKKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAED 230

Query: 221 ---PKPP-ARKCWYYVKLRPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLF 276
              PKPP  RKCWYYVK+RPGLKEFF K+AP FE+HIYTMATRAYAL+IAKI+DP G+LF
Sbjct: 231 GSVPKPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELF 290

Query: 277 GDRILSRDENGSITHKSLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDI 336
           GDRILSRDENGS+T KSL +LFP DQSMVV+IDDRGDVWNWC NLIKVVPY+FFVGVGDI
Sbjct: 291 GDRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDI 350

Query: 337 NSNFLPRQQNSMLHLGRRHRKKAXXXXXX-XXXXXXXKKLQEKIDEEVKRQEEKLS-KMT 394
           NSNFLP+Q   ML LGR+ R+K+              KKLQEKID EVKRQEE+L+ ++ 
Sbjct: 351 NSNFLPKQSTGMLQLGRKTRQKSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNHQLA 410

Query: 395 EEKQPEDTNSKEDLAKKLEHSASLEVQQQNRPLAELQKHLHNQKLLIDDDDELPHLSRIL 454
             ++P    SKE+L KKLE+SASLEVQQQNRPLA+LQKHLH+QKLL+DDDDEL +L   L
Sbjct: 411 TAEEPSANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELHYLMSTL 470

Query: 455 LQVHGKYYEDLSKHSS-PPNIKNLMPQLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTS 513
           L +H  YY+ LS+     PN+  ++P LK++VF  C FVFSGLIPLGTD++++DI +WTS
Sbjct: 471 LNIHKTYYQMLSQPGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTS 530

Query: 514 MFGAKTTADIDEATTHIITKTPGTFKARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAY 573
            FGA +T+DI+  TTH+ITK PGT+KARLAK FNPEIKVVHPDWIFECLVNWK+VDEK Y
Sbjct: 531 TFGATSTSDINYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPY 590

Query: 574 ELLIEQPVSXXXXXXXXXXXXXXXXXAQIQEEVDR--VSSDEINLLAGNDSWL 624
            L+++ P+S                      E     +  + INL A   SWL
Sbjct: 591 TLIVDSPISDDELQSFQKQLQKKQEYLDEHHEQQHMLMPQENINLFAAGTSWL 643

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%)

Query: 231 YVKLRPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRIL 281
           YV  RPG+ EF EK+   FE+ I+T +   Y   +   +DP GK    R+ 
Sbjct: 381 YVIKRPGVDEFLEKVGKLFEVVIFTASVSRYGDPLLDRLDPKGKSIHHRLF 431

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 4/60 (6%)

Query: 231 YVKLRPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDG----KLFGDRILSRDEN 286
           YV  RPG+ EF E++   +E+ ++T +   Y   +  I+DP G    +LF D   + D N
Sbjct: 267 YVIKRPGVDEFLERVGKLYEVVVFTASVSRYGDPLLDILDPRGAVHHRLFRDSCYNYDGN 326

>Kpol_1050.63 s1050 (138268..141444) [3177 bp, 1058 aa] {ON}
           (138268..141444) [3177 nt, 1059 aa]
          Length = 1058

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 50/113 (44%), Gaps = 4/113 (3%)

Query: 461 YYEDLSKHSSPPNIKNLMPQLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFGAKTT 520
           Y  +L K   P NI  +    KK VF K   + +     G   ++  I   T+  G  TT
Sbjct: 321 YLLNLKKFQKPENI--MYHPYKKSVFNKDELILTYTNLFGP--QRTYIKTLTNALGGVTT 376

Query: 521 ADIDEATTHIITKTPGTFKARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAY 573
           A +      ++   P   K + A+ +  ++ +V P+W+ EC    K++D K +
Sbjct: 377 ATLSHINNCLVYGIPEGMKYKTAEKWGDKLIIVGPNWLEECYKANKKLDPKLF 429

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (56%)

Query: 231 YVKLRPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRIL 281
           YV  RPG++EF +++   FE+ ++T +   Y   +  I+DP  +L   R+ 
Sbjct: 340 YVIKRPGVEEFLKRVGELFEVVVFTASVARYGDPLLDILDPGRQLIHHRLF 390

>Ecym_2066 Chr2 complement(110523..113165) [2643 bp, 880 aa] {ON}
           similar to Ashbya gossypii ADL145C
          Length = 880

 Score = 38.5 bits (88), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 32/72 (44%), Gaps = 4/72 (5%)

Query: 506 ADIALWTSMF---GAKTTADIDEATTHIITKTPGTFKARLAKAFNP-EIKVVHPDWIFEC 561
           A+  L+TSM    G      +    THIIT  P      + K FN  E+  V   W+ EC
Sbjct: 134 AEYELYTSMLTYMGGCCMDYLSTKVTHIITSDPKDQAVLVLKRFNKFEVLTVSSAWLAEC 193

Query: 562 LVNWKRVDEKAY 573
            V  + V E AY
Sbjct: 194 FVRQEYVSEAAY 205

>Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932
           aa] {ON} (148944..151325,151327..151743) [2799 nt, 933
           aa]
          Length = 932

 Score = 38.1 bits (87), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 2/63 (3%)

Query: 515 FGAKTTADIDEATTHIITKTPG--TFKARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKA 572
            G   +  I   TTH+I+  P      A +A   +  IK V+P W+ +C +  K VDEK 
Sbjct: 150 LGGSVSDMISNKTTHLISSDPTDPALIAIVASDCHSRIKQVYPAWLCQCFLEVKYVDEKN 209

Query: 573 YEL 575
           + L
Sbjct: 210 FIL 212

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score = 37.7 bits (86), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 27/45 (60%)

Query: 231 YVKLRPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKL 275
           YV  RPG+ EF  +++  +E+ ++T +   YA  +   +DP+G +
Sbjct: 265 YVIKRPGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPNGTI 309

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score = 37.7 bits (86), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 25/42 (59%)

Query: 231 YVKLRPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPD 272
           YV  RPG++EF E++   FE+ ++T +   Y   +  I+D D
Sbjct: 295 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTD 336

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 28/51 (54%)

Query: 231 YVKLRPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRIL 281
           YV  RPG+ EF ++++  +E+ ++T +   Y   +  I+DP   +   R+ 
Sbjct: 361 YVIKRPGVDEFLKRVSELYEVVVFTASVSRYGDPLLNILDPANTIIHHRLF 411

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 26/45 (57%)

Query: 231 YVKLRPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKL 275
           YV  RPG+ EF  ++   +E+ ++T +   YA  +   +DP+G +
Sbjct: 260 YVIKRPGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDPNGTI 304

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 25/42 (59%)

Query: 231 YVKLRPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPD 272
           YV  RPG++EF E++   FE+ ++T +   Y   +  I+D D
Sbjct: 282 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDAD 323

>KAFR0E02140 Chr5 (426065..428920) [2856 bp, 951 aa] {ON} Anc_5.94
           YHR154W
          Length = 951

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 38/76 (50%), Gaps = 6/76 (7%)

Query: 506 ADIALWTSM---FGAKTTADIDEATTHIITKTP--GTFKARLAKAFNPEIKVVHPDWIFE 560
           ++  L+T +    G     +I+  TTHIIT  P    F+  L +     IK ++P W+  
Sbjct: 140 SEYLLYTELIHSMGGTCVENINNKTTHIITTNPKESCFEI-LKRNGTTSIKYIYPTWLIH 198

Query: 561 CLVNWKRVDEKAYELL 576
           C+   + +DE  +E++
Sbjct: 199 CVKESQLIDESEHEIV 214

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 27/45 (60%)

Query: 231 YVKLRPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKL 275
           YV  RPG+ EF  +++  +E+ ++T +   YA  +   +DP+G +
Sbjct: 260 YVIKRPGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDPNGTI 304

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 25/42 (59%)

Query: 231 YVKLRPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPD 272
           YV  RPG++EF E++   FE+ ++T +   Y   +  I+D D
Sbjct: 283 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTD 324

>NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5.94
           YHR154W
          Length = 1034

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 41/88 (46%), Gaps = 2/88 (2%)

Query: 471 PPNIKNLMPQLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFGAKTTADIDEATTHI 530
           PPN   L    KK++F     + +     G   +++ I   T M G  +T ++ +  TH+
Sbjct: 342 PPNTNLLFEPFKKKIFKSSELILTYTNYFGR--QRSYIQRLTEMLGGISTTELSKRNTHL 399

Query: 531 ITKTPGTFKARLAKAFNPEIKVVHPDWI 558
           +++ P   K   AK +    +V++  W+
Sbjct: 400 VSRMPVGKKFFQAKKWKDRCQVINHLWL 427

 Score = 32.0 bits (71), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 25/59 (42%), Gaps = 3/59 (5%)

Query: 515 FGAKTTADIDEATTHIIT---KTPGTFKARLAKAFNPEIKVVHPDWIFECLVNWKRVDE 570
            G   T  I+  TTH+I      P     +     N  IK V+P W+ +C    K +DE
Sbjct: 160 LGGTITHVINNKTTHLIAIAIDDPAIIAIKEKGQNNTIIKSVYPTWLVQCFKERKYIDE 218

>ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 482

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%)

Query: 231 YVKLRPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIID 270
           YV  RPG+ EF +K+   FE+ I+T +   Y   +  I+D
Sbjct: 350 YVMKRPGVDEFLKKVGSLFEVVIFTASVARYGDPLLDILD 389

>Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 35.4 bits (80), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%)

Query: 231 YVKLRPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIID 270
           YV  RPG++EF E++   FE+ ++T +   Y   +  I+D
Sbjct: 283 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD 322

>SAKL0H20592g Chr8 complement(1805321..1806847) [1527 bp, 508 aa]
           {ON} some similarities with uniprot|Q12114 Saccharomyces
           cerevisiae YLR330W CHS5 Protein of unknown function
           involved in chitin biosynthesis by regulating Chs3p
           localization also involved in cell fusion during mating
          Length = 508

 Score = 35.4 bits (80), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 32/74 (43%), Gaps = 1/74 (1%)

Query: 503 VRKADIALWTSMFGAKTTAD-IDEATTHIITKTPGTFKARLAKAFNPEIKVVHPDWIFEC 561
           V K  I    S  GAK   D +   TTH I     +    L KA N  I VV P+W+  C
Sbjct: 186 VTKNQIETSLSNIGAKALQDHVGLDTTHFICNEKDSEDPELEKAQNSNIPVVRPEWVRAC 245

Query: 562 LVNWKRVDEKAYEL 575
            +  + V  + + L
Sbjct: 246 ELERRIVGVRGFYL 259

>SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some
           similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 879

 Score = 35.4 bits (80), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 47/98 (47%), Gaps = 2/98 (2%)

Query: 472 PNIKNLMPQLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFGAKTTADIDEATTHII 531
           P+ K L+  L+ ++F K   + S    LG   ++  I       G  +T ++ +  TH++
Sbjct: 327 PSSKLLLSPLRPKIFHKNELLLSYTNYLGQ--QRFYIQKLVEALGGASTTELSKKNTHVL 384

Query: 532 TKTPGTFKARLAKAFNPEIKVVHPDWIFECLVNWKRVD 569
           +  P   K + A  ++   KVV+  W+ EC    K++D
Sbjct: 385 SCMPYGQKYQAAVRWSDTCKVVNHLWLEECYKFAKKLD 422

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score = 35.0 bits (79), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 26/51 (50%)

Query: 231 YVKLRPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRIL 281
           YV  RPG+  F  ++   +E+ I+T +   YA  +  ++D D  L   R+ 
Sbjct: 351 YVIKRPGVDRFLREVKKWYEIVIFTASLSRYANPLLDLLDKDHNLINHRLF 401

>TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {ON}
           Anc_5.202 YLL010C
          Length = 452

 Score = 34.3 bits (77), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 23/41 (56%)

Query: 231 YVKLRPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDP 271
           YV  RPG+ EF + +   +E+ ++T +   Y   +  I+DP
Sbjct: 320 YVSKRPGVDEFLKIVGDLYEVIVFTASVSRYGNPLMDILDP 360

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 25/42 (59%)

Query: 231 YVKLRPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPD 272
           YV  RPG+ EF  +++  +E+ ++T +   YA  +   +DP+
Sbjct: 253 YVIKRPGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLDPN 294

>Ecym_7276 Chr7 complement(579526..581307) [1782 bp, 593 aa] {ON}
           similar to Ashbya gossypii AGL051C
          Length = 593

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 41/102 (40%), Gaps = 7/102 (6%)

Query: 478 MPQLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFGAK-TTADIDEATTHIITKTPG 536
           M  +     C    V SG      DV K  + +     GAK     +   TTH +     
Sbjct: 167 MTDMSGITVCLGPLVKSG------DVTKEHMEVSLKAIGAKPLQKRVSLDTTHFVCNDAQ 220

Query: 537 TFKARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYELLIE 578
           +    LA+A N  I VV P+WI  C +  + V  + + L ++
Sbjct: 221 SDDKELARAKNGNIPVVRPEWIRACELEKRIVGVRGFYLDVD 262

>KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010C
          Length = 414

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 4/60 (6%)

Query: 231 YVKLRPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDG----KLFGDRILSRDEN 286
           YV  RPG+ EF  +I   +E+ ++T +   Y   +  I+D D     +LF D   + + N
Sbjct: 282 YVIKRPGVDEFLRRITELYEVVVFTASVSRYGDPLLDILDKDKTIHHRLFRDSCYNYEGN 341

>TPHA0A05110 Chr1 (1149460..1152657) [3198 bp, 1065 aa] {ON}
           Anc_5.94 YHR154W
          Length = 1065

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 36/70 (51%), Gaps = 4/70 (5%)

Query: 513 SMFGAKTTADIDEATTHIITKTPGTFKARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKA 572
           +  G K+T  + +  TH+I   P   K   A++   +I VV+  W+ +C++   RV E  
Sbjct: 372 TALGGKSTPTLSKRNTHLIFGVPYGKKYNYARSKLNKINVVNIKWLEQCVLLKSRVPEN- 430

Query: 573 YELLIEQPVS 582
              L E+P++
Sbjct: 431 ---LFEKPIT 437

>KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5.202
           YLL010C
          Length = 481

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 24/45 (53%)

Query: 231 YVKLRPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKL 275
           YV  RPG+ EF  ++   +E+ ++T +   Y   +  I+D D  +
Sbjct: 349 YVIKRPGVDEFLRRVGKLYEVVVFTASVSRYGDPLLDILDKDKSI 393

>NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202
          Length = 391

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 23/40 (57%)

Query: 231 YVKLRPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIID 270
           YV  RPG+ EF  ++A  +E+ ++T +   Y   +  I+D
Sbjct: 259 YVIKRPGVDEFLRRVAQLYEVVVFTASVSRYGDPLLDILD 298

>TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5.94
           YHR154W
          Length = 1015

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 35/79 (44%), Gaps = 5/79 (6%)

Query: 505 KADIALWTSM---FGAKTTADIDEATTHIITKTPG--TFKARLAKAFNPEIKVVHPDWIF 559
           K ++  ++ +    G  T   I   TTH+IT  P      A +A      I  V+P W+ 
Sbjct: 134 KTEVLFYSELINALGGTTVDHISTLTTHLITNDPTDQAVIATIASEQKQNISFVYPTWLC 193

Query: 560 ECLVNWKRVDEKAYELLIE 578
           +C  +   V+E  + + I+
Sbjct: 194 QCFKSMTLVNESDHLINIQ 212

>KAFR0A06560 Chr1 complement(1329583..1331250) [1668 bp, 555 aa]
           {ON} Anc_4.156 YLR330W
          Length = 555

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 527 TTHIITKTPGTFKARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYEL 575
           TTH I        A L +A N  I +V P+WI  C V  + V  + + L
Sbjct: 212 TTHFICNDEEEEDAELIRAKNSNIPIVRPEWIRACAVEKRIVGVRGFYL 260

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 68,143,817
Number of extensions: 2903221
Number of successful extensions: 17968
Number of sequences better than 10.0: 209
Number of HSP's gapped: 18204
Number of HSP's successfully gapped: 250
Length of query: 688
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 571
Effective length of database: 40,065,477
Effective search space: 22877387367
Effective search space used: 22877387367
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)