Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0D01474g8.840ON62462433800.0
Kwal_27.102588.840ON62061821960.0
YMR278W (PGM3)8.840ON62262321700.0
KLTH0C03872g8.840ON62162621230.0
Suva_13.4668.840ON62262321100.0
Smik_13.4918.840ON62262320920.0
Skud_13.4508.840ON62262320820.0
NCAS0C004108.840ON62562620620.0
TDEL0B005708.840ON63062320220.0
TPHA0I002508.840ON62962620160.0
ZYRO0G14190g8.840ON61062020140.0
Ecym_46118.840ON63062220040.0
KAFR0B039208.840ON62462219750.0
Kpol_1068.88.840ON63262419740.0
KNAG0J002708.840ON62562319720.0
ABL126W8.840ON62462919640.0
NDAI0K004108.840ON62662319540.0
CAGL0M02981g8.840ON61762419360.0
KLLA0D01573g8.840ON60762519040.0
TBLA0B032508.840ON64363518780.0
KNAG0E023902.445ON5695801162e-05
NCAS0F014702.445ON5694441063e-04
Kwal_26.76282.445ON5704051038e-04
KLTH0D04796g2.445ON570451990.002
Ecym_24752.445ON567448980.003
TBLA0B090102.445ON569582930.015
CAGL0B03597g6.11ON54046900.028
TDEL0A022102.445ON572448890.039
TBLA0I013802.445ON571443890.043
NCAS0F002006.11ON54928860.078
CAGL0K03421g2.445ON568578860.084
TDEL0G046006.11ON52827860.088
TBLA0G009806.11ON55828850.10
KAFR0L003406.11ON54027850.12
NDAI0H023502.445ON569576850.13
NDAI0K028906.11ON56130840.13
Kpol_1032.26.11ON53928840.15
Kpol_1018.1612.445ON569422840.16
YEL058W (PCM1)6.11ON55727820.27
Smik_5.296.11ON55527820.28
ZYRO0F00506g6.11ON55023820.29
Suva_5.106.11ON55327820.29
Skud_5.316.11ON55727820.30
YMR105C (PGM2)2.445ON569578810.34
KAFR0D030102.445ON569583800.51
Skud_13.2632.445ON569577790.55
ABL029W2.445ON568449790.59
KNAG0E009406.11ON53856790.63
TDEL0E00210singletonON570130780.75
ZYRO0G02508g2.445ON569131780.82
SAKL0E00902g6.11ON54418770.91
KLLA0D00858g6.11ON54118770.93
Kpol_1033.542.445ON570133770.95
Smik_13.2912.445ON569578770.97
Kwal_56.223556.11ON54125770.99
SAKL0E03630g2.445ON571456771.1
KLTH0C11506g6.11ON54420771.1
ACR015W6.11ON55238761.3
Suva_13.2822.445ON569542751.8
TPHA0G029002.445ON569131752.0
Smik_11.1122.445ON570130742.3
TPHA0M002106.11ON54528733.3
TPHA0G024702.445ON569132724.6
KLLA0B05863g4.172ON34488714.9
Ecym_30146.11ON55118715.2
CAGL0L02849g8.619ON113366708.2
SAKL0F13442g7.433ON1153114699.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0D01474g
         (624 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...  1306   0.0  
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...   850   0.0  
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...   840   0.0  
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...   822   0.0  
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...   817   0.0  
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...   810   0.0  
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...   806   0.0  
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...   798   0.0  
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...   783   0.0  
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...   781   0.0  
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...   780   0.0  
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...   776   0.0  
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...   765   0.0  
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...   764   0.0  
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...   764   0.0  
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...   761   0.0  
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...   757   0.0  
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...   750   0.0  
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...   738   0.0  
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...   728   0.0  
KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.4...    49   2e-05
NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {O...    45   3e-04
Kwal_26.7628 s26 (449302..451014) [1713 bp, 570 aa] {ON} YMR105C...    44   8e-04
KLTH0D04796g Chr4 (437416..439128) [1713 bp, 570 aa] {ON} highly...    43   0.002
Ecym_2475 Chr2 complement(927999..929702) [1704 bp, 567 aa] {ON}...    42   0.003
TBLA0B09010 Chr2 complement(2135961..2137670) [1710 bp, 569 aa] ...    40   0.015
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...    39   0.028
TDEL0A02210 Chr1 (400375..402093) [1719 bp, 572 aa] {ON} Anc_2.4...    39   0.039
TBLA0I01380 Chr9 complement(297671..299386) [1716 bp, 571 aa] {O...    39   0.043
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...    38   0.078
CAGL0K03421g Chr11 complement(314680..316386) [1707 bp, 568 aa] ...    38   0.084
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...    38   0.088
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...    37   0.10 
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...    37   0.12 
NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {O...    37   0.13 
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....    37   0.13 
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...    37   0.15 
Kpol_1018.161 s1018 (412372..414081) [1710 bp, 569 aa] {ON} (412...    37   0.16 
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...    36   0.27 
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)    36   0.28 
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...    36   0.29 
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)    36   0.29 
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)    36   0.30 
YMR105C Chr13 complement(475897..477606) [1710 bp, 569 aa] {ON} ...    36   0.34 
KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.4...    35   0.51 
Skud_13.263 Chr13 complement(451194..452903) [1710 bp, 569 aa] {...    35   0.55 
ABL029W Chr2 (343850..345556) [1707 bp, 568 aa] {ON} Syntenic ho...    35   0.59 
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...    35   0.63 
TDEL0E00210 Chr5 (28244..29956) [1713 bp, 570 aa] {ON} Anc_2.445...    35   0.75 
ZYRO0G02508g Chr7 (192411..194120) [1710 bp, 569 aa] {ON} highly...    35   0.82 
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...    34   0.91 
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...    34   0.93 
Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON} (1362...    34   0.95 
Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {...    34   0.97 
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...    34   0.99 
SAKL0E03630g Chr5 complement(294321..296036) [1716 bp, 571 aa] {...    34   1.1  
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...    34   1.1  
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...    34   1.3  
Suva_13.282 Chr13 complement(457565..459274) [1710 bp, 569 aa] {...    33   1.8  
TPHA0G02900 Chr7 (622303..624012) [1710 bp, 569 aa] {ON}               33   2.0  
Smik_11.112 Chr11 (189511..191223) [1713 bp, 570 aa] {ON} YKL127...    33   2.3  
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...    33   3.3  
TPHA0G02470 Chr7 (507445..509154) [1710 bp, 569 aa] {ON} Anc_2.4...    32   4.6  
KLLA0B05863g Chr2 complement(529188..530222) [1035 bp, 344 aa] {...    32   4.9  
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...    32   5.2  
CAGL0L02849g Chr12 (334192..337593) [3402 bp, 1133 aa] {ON} high...    32   8.2  
SAKL0F13442g Chr6 (1065165..1068626) [3462 bp, 1153 aa] {ON} sim...    31   9.5  

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score = 1306 bits (3380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 624/624 (100%), Positives = 624/624 (100%)

Query: 1   MSDSYTTVPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLR 60
           MSDSYTTVPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLR
Sbjct: 1   MSDSYTTVPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLR 60

Query: 61  SRMEAGFSRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQL 120
           SRMEAGFSRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQL
Sbjct: 61  SRMEAGFSRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQL 120

Query: 121 GFKVYYLNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQ 180
           GFKVYYLNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQ
Sbjct: 121 GFKVYYLNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQ 180

Query: 181 IIPPHDRLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVR 240
           IIPPHDRLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVR
Sbjct: 181 IIPPHDRLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVR 240

Query: 241 VPMLDCDKPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPN 300
           VPMLDCDKPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPN
Sbjct: 241 VPMLDCDKPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPN 300

Query: 301 PEEKGALDLSIALAEEQDIRLVIANDPDADRFSVAVKNGDRWSQLTGNEIGFLFAYYQWQ 360
           PEEKGALDLSIALAEEQDIRLVIANDPDADRFSVAVKNGDRWSQLTGNEIGFLFAYYQWQ
Sbjct: 301 PEEKGALDLSIALAEEQDIRLVIANDPDADRFSVAVKNGDRWSQLTGNEIGFLFAYYQWQ 360

Query: 361 DYQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQGY 420
           DYQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQGY
Sbjct: 361 DYQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQGY 420

Query: 421 YVPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGVFK 480
           YVPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGVFK
Sbjct: 421 YVPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGVFK 480

Query: 481 EYNGYYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTIDNV 540
           EYNGYYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTIDNV
Sbjct: 481 EYNGYYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTIDNV 540

Query: 541 PNLPVDASSQMITATLRPSNGKESTSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQHL 600
           PNLPVDASSQMITATLRPSNGKESTSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQHL
Sbjct: 541 PNLPVDASSQMITATLRPSNGKESTSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQHL 600

Query: 601 ARETWQVLRREWFRPERTGLETKF 624
           ARETWQVLRREWFRPERTGLETKF
Sbjct: 601 ARETWQVLRREWFRPERTGLETKF 624

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score =  850 bits (2196), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/618 (66%), Positives = 475/618 (76%), Gaps = 6/618 (0%)

Query: 8   VPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLRSRMEAGF 67
           +P DLK SV  W  +DKN ETR+E+L LV  ++W ELH RLD+RISFGTAGLRS+MEAGF
Sbjct: 8   IPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLRSKMEAGF 67

Query: 68  SRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQLGFKVYYL 127
           SRMNTLTVLQASQGLA YI  +FPEN +V VGHDHR++S +FA VT  AFLQL FKVY L
Sbjct: 68  SRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQLRFKVYSL 127

Query: 128 NLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQIIPPHDR 187
             ++    + FVHTPMVPF I++L ASAG+MITASHNPKMDNGYKVYYSNGCQIIPPHDR
Sbjct: 128 GFNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQIIPPHDR 187

Query: 188 LISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVRVPMLDCD 247
           LI+++I  NL PW +AWDC  VI  A E G+  D+K+ +   Y+K +SD+LV   + D  
Sbjct: 188 LIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVSSDIGDRS 247

Query: 248 KPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPNPEEKGAL 307
           KPWFVYTP+HGVGFEIFE+IA   LGL EG+ Y CV E + PDPAFPTVSFPNPEE GAL
Sbjct: 248 KPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEAGAL 307

Query: 308 DLSIALAEEQDIRLVIANDPDADRFSVAVKNGDRWSQLTGNEIGFLFAYYQWQDYQKLGE 367
           DL+IALA++  I  V+ NDPDADRFS AVK+  +W QLTGNEIGFLFA + W+ YQK   
Sbjct: 308 DLAIALADKNGISFVLGNDPDADRFSAAVKHQGKWRQLTGNEIGFLFAQFVWEKYQKESS 367

Query: 368 SFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQGYYVPFAYE 427
            FK ++PLA+INSTVSSQMIK LA  EKFHYEDTLTGFKWLGNRA +LE+ GYYVPFAYE
Sbjct: 368 EFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQLESSGYYVPFAYE 427

Query: 428 EAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGVFKEYNGYYI 487
           EAIG+MF ++ HDKDG+SAAVVFLQM   W  K  ++P+ VL   FGKYGVFKEYNGYY 
Sbjct: 428 EAIGFMFSDIVHDKDGVSAAVVFLQMLWSW-KKQALSPIDVLQSAFGKYGVFKEYNGYYT 486

Query: 488 VPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTIDNVPNLPVDA 547
           VP LSLT  +F  IR  Y     +YP  IG++F V+SF DLT G+QSDT DN P LPVD 
Sbjct: 487 VPDLSLTDRIFSDIRSSY----DSYPKHIGNQFDVVSFTDLTKGFQSDTADNTPRLPVDP 542

Query: 548 SSQMITATLRPS-NGKESTSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQHLARETWQ 606
           SSQMI ATL PS +G      E VRFT RGSGTEPKLKVYIEA S +E RA  LAR TW 
Sbjct: 543 SSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEETRASDLARTTWN 602

Query: 607 VLRREWFRPERTGLETKF 624
           VLR EWF+P+ TGL TKF
Sbjct: 603 VLRDEWFKPKETGLSTKF 620

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score =  840 bits (2170), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/623 (63%), Positives = 478/623 (76%), Gaps = 13/623 (2%)

Query: 7   TVPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLRSRMEAG 66
           TVP DLK+ ++LW   D+NP+T  E+  L +   W ELH R D RI FGTAGLRS+M+AG
Sbjct: 8   TVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGLRSQMQAG 67

Query: 67  FSRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQLGFKVYY 126
           FSRMNTL V+QASQGLA+Y++ QFP+NL  +VGHDHR+HS EFAR T  AFL  GFKV+Y
Sbjct: 68  FSRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLLKGFKVHY 127

Query: 127 LNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQIIPPHD 186
           LN         FVHTP+VPF +++L AS G+MITASHNPKMDNGYKVYYSNGCQIIPPHD
Sbjct: 128 LN-----PDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHD 182

Query: 187 RLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVRVPMLDC 246
             IS++ID NL PW   WD D+V+  A++ G L   +E++   Y++ VS  LV +  L  
Sbjct: 183 HAISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVEINPLKL 242

Query: 247 D---KPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPNPEE 303
           +   KPWFVYTPMHGVGF+IF  I    L L EGK Y+CVPEQ+ PDP+FPTV FPNPEE
Sbjct: 243 EVKAKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEE 302

Query: 304 KGALDLSIALAEEQDIRLVIANDPDADRFSVAVKN--GDRWSQLTGNEIGFLFAYYQWQD 361
           KGALD+ I LAE+ DI L++ANDPDADRFSVAVK+     W QLTGNEIGFLFA+Y++Q 
Sbjct: 303 KGALDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFYEYQK 362

Query: 362 YQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQGYY 421
           Y+ + + F+  HPLAM+NSTVSSQMIK +AE E FHYEDTLTGFKW+GNRA  LE +GYY
Sbjct: 363 YKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEKKGYY 422

Query: 422 VPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGVFKE 481
           VPF +EEAIGYMFP +EHDKDGISA++VFLQ YC+W     + PL VL+ GF KYGVFKE
Sbjct: 423 VPFGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKKYGVFKE 482

Query: 482 YNGYYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTIDNVP 541
           YNGYY+VP  ++TK++FDYIR  YTP G +YP +IG E  V+ +RDLTTGYQSDTI++ P
Sbjct: 483 YNGYYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTINHKP 542

Query: 542 NLPVDASSQMITATLRPSNGKESTSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQHLA 601
            LPVD +SQMIT + RPSNG E+   E +RFTIRGSGTEPKLKVYIEA + +E+RA  LA
Sbjct: 543 TLPVDPTSQMITVSARPSNGSEN---EHIRFTIRGSGTEPKLKVYIEACANEEQRASFLA 599

Query: 602 RETWQVLRREWFRPERTGLETKF 624
           + TW VLRREWFRP+   + TKF
Sbjct: 600 KLTWNVLRREWFRPDEMNIVTKF 622

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score =  822 bits (2123), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/626 (64%), Positives = 473/626 (75%), Gaps = 8/626 (1%)

Query: 1   MSDSYTTVPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLR 60
           MS +   VP+DLK  V  WL YDKN +TR +++ LVE K W EL  RL+ RI+FGTAGLR
Sbjct: 2   MSLTNAEVPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGLR 61

Query: 61  SRMEAGFSRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQL 120
           SRMEAGF+RMNTLTVLQASQGLA YI S FP+NLSV+VGHDHR++S +FA VT+ AFLQL
Sbjct: 62  SRMEAGFNRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQL 121

Query: 121 GFKVYYLNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQ 180
           GFKVY L  +   S +  VHTPMVPF I+ L AS GIMITASHNPKMDNGYKVYYSNGCQ
Sbjct: 122 GFKVYDLGFTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGCQ 181

Query: 181 IIPPHDRLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVR 240
           IIPPHD+ IS++I  NL PW++AWDC  V   A++S  L D K+ +  +Y+ TV   LV 
Sbjct: 182 IIPPHDQRISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLVI 241

Query: 241 VPMLDCDKPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPN 300
             +     PWFVYTP+HGVGFEIFE+I   A  L +G+ Y+CV EQ+ PDP FPTVSFPN
Sbjct: 242 TNVNHTKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPN 301

Query: 301 PEEKGALDLSIALAEEQDIRLVIANDPDADRFSVAVKNGDRWSQLTGNEIGFLFAYYQWQ 360
           PEEKGALD +I LAE+ DI  V+ NDPDADRFSVA K+  +W QLTGNEIGFLFA Y+W+
Sbjct: 302 PEEKGALDKAIELAEKHDITFVLGNDPDADRFSVAAKHNGQWRQLTGNEIGFLFAQYKWE 361

Query: 361 DYQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQGY 420
            Y+   + FK  +PLAMINSTVSSQMIK +AE E FHYEDTLTGFKWLGNRA ELE  GY
Sbjct: 362 TYRLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRARELENAGY 421

Query: 421 YVPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGVFK 480
           +VPFAYEEAIGYMF +V HDKDGISAAVVFLQM   W ++  +TP  VL   + KYGVFK
Sbjct: 422 FVPFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSWKAQ-ALTPFDVLQRAYQKYGVFK 480

Query: 481 EYNGYYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTIDNV 540
           EYNGYYIVP LSLT +VF  IR  ++      P  IG EF V S+ DLTTGYQS+T D+ 
Sbjct: 481 EYNGYYIVPDLSLTDKVFSGIRSGFS----LQPTHIGQEFRVESYTDLTTGYQSNTPDSE 536

Query: 541 PNLPVDASSQMITATLRP--SNGKESTSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQ 598
           P LPVD SSQMITATL P  S G++  S E VRFT RGSGTEPKLKVYIEA S+ E+ A 
Sbjct: 537 PRLPVDPSSQMITATLTPTSSTGRQGFS-ESVRFTARGSGTEPKLKVYIEAVSSSEELAS 595

Query: 599 HLARETWQVLRREWFRPERTGLETKF 624
            LA++ W VLRREWF+PE+TGL T F
Sbjct: 596 ALAKKAWDVLRREWFKPEQTGLATNF 621

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  817 bits (2110), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/623 (62%), Positives = 469/623 (75%), Gaps = 13/623 (2%)

Query: 7   TVPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLRSRMEAG 66
           TVP DLK  ++LW   D+NPET  E+  L +   W+ELH R D RI FGTAGLRS M+AG
Sbjct: 8   TVPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGLRSEMQAG 67

Query: 67  FSRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQLGFKVYY 126
           FSRMNTL ++QA+QGLA+YIK QFP+NL V+VGHDHR+HS EFAR T TAFL  GFKV+Y
Sbjct: 68  FSRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLLKGFKVHY 127

Query: 127 LNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQIIPPHD 186
           LN         FVHTP+VPF +++L AS G+MITASHNPKMDNGYKVYYSNGCQIIPPHD
Sbjct: 128 LN-----PDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHD 182

Query: 187 RLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVRVPMLDC 246
             IS++ID NL PW   W   +V+  A++ G L   +E++ + Y K VS  LV    L  
Sbjct: 183 HAISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVETNPLKL 242

Query: 247 D---KPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPNPEE 303
           +   KPWFVYTPMHGVGF IF  I    + L EG+ Y+CVPEQ+ PDP+FPTV FPNPEE
Sbjct: 243 EIKAKPWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNPEE 302

Query: 304 KGALDLSIALAEEQDIRLVIANDPDADRFSVAVKN--GDRWSQLTGNEIGFLFAYYQWQD 361
           KGALD+ + LAEE DI L++ANDPDADRFS+AVK+    +W QLTGNEIGFLFA++++Q 
Sbjct: 303 KGALDIGMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAFFEFQR 362

Query: 362 YQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQGYY 421
           Y+   E F++ HPLAM++STVSSQMIK +AE E F YEDTLTGFKW+GNRA  LE +GYY
Sbjct: 363 YKNKDEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILEKEGYY 422

Query: 422 VPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGVFKE 481
           VPF +EEAIGYMFP +EHDKDGISAAVV LQ YC+W     + P+ +L+ GF KYGVFKE
Sbjct: 423 VPFGFEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKYGVFKE 482

Query: 482 YNGYYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTIDNVP 541
           YNGYY+VP   +T E+F+YIR  YTP+G  YPP+IG E  V+ +RDLTTGYQSDT D+ P
Sbjct: 483 YNGYYVVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTPDHKP 542

Query: 542 NLPVDASSQMITATLRPSNGKESTSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQHLA 601
            LPVD +SQMIT + +PS+G      E +RFTIRGSGTEPKLKVYIEA + +EKRA +LA
Sbjct: 543 VLPVDPTSQMITLSGKPSDG---NGNEHIRFTIRGSGTEPKLKVYIEACADNEKRASYLA 599

Query: 602 RETWQVLRREWFRPERTGLETKF 624
           + TW VLRR WFRPE   + T F
Sbjct: 600 KLTWDVLRRGWFRPEIMNITTDF 622

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  810 bits (2092), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/623 (60%), Positives = 469/623 (75%), Gaps = 13/623 (2%)

Query: 7   TVPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLRSRMEAG 66
            VP +LKE+++LW   D+NPET  E+  L +   W ELH R D RI FGTAGLRS+M+AG
Sbjct: 8   AVPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGLRSQMQAG 67

Query: 67  FSRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQLGFKVYY 126
           F+RMNTL ++QASQGLA+Y K QFP NL  +VGHDHR+HS EFAR T TAFL  GFKV+Y
Sbjct: 68  FNRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLLKGFKVHY 127

Query: 127 LNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQIIPPHD 186
           LN         FVHTP+VPF +++L AS G+M+TASHNPKMDNGYKVYYSNGCQIIPPHD
Sbjct: 128 LN-----PDHEFVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIPPHD 182

Query: 187 RLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVRVPMLDC 246
             IS++ID NL PW   W+ D+V+   ++ G L   +E++   Y+  VS  LV    L  
Sbjct: 183 HAISDSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLVGTDPLKF 242

Query: 247 D---KPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPNPEE 303
           +   KPWFVYTPMHGVGF+IF  I    + L EGK Y+CVPEQ+ PDP+FPTV+FPNPEE
Sbjct: 243 EVKAKPWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNPEE 302

Query: 304 KGALDLSIALAEEQDIRLVIANDPDADRFSVAVKN--GDRWSQLTGNEIGFLFAYYQWQD 361
           KGALDL I LAE   I L+IANDPDADRFSVA+K+     W QLTGNEIGFLFA +++Q 
Sbjct: 303 KGALDLGINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIFEFQK 362

Query: 362 YQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQGYY 421
           ++ + + F+  HPLAM++STVSSQMIK +AE E FHYE+TLTGFKW+GNRA  LE +GYY
Sbjct: 363 FKSMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEKEGYY 422

Query: 422 VPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGVFKE 481
           VPF +EEAIGYMFP +EHDKDG+SA++VFLQ YC+W     + P+ +L++GF KYGVFKE
Sbjct: 423 VPFGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKYGVFKE 482

Query: 482 YNGYYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTIDNVP 541
           YNGYYIV    +T E+FDYIR  YTP G +YP +IG E  V+++RDLT GYQSDT ++ P
Sbjct: 483 YNGYYIVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTSNHKP 542

Query: 542 NLPVDASSQMITATLRPSNGKESTSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQHLA 601
            LP+D SSQMIT + +PS+G E   GE +RFTIRGSGTEPK+KVYIEA + +E+RA  LA
Sbjct: 543 TLPIDPSSQMITVSAKPSDGNE---GEHIRFTIRGSGTEPKIKVYIEACADEEQRATFLA 599

Query: 602 RETWQVLRREWFRPERTGLETKF 624
           + TW VL+REWFRPE+  + T F
Sbjct: 600 KLTWNVLKREWFRPEKMDIVTHF 622

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  806 bits (2082), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/623 (61%), Positives = 476/623 (76%), Gaps = 13/623 (2%)

Query: 7   TVPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLRSRMEAG 66
           T+P DLK  ++LW   D++PET  E+  L +   W+ELH R D RI FGTAGLRS+M+AG
Sbjct: 8   TIPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGLRSQMQAG 67

Query: 67  FSRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQLGFKVYY 126
           FSRMN L ++QASQGLA+YI+ QFP NL  +VGHDHR+HS +FAR T TAFL  GFKV+Y
Sbjct: 68  FSRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLLKGFKVHY 127

Query: 127 LNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQIIPPHD 186
           LN       + FVHTP+VPF +++LNAS G+MITASHNPKMDNGYKVYYSNGCQIIPPHD
Sbjct: 128 LN-----PGQEFVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHD 182

Query: 187 RLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVRVPMLDC 246
           + IS  ID NL PW  AW+ D+++   ++ G L   +E++   Y++ +SD LV    L  
Sbjct: 183 QAISNAIDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETTPLKL 242

Query: 247 D---KPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPNPEE 303
           +   KPWFVYTPMHGVGF+IF  I   ++ L EGK Y+CVPEQ+ PDP+FPTV FPNPEE
Sbjct: 243 EVRSKPWFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEE 302

Query: 304 KGALDLSIALAEEQDIRLVIANDPDADRFSVAVKN--GDRWSQLTGNEIGFLFAYYQWQD 361
           KGAL++ + LAE+ DI L+IANDPDADRFSVA+K+     W QLTGNEIGFLFA+++++ 
Sbjct: 303 KGALNIGMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIGFLFAFFEFEK 362

Query: 362 YQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQGYY 421
           ++ + E F++ HPLAM++STVSSQMIK +AE E FHYEDTLTGFKW+GNRA  LE +GYY
Sbjct: 363 FKSMDEQFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAIILEKEGYY 422

Query: 422 VPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGVFKE 481
           VPF +EEAIGYMFP +EHDKDGISA+VVFLQ YC+W   + + P+ VL+ GF KYGVFKE
Sbjct: 423 VPFGFEEAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGFKKYGVFKE 482

Query: 482 YNGYYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTIDNVP 541
           YNGYYIVP   +TKE+F YIR+ YTP    YPP IG E  V+ +RDLTTGYQSDT+D+ P
Sbjct: 483 YNGYYIVPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDHKP 542

Query: 542 NLPVDASSQMITATLRPSNGKESTSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQHLA 601
            LPVD +SQMIT   RP+   +S   E +RFTIRGSGTEPKLKVYIE ++ +E+RA  LA
Sbjct: 543 TLPVDPTSQMITVFARPN---DSNGNEHIRFTIRGSGTEPKLKVYIETRANEERRASFLA 599

Query: 602 RETWQVLRREWFRPERTGLETKF 624
           + TW VLRREWFRPE+T + T F
Sbjct: 600 KLTWDVLRREWFRPEKTNITTNF 622

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  798 bits (2062), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/626 (60%), Positives = 467/626 (74%), Gaps = 12/626 (1%)

Query: 4   SYTTVPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLRSRM 63
           S +  P++L+E +NLWL  D+N ETR E+L L E K+W ELH R D RI FGTAGLRSRM
Sbjct: 7   SLSNCPENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLRSRM 66

Query: 64  EAGFSRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQLGFK 123
           EAGFSRMN+L +LQ++QGLA+YIK QFP NL+ +VGHDHR+HS EFA VT + FL+ GFK
Sbjct: 67  EAGFSRMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIFLRAGFK 126

Query: 124 VYYLNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQIIP 183
           V+YL        + FVHTP+VPF++  L AS G+MITASHNPKMDNGYKVYY N CQIIP
Sbjct: 127 VFYLT-----PDDQFVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNACQIIP 181

Query: 184 PHDRLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVRVPM 243
           PHD+ I+E I +NL PW+ +WD D   K  +E+  L  +K+ +T KY+  +   L+    
Sbjct: 182 PHDKNIAEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSSH 241

Query: 244 L---DCDKPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPN 300
           L   D   P+FVYTPMHGVG EIF +++   L L E   Y+ V EQR PDP+FPTVSFPN
Sbjct: 242 LSLKDVKTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFPN 301

Query: 301 PEEKGALDLSIALAEEQDIRLVIANDPDADRFSVAV--KNGDRWSQLTGNEIGFLFAYYQ 358
           PEEKGAL L+I LA+E  + LVIANDPDADRFS AV  K   +W QLTGNEIGFL  YY+
Sbjct: 302 PEEKGALSLAIKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGYYE 361

Query: 359 WQDYQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQ 418
           +Q Y++   +F+K HPLAMINSTVSSQMIK +A+   FHYEDTLTGFKW+GN+A +L  +
Sbjct: 362 FQLYEQQDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQE 421

Query: 419 GYYVPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGV 478
           GYYVPF +EEAIGYMFP++E DKDGISAA VFLQ YC W+++ +M+P  +++EGFGK+GV
Sbjct: 422 GYYVPFGFEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFGV 481

Query: 479 FKEYNGYYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTID 538
           FKEYNGYYI+  LS+TK VFD+IR +Y  +   YP  IG+E  V  FRDLT GYQS+T D
Sbjct: 482 FKEYNGYYILKDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKD 541

Query: 539 NVPNLPVDASSQMITATLRPSNGKESTSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQ 598
           N+PNLPVD +SQMIT   +PS  + S     VR T+RGSGTEPKLKVYIEA S  E+ A 
Sbjct: 542 NIPNLPVDPTSQMITVEAKPS--EFSNLEGTVRLTMRGSGTEPKLKVYIEACSKSEESAT 599

Query: 599 HLARETWQVLRREWFRPERTGLETKF 624
           +LAR TW +L+REWFRPE TGL T F
Sbjct: 600 NLARSTWDILKREWFRPEVTGLTTSF 625

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/623 (61%), Positives = 465/623 (74%), Gaps = 13/623 (2%)

Query: 7   TVPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLRSRMEAG 66
           +VP DL + V  WL+ D N +TR E+LNL + K W ELH RLD RI FGTAGLRSRMEAG
Sbjct: 16  SVPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFGTAGLRSRMEAG 75

Query: 67  FSRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQLGFKVYY 126
           FSRMNTL VLQA+QGLA +IK QFP+ L+ +VGHDHR++S EFA  TV  FLQ GFKV +
Sbjct: 76  FSRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATVATFLQAGFKVIF 135

Query: 127 LNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQIIPPHD 186
           LN   K     FVHTP+VPFT+N++ AS G+MITASHNPKMDNGYKVYYSNGCQIIPPHD
Sbjct: 136 LNDGDK-----FVHTPIVPFTVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHD 190

Query: 187 RLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVRVPMLDC 246
             I+++I++NL  W KAW  DE++K  +++  L    E++  +Y K +   LV    +  
Sbjct: 191 SEIAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQSLVDRTTISA 250

Query: 247 DK---PWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPNPEE 303
           +K   PWFVYTP+HGVG++IF QIA   + L  G+ Y+CV EQ+ PDP+FPTV FPNPEE
Sbjct: 251 EKEGKPWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSFPTVPFPNPEE 310

Query: 304 KGALDLSIALAEEQDIRLVIANDPDADRFSVAVKNGDR--WSQLTGNEIGFLFAYYQWQD 361
           KGALD++I++A++  I LV+ANDPDADRFS AVK+     W QLTGNEIG LFA+Y++Q 
Sbjct: 311 KGALDMAISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIGALFAFYEFQK 370

Query: 362 YQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQGYY 421
           YQK  E +K++HPLAM+NSTVSSQ+I  +AE E+FHY DTLTGFKW+GNR  +LE   YY
Sbjct: 371 YQKKNEEYKEKHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNRTLDLEAMNYY 430

Query: 422 VPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGVFKE 481
           VPF +EEAIGYMFP +EHDKDGISAA VFLQMY +WL   + T L VL++ F KYGVFKE
Sbjct: 431 VPFGFEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLEDIFEKYGVFKE 490

Query: 482 YNGYYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTIDNVP 541
           YNGYY V    + KEVFD+IR DY+ +   YP  IG E  V  FRDLT GYQSDT++  P
Sbjct: 491 YNGYYSVNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLGYQSDTVNQRP 550

Query: 542 NLPVDASSQMITATLRPSNGKESTSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQHLA 601
           +LPVD +SQMITA  + +  K     E VRFTIRGSGTEPKLKVYIEA S  E+RA  LA
Sbjct: 551 DLPVDPNSQMITAWTKVNGAKPY---ESVRFTIRGSGTEPKLKVYIEACSKSEERASELA 607

Query: 602 RETWQVLRREWFRPERTGLETKF 624
           + TW+VL+REWFRP+ TGL T F
Sbjct: 608 QLTWRVLKREWFRPDVTGLTTTF 630

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score =  781 bits (2016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/626 (61%), Positives = 462/626 (73%), Gaps = 16/626 (2%)

Query: 6   TTVPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLRSRMEA 65
           +++P+DLKE + +W  YD N ET  E+  L   K  +ELH R D+RI FGTAGLRSRMEA
Sbjct: 13  SSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIVFGTAGLRSRMEA 72

Query: 66  GFSRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQLGFKVY 125
           GF+RMN LTVLQ++QGLASYIKSQFP NL+ +VGHDHRYHS EFA++T   FL  GFKVY
Sbjct: 73  GFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITAAVFLNAGFKVY 132

Query: 126 YLNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQIIPPH 185
           YLN       + FVHTPMVPF IN  +AS G+MITASHNP+MDNGYKVYY+NGCQIIPPH
Sbjct: 133 YLN-----PNDEFVHTPMVPFGINLYSASIGVMITASHNPEMDNGYKVYYNNGCQIIPPH 187

Query: 186 DRLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVRVPM-- 243
           D+ I+E I++NL P +  W+ + VI  AIE+  L   KE V  +Y+  +   ++   +  
Sbjct: 188 DKNIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYIIPKNISL 247

Query: 244 ---LDCDKPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPN 300
              +   KPWFVYTPMHGVG++IF +I+   L L E   YVCV EQ  PDP+FPTVSFPN
Sbjct: 248 GTTIKGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSFPTVSFPN 307

Query: 301 PEEKGALDLSIALAEEQDIRLVIANDPDADRFSVAVKN--GDRWSQLTGNEIGFLFAYYQ 358
           PEEKGALDL I  A++ +I LV+ANDPDADRFSVAV+N   D + QLTGNEIGFLFAY+ 
Sbjct: 308 PEEKGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIGFLFAYFL 367

Query: 359 WQDYQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQ 418
           W+ Y  L   FK + PLAMINSTVSSQMIK +AE E F+YEDTLTGFKW+GN+A ELE +
Sbjct: 368 WEQYSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNKARELEKE 427

Query: 419 GYYVPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGV 478
           GYYVPF +EEAIGYMFP++E DKDGI+A VVFLQ Y  W   ++ +   +++ GF KYGV
Sbjct: 428 GYYVPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSLFDIIETGFKKYGV 487

Query: 479 FKEYNGYYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTID 538
           FKEYNGYYIV  LSLTK +FD IRE+       Y   IG+EF VI+FRDLT GYQSDTI 
Sbjct: 488 FKEYNGYYIVNDLSLTKIIFDNIRENKN-DKEKYVSHIGTEFKVITFRDLTLGYQSDTIG 546

Query: 539 NVPNLPVDASSQMITATLRPSNGKESTSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQ 598
           NVP LPVD SSQMIT T+ P++  E+ S   VRFTIRGSGTEPKLKVYIEA +  E  A 
Sbjct: 547 NVPTLPVDPSSQMITMTIIPTSLPENGS---VRFTIRGSGTEPKLKVYIEANAKTEAEAN 603

Query: 599 HLARETWQVLRREWFRPERTGLETKF 624
            LA+ TW VL+REWF  E+TGL T F
Sbjct: 604 RLAKLTWDVLKREWFSSEKTGLTTNF 629

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score =  780 bits (2014), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/620 (60%), Positives = 465/620 (75%), Gaps = 13/620 (2%)

Query: 6   TTVPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLRSRMEA 65
           + +P++LK+ ++LWL  D+N +T  E+  L + ++W ELH RL+ R+ FGTAGLR+RMEA
Sbjct: 3   SNIPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARMEA 62

Query: 66  GFSRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQLGFKVY 125
           GFSRMNTL V+QA+QGLA YIK QFP++L  +VGHDHR++S +FA+ T T  L+ GF+V+
Sbjct: 63  GFSRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFEVH 122

Query: 126 YLNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQIIPPH 185
           YLN       +++VHTPMVPFT++++ AS G+MITASHNPK+DNGYKVYY+NGCQIIPPH
Sbjct: 123 YLN-----QGDSYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIPPH 177

Query: 186 DRLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELV-RVPML 244
           D  I+ +I+ NL P N  WD D+ ++ A + G L   ++K+  +YI  V D  V  +  L
Sbjct: 178 DSAIARSIESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFVTELDSL 237

Query: 245 DCDKPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPNPEEK 304
              KPWFVYTPMHGVG+++F+QIA   L L+  + ++ V EQ  PDP FPTV FPNPEEK
Sbjct: 238 PKGKPWFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPEEK 297

Query: 305 GALDLSIALAEEQDIRLVIANDPDADRFSVAVKNGDRWSQLTGNEIGFLFAYYQWQDYQK 364
           GALDL+I LAE   I+LVIA+DPDADRFSVA K    W QL+GN+IGFLFAYY+ Q Y+ 
Sbjct: 298 GALDLAIKLAENHGIKLVIASDPDADRFSVAFKGPHGWQQLSGNDIGFLFAYYELQKYRG 357

Query: 365 LGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQGYYVPF 424
               ++K HPLAM+NSTVSSQMI S+A  E FH+EDTLTGFKW+GNRA ELE +GYYVPF
Sbjct: 358 FDAEYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYYVPF 417

Query: 425 AYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGVFKEYNG 484
            +EEAIGYMFP  EHDKDGISAAVVFLQ Y  W+S+ + +PL +LDE   KYGVF+EYNG
Sbjct: 418 GFEEAIGYMFPATEHDKDGISAAVVFLQAYHSWISQGK-SPLDILDEASAKYGVFREYNG 476

Query: 485 YYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTIDNVPNLP 544
           YY+V   SLT + F YIREDYTP G  YP  IG +  V +FRDLTTGYQSDT +N+PNL 
Sbjct: 477 YYLVDEPSLTNKTFAYIREDYTPKGENYPRTIG-DLQVKTFRDLTTGYQSDTPNNIPNLH 535

Query: 545 VDASSQMITATLRPSNGKESTSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQHLARET 604
           VD SSQMIT   +P  G    SGE VRFT+RGSGTEPKLKVYIEA +  + RA+ LAR+T
Sbjct: 536 VDPSSQMITIVAQPKGGG---SGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQT 592

Query: 605 WQVLRREWFRPERTGLETKF 624
           W +LR EWF   R GL TKF
Sbjct: 593 WDILREEWFN--RPGLTTKF 610

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score =  776 bits (2004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/622 (60%), Positives = 464/622 (74%), Gaps = 9/622 (1%)

Query: 8   VPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLRSRMEAGF 67
           +PDDL++ ++ W  YDKNP+T +E+ +LV+ ++W EL GRL +RISFGTAGLR+RMEAGF
Sbjct: 13  IPDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGLRARMEAGF 72

Query: 68  SRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQLGFKVYYL 127
           +RMNTLTV+QASQGLA+YIKSQFP NL V+VGHDHRY+S  FA V + AFLQLGF+VYYL
Sbjct: 73  ARMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIAAFLQLGFEVYYL 132

Query: 128 N-LSSKDSTETFVHTPMVPFTINQL--NASAGIMITASHNPKMDNGYKVYYSNGCQIIPP 184
           N + S    E++VHTPMVPFT++ +   AS GIMITASHNPKMDNGYKVYYSNGCQI PP
Sbjct: 133 NYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQITPP 192

Query: 185 HDRLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVRVPML 244
           HD+ I+  ID NLVPW++AWD  ++I+ A  +  L DVK+++   Y++ +   LV    L
Sbjct: 193 HDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQSSLVTTNSL 252

Query: 245 -DCDKPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPNPEE 303
            DC K WFVYTPMHGVG+EIF  I    L LKE +HY+ V  Q+ PDP F TVSFPNPEE
Sbjct: 253 ADCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFPNPEE 312

Query: 304 KGALDLSIALAEEQDIRLVIANDPDADRFSVAVKNGDRWSQLTGNEIGFLFAYYQWQDYQ 363
           +GAL+L+I LA      LV+ANDPDADRFS AVK+G++W QLTGN++G+LFA  Q + + 
Sbjct: 313 EGALNLAIELAARSGAELVLANDPDADRFSAAVKDGNKWKQLTGNQLGYLFAVGQLEKFS 372

Query: 364 KLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQGYYVP 423
              E+ K   PLAM+ STVSSQMI  +A+ E F + +TLTGFKWL NRA +LE  G+YVP
Sbjct: 373 NQNENKK---PLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLENDGFYVP 429

Query: 424 FAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGVFKEYN 483
           FAYEEAIGYMF  V HDKDG+SAA  FLQM   W  K+  TPL VL+ G+ KYG F EYN
Sbjct: 430 FAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARW-KKEGKTPLDVLNAGYEKYGNFVEYN 488

Query: 484 GYYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTIDNVPNL 543
           GYY V  LS+  +VF YIR     +   YP  IG+EF+V SFRDLT GYQSDT +++PNL
Sbjct: 489 GYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDTGNHIPNL 548

Query: 544 PVDASSQMITATLRPSNGKES-TSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQHLAR 602
           PV   S MIT  L+P   + + TS + VRFTIRGSGTEPKLKVYIE+ + D++ A  LA+
Sbjct: 549 PVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDKEYATKLAK 608

Query: 603 ETWQVLRREWFRPERTGLETKF 624
            TW VL+REWFRPE TGL+TKF
Sbjct: 609 LTWDVLKREWFRPEVTGLQTKF 630

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score =  765 bits (1975), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/622 (60%), Positives = 463/622 (74%), Gaps = 17/622 (2%)

Query: 8   VPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLRSRMEAGF 67
           VP+ LK S + WL YD+N ETRSE+L ++  K W+EL  RL+ RI FGTAGLR RMEAGF
Sbjct: 15  VPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIPFGTAGLRGRMEAGF 74

Query: 68  SRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQLGFKVYYL 127
           +RMN+L +LQ SQGLA YI  +FP+NLSV+VGHDHRYHS EFA +TV  FL  GFKV+YL
Sbjct: 75  TRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADITVATFLNAGFKVFYL 134

Query: 128 NLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQIIPPHDR 187
           N  ++     FVHTP+VP+++++L ++ G+MITASHNPK DNGYKVYYSNGCQIIPPHD+
Sbjct: 135 NTENE-----FVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNGCQIIPPHDK 189

Query: 188 LISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVR--VPMLD 245
            I+ TI++NL PW+K W+  ++  T   +G L     K+   Y++ ++  +     PML 
Sbjct: 190 NIALTIEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDITRYVFTNGSPMLK 249

Query: 246 CDKPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPNPEEKG 305
             KPWFVYTPMHGVG +IF QIA   LGL E   Y  VPEQ  PDP+FPTVSFPNPEEKG
Sbjct: 250 TGKPWFVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPTVSFPNPEEKG 309

Query: 306 ALDLSIALAEEQDIRLVIANDPDADRFSVAVKN--GDRWSQLTGNEIGFLFAYYQWQDYQ 363
           ALD++I LAE + + L+IANDPDADRFS AVK+     W QL+GNEIG LFA ++ Q+++
Sbjct: 310 ALDMAIQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGSLFAIFKLQEHK 369

Query: 364 KLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQGYYVP 423
           +   S K   PLAM+NSTVSSQM+K +A+ E FHYE+TLTGFKW+GNRA +LE QGY V 
Sbjct: 370 EKAASRK---PLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRALQLEQQGYDVC 426

Query: 424 FAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGVFKEYN 483
           F YEEAIGYMFP +EHDKDGI A+VVFL MY +WL  + + PL VLD  F KYGVF EYN
Sbjct: 427 FGYEEAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCFEKYGVFSEYN 486

Query: 484 GYYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTIDNVPNL 543
           GYY V   +L + VF YIR++Y P    YP  +G EF + SFRDLT GYQSDTID  P L
Sbjct: 487 GYYTVEEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQSDTIDFKPTL 546

Query: 544 PVDASSQMITATLRPSNGKESTSG-EQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQHLAR 602
           PVDASSQMITATL+P    E T G E++RFTIRGSGTEPKLKVYIE+ + +++ A +LA 
Sbjct: 547 PVDASSQMITATLKP----ERTVGHEEIRFTIRGSGTEPKLKVYIESHAANKEAAANLAH 602

Query: 603 ETWQVLRREWFRPERTGLETKF 624
            TW VLRREWFRPE TGL+T F
Sbjct: 603 LTWNVLRREWFRPEITGLKTSF 624

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score =  764 bits (1974), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/624 (57%), Positives = 454/624 (72%), Gaps = 11/624 (1%)

Query: 7   TVPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLRSRMEAG 66
           T+P DL++ V  WL  DKNPET +E++ L +     ELH R D RI FGTAGLRS+MEAG
Sbjct: 14  TLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRILFGTAGLRSKMEAG 73

Query: 67  FSRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQLGFKVYY 126
           FSRMNTL VLQA+QGLA+YIK QFP NL  ++GHDHRYHS EFA +  + FL  GF VY 
Sbjct: 74  FSRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIATSVFLSAGFTVYN 133

Query: 127 LNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQIIPPHD 186
           LN        TFVHTP+VPFT++Q+ AS G+MITASHNPKMDNGYKVYYSNGCQIIPP D
Sbjct: 134 LNPPG-----TFVHTPLVPFTVDQIGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPVD 188

Query: 187 RLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVRVPML-- 244
             I++ ID+NL PW+ +WD  + I+  + +  L  ++ ++   Y   V + ++    +  
Sbjct: 189 ASIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNIIDKKTIRE 248

Query: 245 --DCDKPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPNPE 302
             +  KPWFVYTPMHGVG+EIF  + L  + LKE + Y+ V EQ  PDPAFPT+SFPNPE
Sbjct: 249 FDEHRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFPTISFPNPE 308

Query: 303 EKGALDLSIALAEEQDIRLVIANDPDADRFSVAVKNGD--RWSQLTGNEIGFLFAYYQWQ 360
           EKGALD++IALA+E DI LVIANDPDADRFS A+ N     W QLTGNEIGFLF YY + 
Sbjct: 309 EKGALDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIGFLFGYYLFN 368

Query: 361 DYQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQGY 420
            Y  +   FKK HPLAM+NSTVSS+M+KS+A+ E F + DTLTGFKW+GN+A +L+ +GY
Sbjct: 369 KYTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKAIDLKKEGY 428

Query: 421 YVPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGVFK 480
           +V F YEEAIGYMFP +EHDKDGI+A+VVFLQ Y EW +  ++T + +L++G  KYG FK
Sbjct: 429 HVVFGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQGIEKYGAFK 488

Query: 481 EYNGYYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTIDNV 540
           EYNGYY+V    +T ++F YIR +Y  +G+ YP  IG+   V SFRDLTTG+QSDT+DN+
Sbjct: 489 EYNGYYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGFQSDTVDNI 548

Query: 541 PNLPVDASSQMITATLRPSNGKESTSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQHL 600
           P+LPVD SSQMIT T +  + +   S   VRFT+RGSGTEPKLK+YIE  S D   A  +
Sbjct: 549 PSLPVDPSSQMITITAKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHSKDPIAASKI 608

Query: 601 ARETWQVLRREWFRPERTGLETKF 624
           A+ TW VL++EW RPE TG+ T +
Sbjct: 609 AKLTWDVLKKEWIRPEVTGVTTSY 632

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  764 bits (1972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/623 (59%), Positives = 460/623 (73%), Gaps = 13/623 (2%)

Query: 7   TVPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLRSRMEAG 66
             P+ L+  +  WL  DKN ETR E+L+L + + W EL+ R  +RI FGTAGLRSRMEAG
Sbjct: 11  NAPEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTAGLRSRMEAG 70

Query: 67  FSRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQLGFKVYY 126
            +R+N+L +LQA+QGLA YI SQFP+N   +VGHDHR+HS EFA VT   FL+ GFKV Y
Sbjct: 71  TNRLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAVFLRAGFKVLY 130

Query: 127 LNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQIIPPHD 186
           LN       +T VHTP+VPFT++ LNAS G+MITASHNPKMDNGYKVY++NGCQIIPPHD
Sbjct: 131 LN-----PGDTLVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANGCQIIPPHD 185

Query: 187 RLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELV---RVPM 243
             I+ +IDQNL PW  +WD   VI+ A +   +  VK+++T  Y KT   +L+   +V  
Sbjct: 186 LNIARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGGRKVLR 245

Query: 244 LDCDKPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPNPEE 303
                PWFVYTPMHGVG EIF +I+   LG+KE + Y+CVPEQ+ PDP+FPTVSFPNPEE
Sbjct: 246 NPGSGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSFPNPEE 305

Query: 304 KGALDLSIALAEEQDIRLVIANDPDADRFSVAVKNGD--RWSQLTGNEIGFLFAYYQWQD 361
           KGALD +I LA +  I LVIANDPDADRFS+AV +     W QLTGNEIGFLFAY Q++ 
Sbjct: 306 KGALDKAIELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFAYQQFEM 365

Query: 362 YQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQGYY 421
           Y+ + + F+K+HPL ++NSTVSSQMIK +AE E FHYEDTLTGFKW+GNRA +LE +G++
Sbjct: 366 YKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLEKKGFF 425

Query: 422 VPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGVFKE 481
            PF YEEAIGYMF ++EHDKDGISA+++FL  Y  W+      PL +L++G+ KYGVFKE
Sbjct: 426 APFGYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKYGVFKE 485

Query: 482 YNGYYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTIDNVP 541
           YNGYYIV    + KE FDYIR D  P G  YP AIGSEF V+SFRDLT G+QSDT D++P
Sbjct: 486 YNGYYIVDNPKIMKETFDYIRNDRKP-GTQYPEAIGSEFQVVSFRDLTLGFQSDTSDHIP 544

Query: 542 NLPVDASSQMITATLRPSNGKESTSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQHLA 601
            LPVD +SQMIT   +P++  ++   + VRFTIRGSGTEPKLKVYIEA S  E  AQ LA
Sbjct: 545 TLPVDPNSQMITVCAKPTH--DNVERDHVRFTIRGSGTEPKLKVYIEACSGSETGAQQLA 602

Query: 602 RETWQVLRREWFRPERTGLETKF 624
           ++ W  L+  WFRP+ TGL T F
Sbjct: 603 KQMWDTLQEVWFRPQTTGLVTDF 625

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score =  761 bits (1964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/629 (59%), Positives = 457/629 (72%), Gaps = 10/629 (1%)

Query: 1   MSDSYTTVPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLR 60
           M ++   VP  LK+S+  WLT+DKN ET+ E+  LV    W+EL  RL  RI+FGTAGLR
Sbjct: 1   MKENTDAVPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLR 60

Query: 61  SRMEAGFSRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQL 120
           +RMEAGFSRMNTLTV+QASQGLA YIKSQFP++L V++GHDHR+HS EFA  T+ AFLQL
Sbjct: 61  ARMEAGFSRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQL 120

Query: 121 GFKVYYLNLSSKDSTE-TFVHTPMVPFTINQLNA---SAGIMITASHNPKMDNGYKVYYS 176
            + +YYLN     S E  FVHTPMVPF IN +     S G+MITASHNPKMDNGYKVYY+
Sbjct: 121 DYDIYYLNYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYA 180

Query: 177 NGCQIIPPHDRLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSD 236
           NGCQIIPPHD LI   ID NL PW +AWD   +I+ AI+SG L DV++++  KY  ++  
Sbjct: 181 NGCQIIPPHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQT 240

Query: 237 ELVRVPMLD-CDKPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPT 295
            LV+   L     PWFVYTPMHGVG+E F++     LG++E K Y+ VPEQ+ PDP FPT
Sbjct: 241 MLVKQSNLKFAGGPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPT 300

Query: 296 VSFPNPEEKGALDLSIALAEEQDIRLVIANDPDADRFSVAVKNGDRWSQLTGNEIGFLFA 355
           VSFPNPEE+GALD+++ +A+   I +V+ANDPDADRFSVAVK    W+QLTGN+IG LFA
Sbjct: 301 VSFPNPEERGALDMAMKVADANGITVVLANDPDADRFSVAVKYHGEWNQLTGNQIGILFA 360

Query: 356 YYQWQDYQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFEL 415
             + Q Y K  +  +KQ  LAM+ S VSSQ+++ +AE E F   +TLTGFKWLGNRA EL
Sbjct: 361 QAEMQSYFKEPKLDRKQ--LAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRAREL 418

Query: 416 ETQGYYVPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGK 475
           E +GYYVPFAYEEAIGYMF +V HDKDGI+AA VFLQM  EW  K   +  +VL E + K
Sbjct: 419 ELEGYYVPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEW-KKVAKSSQEVLQECYEK 477

Query: 476 YGVFKEYNGYYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSD 535
           YG F +YNGYYI    ++TKEVFDY R +YTP+G  YP  IG EF V   RDLT GYQSD
Sbjct: 478 YGYFVDYNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQSD 537

Query: 536 TIDNVPNLPVDASSQMITATLRPSNGKESTSGEQVRFTIRGSGTEPKLKVYIEAKSTDEK 595
           T  N+P+LPVD +SQMIT  L+P   K  T  E VRFT RGSGTEPKLKVYIE+ + + +
Sbjct: 538 TATNIPDLPVDHNSQMITCVLKPV--KMETDCESVRFTARGSGTEPKLKVYIESCAANHQ 595

Query: 596 RAQHLARETWQVLRREWFRPERTGLETKF 624
           RA HL+   W VL+REWFRP  TGL+T F
Sbjct: 596 RASHLSHLAWDVLKREWFRPTETGLQTNF 624

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score =  757 bits (1954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/623 (60%), Positives = 461/623 (73%), Gaps = 14/623 (2%)

Query: 8   VPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLRSRMEAGF 67
            P +L+E+++LWL  DK  ETR+E++ L +  +W ELH R D RI FGTAGLRSRMEAGF
Sbjct: 12  CPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLRSRMEAGF 71

Query: 68  SRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQLGFKVYYL 127
           SRMN L +LQASQGLA YIK+QFP NL+ +VGHDHR+HS +FA +T + FL++GFKVYYL
Sbjct: 72  SRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASVFLRVGFKVYYL 131

Query: 128 NLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQIIPPHDR 187
           N       ++FVHTP+VPF++N LNAS G+MITASHNPKMDNGYKVYYSNGCQIIPPHD+
Sbjct: 132 N-----PEDSFVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQIIPPHDK 186

Query: 188 LISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVRV----PM 243
            I+ TID+NL PW+  W+ D   +  ++   L  V+E++T+KY++ + D LV      P 
Sbjct: 187 NIAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSSSISRPN 246

Query: 244 LDCDKPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPNPEE 303
            +  KPWFVYTPMHGVG+ IF +I+   L  +E   Y  V EQ  PDPAFPTVSFPNPEE
Sbjct: 247 NNGKKPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEE 306

Query: 304 KGALDLSIALAEEQDIRLVIANDPDADRFSVAVKN--GDRWSQLTGNEIGFLFAYYQWQD 361
           KGAL L+  LAEE +I LVIANDPDADRFSVA KN    +W QL+GNEIGFLFA ++ + 
Sbjct: 307 KGALSLATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFASFELEK 366

Query: 362 YQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQGYY 421
           Y      +++ HPLAMINSTVSSQMIK +A+ E FHYEDTLTGFKW+GNRA +L+ QGYY
Sbjct: 367 YMSQDIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDLQGQGYY 426

Query: 422 VPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGVFKE 481
           VPF +EEAIGYMFP +  DKDG+SAAVVFL  Y  WL+ D   P  +L++GF K+G FKE
Sbjct: 427 VPFGFEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEKGFKKFGFFKE 486

Query: 482 YNGYYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTIDNVP 541
           YNGYYI      TK++FD++R  Y  SG+ YP  IG EF +  FRDLTTGYQS+TIDN+P
Sbjct: 487 YNGYYIYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSNTIDNLP 546

Query: 542 NLPVDASSQMITATLRPSNGKESTSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQHLA 601
           NLPVD  S+MIT    P   K+     +VRFT+RGSGTEPKLK+YIEA + +EK A  LA
Sbjct: 547 NLPVDPHSEMITIEAVP---KQDIGKSKVRFTMRGSGTEPKLKLYIEAVADNEKCAIDLA 603

Query: 602 RETWQVLRREWFRPERTGLETKF 624
            E W VL++EW RP+ TGL T F
Sbjct: 604 YEMWNVLKKEWIRPDVTGLTTTF 626

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score =  750 bits (1936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/624 (57%), Positives = 458/624 (73%), Gaps = 11/624 (1%)

Query: 4   SYTTVPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLRSRM 63
           S T +P +L+ ++  WL  DKN ETR+E++ L   ++W+ELH R D RI FGTAGLR+RM
Sbjct: 2   STTDIPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRARM 61

Query: 64  EAGFSRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQLGFK 123
           EAG +R+N L +LQASQGLA+YIK +FP+NL+ +VGHDHRYHS EFA+VT   F++ GFK
Sbjct: 62  EAGTNRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGFK 121

Query: 124 VYYLNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQIIP 183
           VYYLN       + FVHTPMVP++++ LNAS G+MITASHNPKMDNGYKVYY+NGCQIIP
Sbjct: 122 VYYLN-----PHDEFVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQIIP 176

Query: 184 PHDRLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVRVPM 243
           PHD  I+ETI+ NL PW+  W+  +++  A   G +  V++++ + Y+ +V ++L++   
Sbjct: 177 PHDHGIAETINNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQRDF 236

Query: 244 LDCD-KPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPNPE 302
              D KPWFVYTPMHGVG +IF  I   +L LK+   Y+ VPEQ+ PDP+F TVSFPNPE
Sbjct: 237 AAPDEKPWFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPNPE 296

Query: 303 EKGALDLSIALAEEQDIRLVIANDPDADRFSVAVKNGDR--WSQLTGNEIGFLFAYYQWQ 360
           EKGAL+L+I LAE   I+LV+ANDP+ADRFSVAV++  +  W QLTGNEIG LFA+Y+++
Sbjct: 297 EKGALNLAITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAFYEFK 356

Query: 361 DYQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQGY 420
            YQK  +   K  PLAM+NSTVS+Q+IK +AE E F Y+DTLTGFKW+GN A +LE +GY
Sbjct: 357 MYQKAADKGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLEEKGY 416

Query: 421 YVPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGVFK 480
           +VPF YEEAIGYMFP +EHDKDG+SAA+VFLQ Y  WL +    P+ ++ E + KYGV  
Sbjct: 417 FVPFGYEEAIGYMFPAMEHDKDGVSAAIVFLQAYANWL-QSSSNPIDIIHECYDKYGVSA 475

Query: 481 EYNGYYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTIDNV 540
           EYNGYYIV   S T +VF+ IR  YT  G ++P +IG  F V  FRDLT G+ S T D  
Sbjct: 476 EYNGYYIVSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKK 535

Query: 541 PNLPVDASSQMITATLRPSNGKESTSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQHL 600
           P LPVD +SQMIT T  PS    S +GE VRFTIRGSGTEPKLKVYIE  S+ E RA+ L
Sbjct: 536 PLLPVDKNSQMITITAVPSGA--SNTGESVRFTIRGSGTEPKLKVYIEGISSTEGRARIL 593

Query: 601 ARETWQVLRREWFRPERTGLETKF 624
           A+  W+ L+ EWF+P   GL T F
Sbjct: 594 AKSLWETLKHEWFKPSSNGLSTDF 617

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score =  738 bits (1904), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/625 (60%), Positives = 452/625 (72%), Gaps = 34/625 (5%)

Query: 7   TVPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLRSRMEAG 66
           ++P DL+  V  WL YDK  ETR+E+L L       ELH RLD  I+FGTAGLR RMEAG
Sbjct: 9   SLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAGLRGRMEAG 68

Query: 67  FSRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQLGFKVYY 126
           F+RMN LTV QASQGLA YIK QFPENL+V+VGHDHR++S  F +VTV  FLQLGFKV++
Sbjct: 69  FNRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQLGFKVFH 128

Query: 127 LNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQIIPPHD 186
           LN    ++ ++ VHTP+VPFT+N   AS GIMITASHNPKMDNGYKVYY+NGCQIIPPHD
Sbjct: 129 LN---HENEKSLVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNGCQIIPPHD 185

Query: 187 RLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVRVPM-LD 245
           +LI+E+I  NL P+           ++ ++G + D KEK+T KYI  +   L+   +   
Sbjct: 186 KLIAESIIHNLEPF-----------SSPQTGTIIDCKEKMTKKYIDAIGSTLIDGAVNKK 234

Query: 246 CDKPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPNPEEKG 305
            ++PWFVYTPMHGVGFEIFE I+   L L+EGK Y+ V EQ+ PD  FPTVSFPNPEEKG
Sbjct: 235 TNEPWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPNPEEKG 294

Query: 306 ALDLSIALAEEQD-IRLVIANDPDADRFSVAVKNGDR-----WSQLTGNEIGFLFAYYQW 359
           ALDL++    + D + L+IANDPDADRFSVAV++ D+     W QLTGNEIGFLFAYY+W
Sbjct: 295 ALDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLFAYYEW 354

Query: 360 QDYQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQG 419
           + Y+          PLAM+NSTVSSQMIK +AE E FHYEDTLTGFKWLGNRA ELE +G
Sbjct: 355 ERYKH----SPIDEPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRALELEQEG 410

Query: 420 YYVPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGVF 479
           YY PFAYEEAIGYMF  V HDKDGISAA+VFLQ Y +W +  + T L +L     KYG F
Sbjct: 411 YYTPFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKWRASGQ-TVLDILATASLKYGHF 469

Query: 480 KEYNGYYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTIDN 539
           KE+NGYYIVP L++TK+VFD IR   +P    YP  +GS F +I FRDLT GYQSDT D+
Sbjct: 470 KEFNGYYIVPDLAITKQVFDAIRSIESP----YPKKLGSSFEIIKFRDLTNGYQSDTPDH 525

Query: 540 VPNLPVDASSQMITATLRPSNGKESTSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQH 599
           +P L  D SSQMIT  +       S    +VRFTIRGSGTEPKLKVYIEA++  E  +  
Sbjct: 526 IPELASDPSSQMITCEMLLVEQPTS----RVRFTIRGSGTEPKLKVYIEARTNTEPNSIA 581

Query: 600 LARETWQVLRREWFRPERTGLETKF 624
           LA+ TW VLR+EWF+PE TGL T F
Sbjct: 582 LAKFTWDVLRQEWFKPELTGLLTPF 606

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score =  728 bits (1878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/635 (56%), Positives = 449/635 (70%), Gaps = 25/635 (3%)

Query: 9   PDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLRSRMEAGFS 68
           P+DL++ V LWL  DK+  TR E+++L +  + +ELH R D RI+FGTAGLRS MEAGFS
Sbjct: 15  PEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITFGTAGLRSTMEAGFS 74

Query: 69  RMNTLTVLQASQGLASYIKSQFP---ENLSVIVGHDHRYHSNEFARVTVTAFLQLGFKVY 125
           RMNTLTVLQASQGLA+Y+K+      + L  ++GHDHRYHS EFA++  T FL  GFKVY
Sbjct: 75  RMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAKIAATVFLIAGFKVY 134

Query: 126 YLNLSSKDS--TETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQIIP 183
           YLN  S +      FVHTPMVPFT+  L AS G+M+TASHNPKMDNGYKVYYSNGCQIIP
Sbjct: 135 YLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIP 194

Query: 184 PHDRLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVRVPM 243
           PHD  IS+ ID NL PW  +W+  E++  A   G L   ++ + + YI  + ++L    +
Sbjct: 195 PHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLNDYITQLEEKLTSKDI 254

Query: 244 LDCDK-------PWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTV 296
           +   K       PWFVYTPMHGVG+EIF +I+   L +KEG+ ++ V EQ+ PDP FPTV
Sbjct: 255 IHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQKHPDPGFPTV 314

Query: 297 SFPNPEEKGALDLSIALAEEQDIRLVIANDPDADRFSVAVKNGDR---WSQLTGNEIGFL 353
           SFPNPEEKGA+D+ I LAE+  I LVIANDPDADRFS+AVK+      W Q TGNEIG+L
Sbjct: 315 SFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWHQFTGNEIGYL 374

Query: 354 FAYYQWQDYQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAF 413
           FAY+++Q Y+    S +  H L M+NSTVSSQMIK +AE E F+YE+TLTGFKW+GNRA 
Sbjct: 375 FAYFEFQKYKI---SKQDLHRLYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWIGNRAI 431

Query: 414 ELETQGYYVPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGF 473
           +L  +G  VPF YEEAIGYMFP +E DKDGI+A V+F+Q +  W   D+M P +++  GF
Sbjct: 432 DLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQIDKMDPYEIIQLGF 491

Query: 474 GKYGVFKEYNGYYIVPRLSLTKEVFDYIREDY----TPSGHAYPPAIGSEFSVISFRDLT 529
            KYGVF EYNGYY    L +TK++FDY+R DY    +     YP  IG EF +I +RDLT
Sbjct: 492 KKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNKKYPDHIGEEFKIIKYRDLT 551

Query: 530 TGYQSDTIDNVPNLPVDASSQMITATLRPSNGKESTSGEQVRFTIRGSGTEPKLKVYIEA 589
           TGYQSDT DN P LPVD SSQMIT  + P++ +   S   +R TIRGSGTEPKLKVYIEA
Sbjct: 552 TGYQSDTPDNKPLLPVDPSSQMITVEMIPTDNESDGS---IRLTIRGSGTEPKLKVYIEA 608

Query: 590 KSTDEKRAQHLARETWQVLRREWFRPERTGLETKF 624
            S     A  LA++ W VL+REW RPE+TG+ T F
Sbjct: 609 CSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643

>KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 138/580 (23%), Positives = 222/580 (38%), Gaps = 88/580 (15%)

Query: 55  GTAGLRSRMEAGFSRMNTLTVLQASQGLASYIKSQFPENL---SVIVGHDHRYHSNEFAR 111
           GT+GLR +  A F+     T     +     +    PE     +++VG D RY+++    
Sbjct: 19  GTSGLRKKT-AVFTNEPHYT-----ENFIQAVMEAIPEGCKGATLVVGGDGRYYNDVILH 72

Query: 112 VTVTAFLQLGFKVYYLNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHN---PKMD 168
                    G +   +  +   ST    H         +   + GI++TASHN   PK D
Sbjct: 73  KIAAIGAANGVRKLVIGQNGLLSTPAASHI----MRTYKEKCTGGIILTASHNPGGPKND 128

Query: 169 NGYKVYYSNGCQIIPPHDRLISETIDQ----NLVPWNKAWDCDEVIKTAIESGFLFDVKE 224
            G K   SNG     P    I E   Q     ++P       D + +       L DV +
Sbjct: 129 MGIKYNLSNGGPAPEPVTNKIWEVSKQLDHYKIIPDLPELALDTLAENVQYGPLLVDVVD 188

Query: 225 KVTSKYIKTVSDELVRVPMLD-------CDKPW-FVYTPMHGV----GFEIF-EQIALLA 271
             T  Y++ +  E+   P++          K W  ++  M+GV    G  IF ++  L A
Sbjct: 189 -TTRDYVEFLK-EIFDFPLIKSFIHKQRSQKHWKLLFDGMNGVTGPYGKAIFVDEFELPA 246

Query: 272 LGLKEGKHYVCVPEQRCPDPAFPTVSFPNPEEKGALDLSIALAEEQDIRLVIANDPDADR 331
             + +  H         P P F  +  P+P    A  L +   + ++I    A+D D DR
Sbjct: 247 EEVLQNWH---------PQPDFGGIH-PDPNLTYARSL-VDRVDRENIEFGAASDGDGDR 295

Query: 332 FSVAVKNGDRWSQLTGNEIGFLFAYYQWQDYQKLGESFKKQHPLAMINSTVSSQMIKSLA 391
            ++    G  +    G+ +  +  Y     Y      F KQ    +  S  ++  I  +A
Sbjct: 296 -NMIYGAGPAFVS-PGDSVAIIAEYAAEIPY------FAKQGIYGLARSFPTASAIDRVA 347

Query: 392 EAEKFHYEDTLTGFKWLGNRAFELETQGYYVPFAYEEAIGYMFPEVEHDKDGISAAVVFL 451
           E       +  TG+K+     F        +    EE+ G     V  +KDG+ A + +L
Sbjct: 348 EKHGLKCYEVPTGWKF-----FCALFDAKKLSICGEESFGTGSNHV-REKDGVWAIIAWL 401

Query: 452 QMYCEWLSK--DRMTPLQVLDEGF-GKYG-VFKEYNGYYIVPRLSLTKEVFDYIREDYTP 507
            +   +  +  DR   ++++ E F  KYG VF     Y  V   S  K+V D +R  YT 
Sbjct: 402 NLLAIYNRRHPDRDVSIKIIQEEFWKKYGRVFFTRYDYEHVDSNS-AKKVIDNLRS-YTE 459

Query: 508 SGHAYPPAIGSEFSVISFRDLTTGYQSDTIDNVPNLPVDAS-SQMITATLRPSNGKESTS 566
                P  +GS+F   +   +T        D      +D S S+     +R SNG     
Sbjct: 460 K----PGVVGSKFPTDTTLTVTESGDFSYKD------LDGSVSEHQGLYVRLSNG----- 504

Query: 567 GEQVRFTIRGSGTEPK---LKVYIEAKSTDEKRAQHLARE 603
               RF +R SGT      +++Y+E    DE +    A E
Sbjct: 505 ---ARFVVRLSGTGSSGATIRLYLEKYCDDESKYGLTAEE 541

>NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 110/444 (24%), Positives = 175/444 (39%), Gaps = 53/444 (11%)

Query: 55  GTAGLRSRMEAGFSRMN-TLTVLQASQGLASYIKSQFPEN---LSVIVGHDHRYHSNEFA 110
           GT+GLR + +      N T   +QA       I    PE     +++VG D RY+++   
Sbjct: 19  GTSGLRKKTKIFKDTPNYTENFIQA-------IMDAIPEGSKGATLVVGGDGRYYNDVIL 71

Query: 111 RVTVTAFLQLGFKVYYLNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNP---KM 167
                     G K   +      ST    H         +     GI++TASHNP   K 
Sbjct: 72  HKIAAIGAANGVKKLVIGQRGLLSTPAASHI----MRTYEEKTQGGIILTASHNPGGIKN 127

Query: 168 DNGYKVYYSNGCQIIPPHDRLISETIDQNLVPWNKAWDCDE-----VIKTAIESGFLFDV 222
           D G K   SNG     P    I E I + +  +    D  E     + K       L DV
Sbjct: 128 DMGIKFNLSNGGPAPEPVTNKIWE-ISKKMTSFKIIKDFPELELETLGKNKKYGPLLVDV 186

Query: 223 KE--KVTSKYIKTVSD-ELVR--VPMLDCDKPW-FVYTPMHGVGFEIFEQIALLALGLKE 276
            +  K   +++K + D +L++  V      K W  ++  M+GV     + I +  LGL  
Sbjct: 187 IDTTKAYVEFVKQIFDFDLIKKFVHKQRDTKHWKLLFDGMNGVTGPYGKAIFVDELGLPA 246

Query: 277 GKHYVCVPEQRCPDPAFPTVSFPNPEEKGALDLSIALAEEQDIRLVIANDPDADRFSVAV 336
            +    V +Q  P P F  V  P+P    A  L +   + ++I    A+D D DR ++  
Sbjct: 247 DE----VLQQWHPSPDFGGVH-PDPNLTYAKAL-VDRVDRENIEFGAASDGDGDR-NMIY 299

Query: 337 KNGDRWSQLTGNEIGFLFAYYQWQDYQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKF 396
             G  +    G+ +  +  Y     Y      F KQ    +  S  +S  I  +A+A   
Sbjct: 300 GAGPAFVS-PGDSVAIIAEYAAEIPY------FAKQGIYGLARSFPTSSAIDRVAKAHGL 352

Query: 397 HYEDTLTGFKWLGNRAFELETQGYYVPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCE 456
           +  +  TG+K+     F        +    EE+ G     V  +KDGI A + +L +   
Sbjct: 353 NCYEVPTGWKF-----FCALFDAKKLSICGEESFGTGSNHVR-EKDGIWAILAWLNLLAI 406

Query: 457 WLSK--DRMTPLQVL-DEGFGKYG 477
           +     DR   ++++ DE + KYG
Sbjct: 407 YNKHHPDRDVSIKIIQDEFWNKYG 430

>Kwal_26.7628 s26 (449302..451014) [1713 bp, 570 aa] {ON} YMR105C
           (PGM2) - Phosphoglucomutase [contig 55] FULL
          Length = 570

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 98/405 (24%), Positives = 158/405 (39%), Gaps = 46/405 (11%)

Query: 92  ENLSVIVGHDHRYHSNEFARVTVTAFLQLGFKVYYLNLSSKDSTETFVHTPMVPFTINQL 151
           EN +++VG D RY++NE  ++        G +   L  +        + TP     I   
Sbjct: 53  ENATLVVGGDGRYYNNEVMQIIGAIAAANGVRKMILGQNG------ILSTPAASHIIRSY 106

Query: 152 --NASAGIMITASHN---PKMDNGYKVYYSNGCQIIPPHDRLISETIDQ----NLVPWNK 202
               + GI++TASHN   P+ D G K   SNG          I E   Q     +V    
Sbjct: 107 PEKCTGGIILTASHNPGGPENDFGIKYNLSNGGPAPESVTNAIFEKSKQLTHYKIVKNFP 166

Query: 203 AWDCDEVIKTAIESGFLFDVKEKVTSKYI---KTVSDELVRVPMLDCDKPW----FVYTP 255
             D  ++ K       L DV +  T+ Y+   K + D  +    +D  +       ++  
Sbjct: 167 KIDFSKIGKDQKYGPLLVDVVDS-TADYVALMKEIFDFDLIKKFIDNQRSTKGFKILFDS 225

Query: 256 MHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPNPEEKGALDLSIALAE 315
           ++GV     E I +  LGL   +    V +   P P F  +  P+P    A  L   + +
Sbjct: 226 LNGVTGPYGEAIFVKELGLPAEE----VLQNYVPKPDFGGLH-PDPNLTYAHTLVERVDK 280

Query: 316 EQDIRLVIANDPDADRFSVAVKNGDRWSQLTGNEIGFLFAYYQWQDYQKLGESFKKQHPL 375
           EQ I    A+D D DR ++    G  +    G+ +  +  Y     Y      FKKQ   
Sbjct: 281 EQ-IAFGAASDGDGDR-NMIYGCGPAFVS-PGDSVAIIAEYASEIPY------FKKQGIY 331

Query: 376 AMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQGYYVPFAYEEAIGYMFP 435
            +  S  +S  I  +A+ +     +  TG+K+     F        +    EE+ G    
Sbjct: 332 GLARSFPTSAAIDRVAKEQGLACYEVPTGWKF-----FCALFDAKKLSICGEESFGTGSN 386

Query: 436 EVEHDKDGISAAVVFLQMYCEWLSK--DRMTPLQVLDEGF-GKYG 477
            V  +KDG+ A V +L +   +     D    ++V+ E F  KYG
Sbjct: 387 HV-REKDGVWAIVAWLNILAIYNRDHPDSDVSIKVIQEKFWAKYG 430

>KLTH0D04796g Chr4 (437416..439128) [1713 bp, 570 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 570

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 108/451 (23%), Positives = 180/451 (39%), Gaps = 67/451 (14%)

Query: 55  GTAGLRSRMEAGFSRMN-TLTVLQASQGLASYIKSQFPE---NLSVIVGHDHRYHSNEFA 110
           GT+GLR + +   +  + T   +QA       I    PE   +  ++VG D RY++NE  
Sbjct: 19  GTSGLRKKTKVFMNEPHYTENFIQA-------IMEAIPEGSQDAVLVVGGDGRYYNNEVL 71

Query: 111 RVTVTAFLQLGFKVYYLNLSSKDSTETFVHTPMVPFTINQL--NASAGIMITASHN---P 165
           +         G K   +  +        + TP     I      ++ GI++TASHN   P
Sbjct: 72  QKIGEIGAANGVKKLIVGQNG------LLSTPAASHIIRSYPEKSTGGIILTASHNPGGP 125

Query: 166 KMDNGYKVYYSNGC--------QIIPPHDRLISETIDQNLVPWNKAWDCDEVIKTAIESG 217
           + D G K   SNG          I     +L S    +N    N      ++ K      
Sbjct: 126 ENDFGIKYNLSNGGPAPESVTNSIFEKSKQLASYKTVKNFPKIN----LSKIGKNQEYGS 181

Query: 218 FLFDVKEKVTSKYIKTVSD----ELVRVPMLDCDKPW----FVYTPMHGVGFEIFEQIAL 269
            L DV + VT++Y+K + +    +L++   +D  +       ++  ++G+     + I  
Sbjct: 182 LLVDVID-VTAEYVKLMKEIFDFDLIK-KFIDHQRSTKGFKILFDALNGITGPYGKAIFA 239

Query: 270 LALGLKEGKHYVCVPEQRCPDPAFPTVSFPNPEEKGALDLSIALAEEQDIRLVIANDPDA 329
             LGL   +    V +   P P F  +  P+P    A  L   + +EQ I    A+D D 
Sbjct: 240 DELGLPAEE----VLQNYEPKPDFGGLH-PDPNLTYAHTLVERVDKEQ-IAFGAASDGDG 293

Query: 330 DRFSVAVKNGDRWSQLTGNEIGFLFAYYQWQDYQKLGESFKKQHPLAMINSTVSSQMIKS 389
           DR ++    G  +    G+ +  +  Y     Y      FKKQ    +  S  +S  I  
Sbjct: 294 DR-NMIYGCGPAFVS-PGDSVAIIAEYASEIPY------FKKQGIYGLARSFPTSAAIDR 345

Query: 390 LAEAEKFHYEDTLTGFKWLGNRAFELETQGYYVPFAYEEAIGYMFPEVEHDKDGISAAVV 449
           +A+A+  +  +  TG+K+     F        +    EE+ G     V  +KDG+ A V 
Sbjct: 346 VAKAQGLNCYEVPTGWKF-----FCALFDAKKLSICGEESFGTGSNHV-REKDGVWAIVA 399

Query: 450 FLQ---MYCEWLSKDRMTPLQVLDEGFGKYG 477
           +L    +Y        ++   VLDE + KYG
Sbjct: 400 WLNILAIYNREHPDSDVSIKVVLDEFWAKYG 430

>Ecym_2475 Chr2 complement(927999..929702) [1704 bp, 567 aa] {ON}
           similar to Ashbya gossypii ABL029W
          Length = 567

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 102/448 (22%), Positives = 178/448 (39%), Gaps = 63/448 (14%)

Query: 55  GTAGLRSRMEAGFSRMNTLTVLQASQGLASYIKSQFPENLS---VIVGHDHRYHSNEFAR 111
           GT+GLR + +       T   +QA       I    PE      ++VG D RY+++   +
Sbjct: 19  GTSGLRKKTKVFQQEHYTENFIQA-------ILEAIPEGCQDAILVVGGDGRYYNDVVMQ 71

Query: 112 VTVTAFLQLGFKVYYLNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHN---PKMD 168
                    G K   +  +   ST    H             + GI++TASHN   P  D
Sbjct: 72  KIAEVGSANGVKKLIIGQNGLMSTPAASHL----IRTYAEKVTGGIILTASHNPGGPDND 127

Query: 169 NGYKVYYSNGCQIIPPHDRLISET--IDQNLV------PWNKAWDCDEVIKTAIESGFLF 220
            G K   +NG    P  +++ S    I + L       P+ K  D   +         L 
Sbjct: 128 LGIKYNLANGA---PAPEKVTSAMYEISKKLTHYKIVEPFPK-LDLSRIGTDQKYGDLLV 183

Query: 221 DVKEKVTSKYIKTVSD----ELVRVPMLDCDKPW---FVYTPMHGVGFEIFEQIALLALG 273
           D+ +  T+ Y+K V +    +L++  +      +    ++  ++G+       I +  LG
Sbjct: 184 DIID-TTAAYVKLVKEIFDFDLIKSFLQKAQSEYDFKILFDALNGITGPYGRAIFVDELG 242

Query: 274 LKEGKHYVCVPEQRC-PDPAFPTVSFPNPEEKGALDLSIALAEEQDIRLVIANDPDADRF 332
           L E  H++    Q C P P F  +  P+P    A DL ++  +E+ I    A+D D DR 
Sbjct: 243 LPE--HFL----QHCTPLPDFGGLH-PDPNLTYAHDL-VSRVDEEQIAFGAASDGDGDR- 293

Query: 333 SVAVKNGDRWSQLTGNEIGFLFAYYQWQDYQKLGESFKKQHPLAMINSTVSSQMIKSLAE 392
           ++    G  +    G+ +  +  Y Q   Y      F K     +  S  +S  I  +A+
Sbjct: 294 NMIYGAGPAFVS-PGDSVAIIAEYAQEIPY------FAKNGIHGLARSFPTSGAIDLVAK 346

Query: 393 AEKFHYEDTLTGFKWLGNRAFELETQGYYVPFAYEEAIGYMFPEVEHDKDGISAAVVFLQ 452
               +  +  TG+K+  N  F+ +     +    EE+ G     +  +KDG+ A + +L 
Sbjct: 347 EHGLNCYEVPTGWKFFCN-LFDSKK----LSICGEESFGTGSDHIR-EKDGLWAIIAWLN 400

Query: 453 MYCEWLSKDRMTPLQ---VLDEGFGKYG 477
           +   +  ++   P     + DE + KYG
Sbjct: 401 VLAIYNRRNPEKPASIKAIQDEFWLKYG 428

>TBLA0B09010 Chr2 complement(2135961..2137670) [1710 bp, 569 aa]
           {ON} Anc_2.445 YKL127W
          Length = 569

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 131/582 (22%), Positives = 224/582 (38%), Gaps = 92/582 (15%)

Query: 55  GTAGLRSRMEAGFSRMN-TLTVLQASQGLASYIKSQFPE---NLSVIVGHDHRYHSNEFA 110
           GT+GLR + +      N T   +QA       I    PE   + +++VG D R++++   
Sbjct: 19  GTSGLRKKTKVFMDEPNYTENFIQA-------IMDAIPEGSKDATLVVGGDGRFYNDVIM 71

Query: 111 RVTVTAFLQLGFKVYYLNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHN---PKM 167
                     G K   +  +   ST    H         +   + GI++TASHN   P  
Sbjct: 72  NKIAAIGAANGVKKLIIGQNGILSTPAASHI----IRTYKDKVTGGIILTASHNPGGPTN 127

Query: 168 DNGYKVYYSNGCQIIPPHDRLISETI--------DQNLVPWNKAWDCDEVIKTAIESGFL 219
           D G K    NG     P    +++ I        D  +V      D   +++       L
Sbjct: 128 DLGIKYNLGNGA----PAPEAVTDAIWEASKKLTDYKIVNDFPELDLATIVENKKYGNLL 183

Query: 220 FDVKEKVTSKYIKTVSDELVRVPMLDC-------DKPW-FVYTPMHGVGFEIFEQIALLA 271
            D+ +  T  Y+K +  E+   P++          K W  ++  ++GV     + I    
Sbjct: 184 VDIIDS-TEAYVKYMK-EIFDFPLIKKFIVSQRETKNWKLLFDSLNGVTGPYGKAIFADE 241

Query: 272 LGLKEGKHYVCVPEQRCPDPAFPTVSFPNPEEKGALDLSIALAEEQDIRLVIANDPDADR 331
            GL   +    V +   P P F  +  P+P    A  L ++  +++ I    A+D D DR
Sbjct: 242 FGLPADE----VLQNYVPKPDFGGLH-PDPNLTYAKTL-VSRVDKEKIEFGAASDGDGDR 295

Query: 332 FSVAVKNGDRWSQLTGNEIGFLFAYYQWQDYQKLGESFKKQHPLAMINSTVSSQMIKSLA 391
            ++    G  +    G+ +  +  Y     Y      F KQ    +  S  +S  I  +A
Sbjct: 296 -NMIYGYGPTFVS-PGDSVAIIAEYASEIPY------FAKQGIYGLARSFPTSSAIDRVA 347

Query: 392 EAEKFHYEDTLTGFKWLGNRAFELETQGYYVPFAYEEAIGYMFPEVEHDKDGISAAVVFL 451
           +    +  +  TG+K+      E +     +    EE+ G     V  +KDG+ A + +L
Sbjct: 348 KEHNLNCYEVPTGWKFFCKLFDENK-----LSICGEESFGTGSNHV-REKDGVWAIMAWL 401

Query: 452 QMYCEWLSK--DRMTPLQVL-DEGFGKYG--VFKEYNGYYIVPRLSLTKEVFDYIREDYT 506
            +   +  K  +R   L+ + DE + KYG   F  Y+   I  +     E+ D ++   +
Sbjct: 402 NILAIYNKKHPERDASLKTIQDEFWAKYGRTFFTRYDFENI--KSETANEIVDILKNFIS 459

Query: 507 PSGHAYPPAIGSEFSVI-SFRDLTTGYQSDTIDNVPNLPVDAS-SQMITATLRPSNGKES 564
            S      AIGS F    S +    G  S T        +D S S+     ++ SNG   
Sbjct: 460 KS-----DAIGSVFPADESLKIADCGDFSYT-------DLDGSVSKNQGLFIKFSNG--- 504

Query: 565 TSGEQVRFTIRGSGTEPK---LKVYIEAKSTDEKRAQHLARE 603
                 R  +R SGT      +++Y+E  + D K+ Q  A +
Sbjct: 505 -----ARLVLRLSGTGSSGATIRMYVEQYTDDSKKYQEAADD 541

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 26/46 (56%), Gaps = 4/46 (8%)

Query: 153 ASAGIMITASHNPKMDNGYKVYYSNGCQII----PPHDRLISETID 194
           A  G+MITASHNP  DNG K+  S+G  ++    P   RL +   D
Sbjct: 52  APVGVMITASHNPPRDNGVKIVESDGSMLLQDWEPLATRLANSVAD 97

>TDEL0A02210 Chr1 (400375..402093) [1719 bp, 572 aa] {ON} Anc_2.445
           YKL127W
          Length = 572

 Score = 38.9 bits (89), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 98/448 (21%), Positives = 176/448 (39%), Gaps = 58/448 (12%)

Query: 55  GTAGLRSRMEAGFSRMNTLTVLQASQGLASYIKSQFPE---NLSVIVGHDHRYHSNEFAR 111
           GT+GLR + +    +         ++     I    PE   + +++VG D RY++++  +
Sbjct: 19  GTSGLRKKTKVFMEKP------HYTENFIQSILDAIPEGSKDATLVVGGDGRYYNDKILQ 72

Query: 112 VTVTAFLQLGFKVYYLNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHN---PKMD 168
           +  +     G     +      ST    H        +    + GI++TASHN   P  D
Sbjct: 73  IIASISAANGVGKLVIGQHGLLSTPAASHIIRTYQDKSGKKVTGGIILTASHNPGGPDND 132

Query: 169 NGYKVYYSNGC--------QIIPPHDRLISETIDQNLVPWNKAWDCDEVIKTAIESGFLF 220
            G K   SNG          I     +L S  I +NL   + +   ++ +          
Sbjct: 133 IGIKYNLSNGGPAPESVTNAIWEISKKLTSYKIIKNLPQLDLSTKGEKKL-----GNLEI 187

Query: 221 DVKEKVTSKYIKTVSD----ELVR--VPMLDCDKPW-FVYTPMHGVGFEIFEQIALLALG 273
           DV + VT  Y++ + +    +L++  V      K W  ++  ++GV     + I +  LG
Sbjct: 188 DVVD-VTQAYVEFLKEIFDFDLIKKFVDTQRSTKHWKLLFDGLNGVTGPYGKAIFVDELG 246

Query: 274 LKEGKHYVCVPEQRC-PDPAFPTVSFPNPEEKGALDLSIALAEEQDIRLVIANDPDADRF 332
           L E +       Q C P P F  +  P+P    A  L +   +++ I    A+D D DR 
Sbjct: 247 LPENEVL-----QNCHPKPDFGGI-HPDPNLTYARTL-VERVDKEKIEFGAASDGDGDR- 298

Query: 333 SVAVKNGDRWSQLTGNEIGFLFAYYQWQDYQKLGESFKKQHPLAMINSTVSSQMIKSLAE 392
           ++    G  +    G+ +  +  Y +   Y      F KQ    +  S  +S  I  +A 
Sbjct: 299 NMIYGYGPAFVS-PGDSVAIIAEYAKEIPY------FAKQGIYGLARSFPTSSAIDRVAA 351

Query: 393 AEKFHYEDTLTGFKWLGNRAFELETQGYYVPFAYEEAIGYMFPEVEHDKDGISAAVVFLQ 452
            +  +  +  TG+K+     F        +    EE+ G     V  +KDG+ A + +L 
Sbjct: 352 EQGLNCYEVPTGWKF-----FCALFDAKKLSICGEESFGTGSNHV-REKDGVWAIIAWLN 405

Query: 453 ---MYCEWLSKDRMTPLQVLDEGFGKYG 477
              +Y +   +   +   + DE + KYG
Sbjct: 406 ILAIYNKHHPQKEASIKTIQDEFWLKYG 433

>TBLA0I01380 Chr9 complement(297671..299386) [1716 bp, 571 aa] {ON}
           Anc_2.445 YKL127W
          Length = 571

 Score = 38.9 bits (89), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 105/443 (23%), Positives = 175/443 (39%), Gaps = 50/443 (11%)

Query: 55  GTAGLRSRMEAGFSRMNTLTVLQASQGLASYIKSQFPENL---SVIVGHDHRYHSNEFAR 111
           GT+GLR +  A F +    T     +     I    PE     +++VG D RY+++    
Sbjct: 20  GTSGLRKKT-AIFEKEPNYT-----ENFIQAIMEAIPEGCKGATLVVGGDGRYYNDAILH 73

Query: 112 VTVTAFLQLGFKVYYLNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHN---PKMD 168
                    G K   +  +   ST    H   +  T      + GI++TASHN   PK D
Sbjct: 74  NIAAIGAANGVKKLIVGQNGLLSTPAASH---IIRTYAPGEITGGIILTASHNPGGPKND 130

Query: 169 NGYKVYYSNGCQIIPPHDRLISETIDQNLVPWNKAWDCDEV-IKTAIESG----FLFDVK 223
            G K    NG     P    I E   + L  +    D  E+ +KT  ++      L DV 
Sbjct: 131 MGIKYNIQNGAPAPEPVTEAIWEA-SKKLQNYKIIKDFPELELKTLGKNKQYGPLLVDVI 189

Query: 224 EKVTS--KYIKTVSDELVRVPMLDCD---KPW-FVYTPMHGVGFEIFEQIALLALGLKEG 277
           +   +  ++IK + D  +    +D     K W  ++  M+GV     + I +  LGL   
Sbjct: 190 DTCEAYVQFIKEIFDFPLIKKFVDTQRKTKNWKLLFDGMNGVTGPYGKAIFVDELGLPAD 249

Query: 278 KHYVCVPEQRCPDPAFPTVSFPNPEEKGALDLSIALAEEQDIRLVIANDPDADRFSVAVK 337
           +    V +   P P F     P+P    A  L +   +++ I    A+D D DR ++   
Sbjct: 250 E----VLKDWHPSPDFGG-HHPDPNLTYAKSL-VDRVDKEKIEFGAASDGDGDR-NMIYG 302

Query: 338 NGDRWSQLTGNEIGFLFAYYQWQDYQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFH 397
            G  +    G+ +  +  Y     Y      FKK     +  S  ++  I  +A+A    
Sbjct: 303 YGPAFVS-PGDSVAIIAEYASDIPY------FKKNGIYGLARSFPTASSIDRVAKAHGLK 355

Query: 398 YEDTLTGFKWLGNRAFELETQGYYVPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEW 457
             +  TG+K+   + F+ +     V    EE+ G     V  +KDG+ A + +L +   +
Sbjct: 356 AYEVPTGWKFF-CKLFDSKK----VSICGEESFGTGSNHV-REKDGVWAIIAWLNILAIY 409

Query: 458 LSKD---RMTPLQVLDEGFGKYG 477
             K+     +   + DE + KYG
Sbjct: 410 NQKNPEKEASIKTIQDEFWLKYG 432

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score = 37.7 bits (86), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 19/28 (67%)

Query: 155 AGIMITASHNPKMDNGYKVYYSNGCQII 182
            G+M+TASHNP +DNG KV    G  +I
Sbjct: 60  VGVMVTASHNPPLDNGVKVVEPTGAMLI 87

>CAGL0K03421g Chr11 complement(314680..316386) [1707 bp, 568 aa]
           {ON} highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105c Phosphoglucomutase 2
          Length = 568

 Score = 37.7 bits (86), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 130/578 (22%), Positives = 221/578 (38%), Gaps = 84/578 (14%)

Query: 55  GTAGLRSRMEAGFSRMNTLTVLQASQGLASYIKSQFPENLS---VIVGHDHRYHSNEFAR 111
           GT+GLR + +    + N +      +     +    PE      ++VG D RY+++   +
Sbjct: 18  GTSGLRKKTKVFEDQPNYV------ENFIQSVMEAIPEGAKGAVLVVGGDGRYYNDVILQ 71

Query: 112 VTVTAFLQLGFKVYYLNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHN---PKMD 168
                    G K   +  +   ST    H         +   + GI++TASHN   P+ D
Sbjct: 72  KIAAIGAANGVKKLVIGQNGLLSTPAASHI----MRTYKEKCTGGIILTASHNPGGPEND 127

Query: 169 NGYKVYYSNGCQIIPPHDRLISETIDQNLVPWNKAWDCDEVIKTAIESG-----FLFDVK 223
            G K   SNG     P    I E I + L  +    D  E+  T +         L DV 
Sbjct: 128 MGIKYNLSNGGPAPEPVTNKIWE-ISKKLTHYKIVKDFPELDLTKLVENKKYGPLLVDVI 186

Query: 224 EKVTSKYIKTVSD----ELVR--VPMLDCDKPW-FVYTPMHGVGFEIFEQIALLALGLKE 276
           +  T  YI+ + +    EL+   +     +K W  +   M+GV     + I +   GL  
Sbjct: 187 D-TTDAYIQLLKEIFDFELIHKFIAKQRKEKGWKLLVDSMNGVTGPYAKAIFVDEFGLDS 245

Query: 277 GKHYVCVPEQRCPDPAFPTVSFPNPEEKGALDLSIALAEEQDIRLVIANDPDADRFSVAV 336
            +    V +   P P F  +  P+P    A  L +    ++ I    A+D D DR ++  
Sbjct: 246 KE----VLQNWHPQPDFGGLH-PDPNLTYAHTL-VERVNKEKIEFGAASDGDGDR-NMIY 298

Query: 337 KNGDRWSQLTGNEIGFLFAYYQWQDYQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKF 396
             G  +    G+ +  +  Y     Y      FKKQ    +  S  ++  I  +A+    
Sbjct: 299 GYGPAFVS-PGDSVAIIAEYANEIPY------FKKQGIYGLARSFPTASAIDRVAKKHGL 351

Query: 397 HYEDTLTGFKWLGNRAFELETQGYYVPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCE 456
           +  +  TG+K+     F        +    EE+ G     V  +KDGI A + +L +   
Sbjct: 352 NCYEVPTGWKF-----FCALFDAKKLSICGEESFGTGSNHV-REKDGIWAIMAWLNILAI 405

Query: 457 WLSK--DRMTPLQVL-DEGFGKYG--VFKEYNGYYIVPRLSLTKEVFDYIRE---DYTPS 508
           +  +  D+   ++ + +E +  YG   F  Y+  Y         +V + +R+   D    
Sbjct: 406 FNQRHPDKEASIKTIQNEFWDTYGRTFFTRYD--YEKVETDKANKVIENLRQYVADSGTK 463

Query: 509 GHAYPPAIGSEFSVISFRDLTTGYQSDTIDNVPNLPVDASSQMITATLRPSNGKESTSGE 568
           G  +P    S  +V+   D +      TI         +S Q +   L  SNG       
Sbjct: 464 GSKFP--TDSALTVVDAGDFSYTDLDGTI---------SSHQGLYVIL--SNG------- 503

Query: 569 QVRFTIRGSGTEPK---LKVYIEAKSTDEKRAQHLARE 603
             RF +R SGT      +++YIE  + D+ +    A+E
Sbjct: 504 -ARFVVRLSGTGSSGATIRLYIERYTDDKSKYSLDAQE 540

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score = 37.7 bits (86), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%)

Query: 156 GIMITASHNPKMDNGYKVYYSNGCQII 182
           G+MITASHNP  DNG KV   +G  +I
Sbjct: 58  GVMITASHNPSGDNGVKVVEPDGSMLI 84

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 154 SAGIMITASHNPKMDNGYKVYYSNGCQI 181
           + G+M+TASHNP +DNG K+   NG  +
Sbjct: 61  AVGVMVTASHNPPVDNGVKIVEPNGSML 88

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 156 GIMITASHNPKMDNGYKVYYSNGCQII 182
           G+MITASHNP  DNG K+   +G  +I
Sbjct: 60  GVMITASHNPPQDNGVKIVEPSGAMLI 86

>NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 134/576 (23%), Positives = 221/576 (38%), Gaps = 80/576 (13%)

Query: 55  GTAGLRSRMEAGFSRMN-TLTVLQASQGLASYIKSQFPENL---SVIVGHDHRYHSNEFA 110
           GT+GLR +      + + T   +QA       I    PE     +++VG D RY+++   
Sbjct: 19  GTSGLRKKTRVFKDKPHYTENFIQA-------IMDAIPEGAKGATLVVGGDGRYYNDVIL 71

Query: 111 RVTVTAFLQLGFKVYYLNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNP---KM 167
                     G K   +      ST    H         +   + GI++TASHNP   + 
Sbjct: 72  HKIAAIGAANGVKKLVVGQHGLLSTPAASHI----MRTYEEKTTGGIILTASHNPGGLEN 127

Query: 168 DNGYKVYYSNGCQIIPPHDRLISETIDQNLVPWNKAWDCDE-----VIKTAIESGFLFDV 222
           D G K   SNG     P    I E I + +  +    D  E     + K       L DV
Sbjct: 128 DMGIKYNLSNGGPAPEPVTNKIWE-ISKKMTHYKIIKDFPELELETLGKNKKYGPLLVDV 186

Query: 223 KE--KVTSKYIKTVSD-ELVRVPMLDC--DKPW-FVYTPMHGVGFEIFEQIALLALGLKE 276
            +  K    ++K + D EL++  + +    K W  ++  M+GV     + I +   GL  
Sbjct: 187 IDITKAYVDFLKEIFDFELIKKFIHNQREKKHWKLLFDGMNGVTGPYGKAIFVDEFGLPA 246

Query: 277 GKHYVCVPEQRCPDPAFPTVSFPNPEEKGALDLSIALAEEQDIRLVIANDPDADRFSVAV 336
            +    V +Q  P P F  V  P+P    A  L   +  E+ I    A+D D DR ++  
Sbjct: 247 DE----VLQQWHPQPDFGGVH-PDPNLTYAKALVDRVNREK-IEFGAASDGDGDR-NMIY 299

Query: 337 KNGDRWSQLTGNEIGFLFAYYQWQDYQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKF 396
             G  +    G+ +  +  Y     Y      FKKQ    +  S  ++  I  +A+A   
Sbjct: 300 GAGPAFVS-PGDSVAIIAEYASEIPY------FKKQGIYGLARSFPTASSIDRVAKAHGL 352

Query: 397 HYEDTLTGFKWLGNRAFELETQGYYVPFAYEEAIGYMFPEVEHDKDGISAAVVFLQ---M 453
           +     TG+K+     F        +    EE+ G     V  +KDG+ A + +L    +
Sbjct: 353 NCYQVPTGWKF-----FCALFDANKLSICGEESFGTGSNHVR-EKDGLWAIIAWLNVLAI 406

Query: 454 YCEWLSKDRMTPLQVLDEGFGKYG--VFKEYNGYYIVPRLSLTKEVFDYIREDYTPSGHA 511
           Y +   +  ++   + DE + KYG   F  Y+  ++    +   +V D +R+    S   
Sbjct: 407 YNKHNPEKDVSIKIIQDEFWNKYGRTFFTRYDYEHVTTEAA--GKVIDQLRKHVESSNF- 463

Query: 512 YPPAIGSEFSVISFRDLTTGYQSDTIDNVPNLPVDAS-SQMITATLRPSNGKESTSGEQV 570
               + S+FS      +T        D      +D S S       R SNG         
Sbjct: 464 ----VNSKFSADETLTVTDAGDFSYTD------LDGSVSAHQGLYFRLSNGS-------- 505

Query: 571 RFTIRGSGTEPK---LKVYIEAKSTDEKRAQHLARE 603
           R  +R SGT      +++Y+E  + D+ +   LA +
Sbjct: 506 RVVVRLSGTGSSGATIRLYVEEYTDDKSQYGKLADD 541

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 21/30 (70%)

Query: 153 ASAGIMITASHNPKMDNGYKVYYSNGCQII 182
           ++ G+M+TASHNP  DNG K+   NG  ++
Sbjct: 66  SAIGVMVTASHNPPEDNGVKIIEPNGSMLL 95

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 19/28 (67%)

Query: 154 SAGIMITASHNPKMDNGYKVYYSNGCQI 181
           + G+MITASHNP  DNG K+   NG  +
Sbjct: 53  AVGVMITASHNPPEDNGVKIVEPNGAML 80

>Kpol_1018.161 s1018 (412372..414081) [1710 bp, 569 aa] {ON}
           (412372..414081) [1710 nt, 570 aa]
          Length = 569

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 97/422 (22%), Positives = 169/422 (40%), Gaps = 60/422 (14%)

Query: 55  GTAGLRSRMEAGFSRMN-TLTVLQASQGLASYIKSQFPENL---SVIVGHDHRYHSNEFA 110
           GT+GLR + +      N T   +QA+           PE     +++VG D RY+++   
Sbjct: 19  GTSGLRKKTKVFAEEPNYTENFIQATM-------DAIPEGCKGATLVVGGDGRYYNDVIM 71

Query: 111 RVTVTAFLQLGFKVYYLNLSSKDSTETFVHTPMVPFTINQLN--ASAGIMITASHN---P 165
              V+     G +   +  +        + TP     I       + GI++TASHN   P
Sbjct: 72  NKIVSIAGANGVRKLIIGHNG------ILSTPAASHVIRSYKEKCTGGIILTASHNPGGP 125

Query: 166 KMDNGYKVYYSNGCQIIPPHDRLISETI---DQNLVPWNKAWDCDEV----IKTAIESG- 217
           K D G K   +NG     P    ++  I    + L  +       E+    I   I+ G 
Sbjct: 126 KNDIGIKYNLANGG----PAPESVTNAIWEASKKLTEYKVIEGLPELDTSKIAVDIKYGP 181

Query: 218 FLFDVKEKVTS--KYIKTVSD-ELVR--VPMLDCDKPW-FVYTPMHGVGFEIFEQIALLA 271
            L D+ +   +   Y+K + D +L++  V      K W  ++  ++GV     E I +  
Sbjct: 182 LLVDIIDSTEAYVDYLKEIFDFKLIKEFVTKQRETKGWKLLFDSLNGVTGPYGEAIFVKE 241

Query: 272 LGLKEGKHYVCVPEQRCPDPAFPTVSFPNPEEKGALDLSIALAEEQDIRLVIANDPDADR 331
           LGL   +    V +   P P F  +  P+P    A  L +   ++++I+   A+D D DR
Sbjct: 242 LGLPADE----VLQNWHPLPDFGGLH-PDPNLTYAHTL-VERVDKENIQFGAASDGDGDR 295

Query: 332 FSVAVKNGDRWSQLTGNEIGFLFAYYQWQDYQKLGESFKKQHPLAMINSTVSSQMIKSLA 391
            ++    G  +    G+ +  +  Y     Y      F KQ    +  S  +S  +  +A
Sbjct: 296 -NMIYGAGPAFVS-PGDSVAIISEYADEIPY------FAKQGIYGVARSFPTSSALDRVA 347

Query: 392 EAEKFHYEDTLTGFKWLGNRAFELETQGYYVPFAYEEAIGYMFPEVEHDKDGISAAVVFL 451
           +A+  +  +  TG+K+     F        V    EE+ G     +  +KDG+ A V +L
Sbjct: 348 KAKGLNCYEVPTGWKF-----FCALFDDQKVSICGEESFGTGSNHI-REKDGVWAIVAWL 401

Query: 452 QM 453
            +
Sbjct: 402 NI 403

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 156 GIMITASHNPKMDNGYKVYYSNGCQII 182
           G+MITASHNP  DNG K+   +G  ++
Sbjct: 61  GVMITASHNPYQDNGVKIVEPDGSMLL 87

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 156 GIMITASHNPKMDNGYKVYYSNGCQII 182
           G+MITASHNP  DNG K+   +G  ++
Sbjct: 61  GVMITASHNPYQDNGVKIVEPDGSMLL 87

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 14/23 (60%), Positives = 18/23 (78%)

Query: 156 GIMITASHNPKMDNGYKVYYSNG 178
           G+M+TASHNP +DNG KV   +G
Sbjct: 60  GVMVTASHNPPVDNGVKVVEPDG 82

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 156 GIMITASHNPKMDNGYKVYYSNGCQII 182
           G+MITASHNP  DNG K+   +G  ++
Sbjct: 61  GVMITASHNPYQDNGVKIVEPDGSMLL 87

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 156 GIMITASHNPKMDNGYKVYYSNGCQII 182
           G+MITASHNP  DNG K+   +G  ++
Sbjct: 61  GVMITASHNPYQDNGVKIVEPDGSMLL 87

>YMR105C Chr13 complement(475897..477606) [1710 bp, 569 aa] {ON}
           PGM2Phosphoglucomutase, catalyzes the conversion from
           glucose-1-phosphate to glucose-6-phosphate, which is a
           key step in hexose metabolism; functions as the acceptor
           for a Glc-phosphotransferase
          Length = 569

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 126/578 (21%), Positives = 216/578 (37%), Gaps = 84/578 (14%)

Query: 55  GTAGLRSRMEAGFSRMNTLTVLQASQGLASYIKSQFPEN---LSVIVGHDHRYHSNEFAR 111
           GT+GLR + +      N       ++     I    PE     +++VG D RY+++    
Sbjct: 19  GTSGLRKKTKVFKDEPNY------TENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 112 VTVTAFLQLGFKVYYLNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHN---PKMD 168
                    G K   +      ST    H         +   + GI++TASHN   P+ D
Sbjct: 73  KIAAIGAANGIKKLVIGQHGLLSTPAASHI----MRTYEEKCTGGIILTASHNPGGPEND 128

Query: 169 NGYKVYYSNGCQIIPPHDRLISETIDQNLVPWNKAWDCDEVIKTAIESG-----FLFDVK 223
            G K   SNG          I E I + L  +    D  E+    I         L D+ 
Sbjct: 129 MGIKYNLSNGGPAPESVTNAIWE-ISKKLTSYKIIKDFPELDLGTIGKNKKYGPLLVDII 187

Query: 224 EKVTSKYIKTVSD----ELVR--VPMLDCDKPW-FVYTPMHGVGFEIFEQIALLALGLKE 276
           + +T  Y+  + +    +L++  +      K W  ++  M+GV     + I +   GL  
Sbjct: 188 D-ITKDYVNFLKEIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVDEFGLPA 246

Query: 277 GKHYVCVPEQRCPDPAFPTVSFPNPEEKGALDLSIALAEEQDIRLVIANDPDADRFSVAV 336
            +    V +   P P F  +  P+P    A  L +   + + I    A+D D DR ++  
Sbjct: 247 DE----VLQNWHPSPDFGGMH-PDPNLTYASSL-VKRVDREKIEFGAASDGDGDR-NMIY 299

Query: 337 KNGDRWSQLTGNEIGFLFAYYQWQDYQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKF 396
             G  +    G+ +  +  Y     Y      F KQ    +  S  +S  I  +A+A   
Sbjct: 300 GYGPSFVS-PGDSVAIIAEYAAEIPY------FAKQGIYGLARSFPTSGAIDRVAKAHGL 352

Query: 397 HYEDTLTGFKWLGNRAFELETQGYYVPFAYEEAIGYMFPEVEHDKDGISAAVVFLQ---M 453
           +  +  TG+K+     F        +    EE+ G     V  +KDG+ A + +L    +
Sbjct: 353 NCYEVPTGWKF-----FCALFDAKKLSICGEESFGTGSNHV-REKDGVWAIMAWLNILAI 406

Query: 454 YCEWLSKDRMTPLQVLDEGFGKYGVFKEYNGYYIVPRLSLTK--EVFDYIREDYTPSG-- 509
           Y +   ++  +   + +E + KYG  + +   Y   ++   K  ++ D +R   T SG  
Sbjct: 407 YNKHHPENEASIKTIQNEFWAKYG--RTFFTRYDFEKVETEKANKIVDQLRAYVTKSGVV 464

Query: 510 -HAYPPAIGSEFSVISFRDLTTGYQSDTIDNVPNLPVDASSQMITATLRPSNGKESTSGE 568
             A+P        V    D +      ++ +   L V           + SNG       
Sbjct: 465 NSAFPAD--ESLKVTDCGDFSYTDLDGSVSDHQGLYV-----------KLSNG------- 504

Query: 569 QVRFTIRGSGTEPK---LKVYIEAKSTDEKRAQHLARE 603
             RF +R SGT      +++YIE    D+ + Q  A E
Sbjct: 505 -ARFVLRLSGTGSSGATIRLYIEKYCDDKSQYQKTAEE 541

>KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 35.4 bits (80), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 128/583 (21%), Positives = 220/583 (37%), Gaps = 88/583 (15%)

Query: 55  GTAGLRSRMEAGFSRMN-TLTVLQASQGLASYIKSQFPEN---LSVIVGHDHRYHSNEFA 110
           GT+GLR +        N T   +QA       I    PE     +++VG D RY+++   
Sbjct: 19  GTSGLRKKTVIFKDEPNYTENFIQA-------IMESIPEGSDGATLVVGGDGRYYNDVIL 71

Query: 111 RVTVTAFLQLGFKVYYLNLSSKDSTETFVHTPMVPFTINQLN--ASAGIMITASHN---P 165
                     G K   +  +        + TP     I   +   + GI++TASHN   P
Sbjct: 72  EKIAKIGAANGVKKLVVGQNG------LLSTPAASHIIRSYHEKVTGGIILTASHNPGGP 125

Query: 166 KMDNGYKVYYSNGC--------QIIPPHDRLISETIDQNLVPWNKAWDCDEVIKTAIESG 217
           K D G K   +NG         +I     +L S  I ++L       D  ++ +      
Sbjct: 126 KNDMGIKYNLANGGPAPESVTDKIWENSKKLTSYKIIKDL----PTLDTSKIGENQKYGP 181

Query: 218 FLFDVKE--KVTSKYIKTVSD-ELVR--VPMLDCDKPW-FVYTPMHGVGFEIFEQIALLA 271
            L DV +  K   +++K + D EL++  +      K W  ++  ++G+     + I +  
Sbjct: 182 ILIDVIDVTKAYVEFLKEIFDFELIKKFIHTQRKTKNWKLLFDGLNGITGPYGKAIFVDE 241

Query: 272 LGLKEGKHYVCVPEQRCPDPAFPTVSFPNPEEKGALDLSIALAEEQDIRLVIANDPDADR 331
             L E +    V +   P P F  +  P+P    A  L +   +++ I    A+D D DR
Sbjct: 242 FELPENE----VLQNYHPQPDFGGLH-PDPNLTYARSL-VDRVDKEKIEFGAASDGDGDR 295

Query: 332 FSVAVKNGDRWSQLTGNEIGFLFAYYQWQDYQKLGESFKKQHPLAMINSTVSSQMIKSLA 391
            ++    G  +    G+ +  +  Y     Y      F KQ    +  S  +S  I  +A
Sbjct: 296 -NMIYGYGPAFVS-PGDSVAIIAEYASEIPY------FAKQGIYGLARSFPTSAAIDRVA 347

Query: 392 EAEKFHYEDTLTGFKWLGNRAFELETQGYYVPFAYEEAIGYMFPEVEHDKDGISAAVVFL 451
           +A      +  TG+K+     F        +    EE+ G     V  +KDG+ A V +L
Sbjct: 348 KAHGLECYEVPTGWKF-----FCALFDAKKLSICGEESFGTGSNHV-REKDGLWAIVAWL 401

Query: 452 QMYCEWLSK--DRMTPLQVLDEGFG-KYG--VFKEYNGYYIVPRLSLTKEVFDYIREDYT 506
            +   +     +R   ++ + + F  KYG   F  Y+  ++    +   +V D + E  +
Sbjct: 402 NVLAIFNKHHPEREASIKTIQDDFWLKYGRTFFTRYDYEHVTSEDA--NKVVDLLTEFTS 459

Query: 507 PSGHAYPPAIGSEFSVISFRDLTTGYQSDTIDNVPNLPVDASSQMITATLRPSNGKESTS 566
            S     P  G E              S T+ +  N     S   +  ++    G     
Sbjct: 460 NSKTKNAPFPGDE--------------SLTVTDCGNF----SYTDLDGSVSSKQGLSVKL 501

Query: 567 GEQVRFTIRGSGTEPK---LKVYIEAKSTDEKRAQHLARETWQ 606
            +  RF +R SGT      +++Y+E  S D+      A E  Q
Sbjct: 502 SDGSRFVLRLSGTGSSGATIRLYVEKYSGDKSTYGQTAEEYLQ 544

>Skud_13.263 Chr13 complement(451194..452903) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 35.0 bits (79), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 129/577 (22%), Positives = 221/577 (38%), Gaps = 82/577 (14%)

Query: 55  GTAGLRSRMEAGFSRMNTLTVLQASQGLASYIKSQFPEN---LSVIVGHDHRYHSNEFAR 111
           GT+GLR + +    + N       ++     I    PE     +++VG D RY+++    
Sbjct: 19  GTSGLRKKTKVFKDQPNY------TENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILN 72

Query: 112 VTVTAFLQLGFKVYYLNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHN---PKMD 168
                    G K   +      ST    H         +   + GI++TASHN   P+ D
Sbjct: 73  KIAAIGSANGIKKLVIGQYGLLSTPAASHI----MRTYEEECTGGIILTASHNPGGPEND 128

Query: 169 NGYKVYYSNGCQIIPPHDRLISET--IDQNLVPWNKAWDCDEV-IKTAIESG----FLFD 221
            G K   SNG    P  + + +    I + L  +    D  E+ +KT  ++      L D
Sbjct: 129 MGIKYNLSNGG---PAPESVTNAIWDISKKLTNYKIVKDFPELDLKTIGKNKKYGPLLID 185

Query: 222 VKE--KVTSKYIKTVSDELVRVPMLD---CDKPW-FVYTPMHGVGFEIFEQIALLALGLK 275
           V +  K    ++K + D  +    +D     K W  ++  M+GV     + I +   GL 
Sbjct: 186 VIDITKAYVDFLKKIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVDEFGLP 245

Query: 276 EGKHYVCVPEQRCPDPAFPTVSFPNPEEKGALDLSIALAEEQDIRLVIANDPDADRFSVA 335
             +    V +   P P F  +  P+P    A  L +   + + I    A+D D DR ++ 
Sbjct: 246 AEE----VLQNWHPSPDFGGMH-PDPNLTYASSL-VKRVDREKIEFGAASDGDGDR-NMI 298

Query: 336 VKNGDRWSQLTGNEIGFLFAYYQWQDYQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEK 395
              G  +    G+ +  +  Y     Y      F KQ    +  S  +S  I  +A+A  
Sbjct: 299 YGYGPSFVS-PGDSVAIIAEYAAEIPY------FAKQGIYGLARSFPTSAAIDRVAKAHG 351

Query: 396 FHYEDTLTGFKWLGNRAFELETQGYYVPFAYEEAIGYMFPEVEHDKDGISAAVVFLQ--- 452
            +  +  TG+K+     F        +    EE+ G     V  +KDG+ A + +L    
Sbjct: 352 LNCYEVPTGWKF-----FCALFDAKKLSICGEESFGTGSNHV-REKDGVWAVMAWLNILA 405

Query: 453 MYCEWLSKDRMTPLQVLDEGFGKYGVFKEYNGYYIVPRLSLTK--EVFDYIREDYTPSGH 510
           +Y +   ++  +   + +E + KYG  + +   Y   ++   K  ++ D +R   T SG 
Sbjct: 406 IYNKHHPENEASIKTIQNEFWAKYG--RTFFTRYDFEKVESEKANKIVDQLRAYVTKSG- 462

Query: 511 AYPPAIGSEFSVISFRDLTTGYQSDTIDNVPNLPVDAS-SQMITATLRPSNGKESTSGEQ 569
                I S F       +T        D      +D S S      ++ SNG        
Sbjct: 463 ----VINSAFPADESLKVTDCGDFSYTD------LDGSVSDHQGLYVKLSNG-------- 504

Query: 570 VRFTIRGSGTEPK---LKVYIEAKSTDEKRAQHLARE 603
            RF +R SGT      +++Y+E    D+ + Q  A E
Sbjct: 505 ARFVLRLSGTGSSGATIRLYVEKYCDDKSQYQKTAEE 541

>ABL029W Chr2 (343850..345556) [1707 bp, 568 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL127W (PGM1) and
           YMR105C (PGM2)
          Length = 568

 Score = 35.0 bits (79), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 96/449 (21%), Positives = 180/449 (40%), Gaps = 64/449 (14%)

Query: 55  GTAGLRSRMEAGFSRMNTLTVLQASQGLASYIKSQFPE---NLSVIVGHDHRYHSNEFAR 111
           GT+GLR + +  F +    T     +     I    PE   N  +++G D RY+++   +
Sbjct: 19  GTSGLRKKTKV-FEQTEHYT-----ENFIQAIMESIPEGSENAVLVIGGDGRYYNDAVMQ 72

Query: 112 VTVTAFLQLGFKVYYLNLSSKDSTETFVHTPMVPFTINQLN--ASAGIMITASHNPKM-D 168
                    G +   +  +        + TP     I   +   + GI++TASHNP   D
Sbjct: 73  KIAEVGSANGVRKLIIGQNG------LLSTPAASHIIRTYHDKVTGGIILTASHNPGGPD 126

Query: 169 NGYKVYY--SNGCQIIPPHDRLISETID--QNLVPWN-----KAWDCDEVIKTAIESGFL 219
           N + + Y  +NG    P  +++ +   +  +NL  +         D  ++ +       L
Sbjct: 127 NDFGIKYNLANGA---PAPEKVTNSMFERSRNLTHYKITRGMPKLDLGKIGENQQYGNLL 183

Query: 220 FDVKEKVTSKYIKTVSDELVRVPMLD-----CDKPW---FVYTPMHGVGFEIFEQIALLA 271
            DV +  T  Y++ +  E+   P++        K +    ++  ++G+     + I +  
Sbjct: 184 VDVIDP-TEAYVRLMK-EIFDFPLIKKFLEHAQKEYGLKVLFDALNGITGPYGKAIFVDE 241

Query: 272 LGLKEGKHYVCVPEQRCPDPAFPTVSFPNPEEKGALDLSIALAEEQDIRLVIANDPDADR 331
           LGL E      VP+     P F  +  P+P    A  L ++  + ++I    A+D D DR
Sbjct: 242 LGLSEDSLQNFVPK-----PDFGGLH-PDPNLTYAHTL-VSRVDRENIAFGAASDGDGDR 294

Query: 332 FSVAVKNGDRWSQLTGNEIGFLFAYYQWQDYQKLGESFKKQHPLAMINSTVSSQMIKSLA 391
            ++    G  +    G+ +  +  Y     Y      F K     +  S  +S  I  +A
Sbjct: 295 -NMIYGAGPAFVS-PGDSVAIIAEYASEIPY------FIKNGIHGLARSFPTSGAIDLVA 346

Query: 392 EAEKFHYEDTLTGFKWLGNRAFELETQGYYVPFAYEEAIGYMFPEVEHDKDGISAAVVFL 451
           + +     +  TG+K+  N  F+ +     +    EE+ G     V  +KDG+ A V +L
Sbjct: 347 KEKNLDCYEVPTGWKFFCN-LFDSKK----LSICGEESFGTGSDHV-REKDGLWAIVAWL 400

Query: 452 QMYCEWLSK--DRMTPLQVLDEGF-GKYG 477
            +   +  +  DR   ++ + E F  KYG
Sbjct: 401 NVLAIYHRRHPDREPSIKTIQEEFWAKYG 429

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score = 35.0 bits (79), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 26/56 (46%), Gaps = 4/56 (7%)

Query: 153 ASAGIMITASHNPKMDNGYKVYYSNGC----QIIPPHDRLISETIDQNLVPWNKAW 204
           A  G+M+TASHNP  DNG KV    G     Q  P   RL +   +     W + W
Sbjct: 56  AQVGVMVTASHNPPEDNGVKVVDPEGGMLPEQWEPLATRLANLAANGTFDQWWEYW 111

>TDEL0E00210 Chr5 (28244..29956) [1713 bp, 570 aa] {ON} Anc_2.445
           YKL127W
          Length = 570

 Score = 34.7 bits (78), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 54/130 (41%), Gaps = 12/130 (9%)

Query: 55  GTAGLRSRMEAGFSRMNTLTVLQASQGLASYIKSQFPE---NLSVIVGHDHRYHSNEFAR 111
           GT+GLR +       MN +     ++     I    PE   +  ++VG D RY++++  +
Sbjct: 17  GTSGLRKKTAV---FMNNV---HYTENFIQSILDAIPESSKDAILVVGGDGRYYNDKILQ 70

Query: 112 VTVTAFLQLGFKVYYLNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHN---PKMD 168
           +        G +   +      ST    H        +    + GI++TASHN   P+ D
Sbjct: 71  IIAAISAANGVRKLVIGQHGLLSTPAASHIIRSYQDKDGKKVTGGIILTASHNPGGPEND 130

Query: 169 NGYKVYYSNG 178
            G K   SNG
Sbjct: 131 IGIKYNLSNG 140

>ZYRO0G02508g Chr7 (192411..194120) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 569

 Score = 34.7 bits (78), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 56/131 (42%), Gaps = 17/131 (12%)

Query: 55  GTAGLRSRMEAGFSRMN-TLTVLQASQGLASYIKSQFPENLS---VIVGHDHRYHSNEFA 110
           GT+GLR R +      N T   +QA       I    PE +    ++VG D RY+++   
Sbjct: 19  GTSGLRKRTKVFAEEPNYTENFIQA-------ILEAIPEGVKDSVLLVGGDGRYYNDVVL 71

Query: 111 RVTVTAFLQLGFKVYYLNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKMDN- 169
           +         G K   +  +   ST    H   V  + ++   + GI++TASHNP   N 
Sbjct: 72  QKIAAIGAANGVKRLVVGQNGILSTPAASH---VIRSYSKAKVTGGIILTASHNPGGPNN 128

Query: 170 --GYKVYYSNG 178
             G K   +NG
Sbjct: 129 DFGIKYNLANG 139

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score = 34.3 bits (77), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 15/18 (83%)

Query: 156 GIMITASHNPKMDNGYKV 173
           G+MITASHNP  DNG K+
Sbjct: 59  GVMITASHNPPQDNGVKI 76

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score = 34.3 bits (77), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 14/18 (77%), Positives = 15/18 (83%)

Query: 156 GIMITASHNPKMDNGYKV 173
           G+MITASHNP  DNG KV
Sbjct: 55  GVMITASHNPPEDNGVKV 72

>Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON}
           (136243..137955) [1713 nt, 571 aa]
          Length = 570

 Score = 34.3 bits (77), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 56/133 (42%), Gaps = 21/133 (15%)

Query: 55  GTAGLRSRMEAGFSRMNTLTVLQASQGLASYIKSQFP---ENLSVIVGHDHRYHSNEFAR 111
           GT+GLR + +   S  N       ++     I +  P   +N +++VG D R++++    
Sbjct: 19  GTSGLRKKTKIFMSEKN------YTENFIQSILNSIPNGVKNSTIVVGGDGRFYNDIILD 72

Query: 112 VTVTAFLQLGFKVYYLNLSSKDSTETFVHTPMVPFTINQLNAS---AGIMITASHN---P 165
             +      G +   +  +        + TP   + I     S    GI++TASHN   P
Sbjct: 73  KIMQISAANGVRKLVIGQNG------ILSTPAASYIIRNYKESCNGGGIILTASHNPGGP 126

Query: 166 KMDNGYKVYYSNG 178
           + D G K   SNG
Sbjct: 127 ENDIGIKYNLSNG 139

>Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 34.3 bits (77), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 126/578 (21%), Positives = 216/578 (37%), Gaps = 84/578 (14%)

Query: 55  GTAGLRSRMEAGFSRMNTLTVLQASQGLASYIKSQFPEN---LSVIVGHDHRYHSNEFAR 111
           GT+GLR + +    + N       ++     I    PE     +++VG D RY+++    
Sbjct: 19  GTSGLRKKTKVFKDQPNY------TENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 112 VTVTAFLQLGFKVYYLNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHN---PKMD 168
                    G K   +      ST    H         +   + GI++TASHN   P+ D
Sbjct: 73  KIAAIGAANGVKKLVIGQHGLLSTPAASHI----MRTYEEKCTGGIILTASHNPGGPEND 128

Query: 169 NGYKVYYSNGCQIIPPHDRLISETIDQNLVPWNKAWDCDEVIKTAIESG-----FLFDVK 223
            G K   SNG         +I + I + L  +    D  E+    I         L D+ 
Sbjct: 129 MGIKYNLSNGGPAPESVTNVIWD-ISKKLTSYKIIKDFPELDLATIGKNKKYGPLLVDII 187

Query: 224 EKVTSKYI---KTVSDELVRVPMLD---CDKPW-FVYTPMHGVGFEIFEQIALLALGLKE 276
           + +T  Y+   K + D  +    +D     K W  ++  M+GV     + I +   GL  
Sbjct: 188 D-ITKDYVDFLKEIFDFKLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVDEFGLPA 246

Query: 277 GKHYVCVPEQRCPDPAFPTVSFPNPEEKGALDLSIALAEEQDIRLVIANDPDADRFSVAV 336
            +    V +   P P F  +  P+P    A  L +   + + I    A+D D DR ++  
Sbjct: 247 DE----VLQNWHPSPDFGGMH-PDPNLTYASTL-VKRVDREKIEFGAASDGDGDR-NMIY 299

Query: 337 KNGDRWSQLTGNEIGFLFAYYQWQDYQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKF 396
             G  +    G+ +  +  Y     Y      F KQ    +  S  +S  I  +A+A   
Sbjct: 300 GYGPSFVS-PGDSVAIIAEYAAEIPY------FAKQGIYGLARSFPTSAAIDRVAKAHGL 352

Query: 397 HYEDTLTGFKWLGNRAFELETQGYYVPFAYEEAIGYMFPEVEHDKDGISAAVVFLQ---M 453
           +  +  TG+K+     F        +    EE+ G     V  +KDG+ A + +L    +
Sbjct: 353 NCYEVPTGWKF-----FCALFDAKKLSICGEESFGTGSNHV-REKDGVWAIMAWLNILAI 406

Query: 454 YCEWLSKDRMTPLQVLDEGFGKYG--VFKEYNGYYIVPRLSLTKEVFDYIREDYTPSG-- 509
           Y +   ++  +   + +E + KYG   F  Y+   +  + +   ++ D ++   T SG  
Sbjct: 407 YNKHHPENEASIKTIQNEFWAKYGRTFFTRYDFEKVESQKA--NKIVDQLKAYVTKSGVV 464

Query: 510 -HAYPPAIGSEFSVISFRDLTTGYQSDTIDNVPNLPVDASSQMITATLRPSNGKESTSGE 568
             A+P        V    D +      ++ +   L V           + SNG       
Sbjct: 465 SSAFPA--DESLKVTDCGDFSYTDLDGSVSDHQGLYV-----------KLSNG------- 504

Query: 569 QVRFTIRGSGTEPK---LKVYIEAKSTDEKRAQHLARE 603
             RF +R SGT      +++YIE    DE +    A E
Sbjct: 505 -ARFVLRLSGTGSSGATIRLYIEKYCDDESQYHKTAEE 541

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score = 34.3 bits (77), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%)

Query: 154 SAGIMITASHNPKMDNGYKVYYSNG 178
           + G+MITASHNP  DNG K+    G
Sbjct: 57  TVGVMITASHNPPEDNGVKIVDPKG 81

>SAKL0E03630g Chr5 complement(294321..296036) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105C PGM2 Phosphoglucomutase catalyzes the
           conversion from glucose-1-phosphate to
           glucose-6-phosphate which is a key step in hexose
           metabolism functions as the acceptor for a
           Glc-phosphotransferase and to YKL127W uniprot|P33401
           Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 571

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 103/456 (22%), Positives = 172/456 (37%), Gaps = 76/456 (16%)

Query: 55  GTAGLRSRMEAGFSRMN-TLTVLQASQGLASYIKSQFPE---NLSVIVGHDHRYHSNEFA 110
           GT+GLR + +      N T   +QA       +    PE   + +++VG D R++++   
Sbjct: 19  GTSGLRKKTKVFMEEPNYTENFIQA-------VMDAIPEGSQDATLVVGGDGRFYNDVVV 71

Query: 111 RVTVTAFLQLGFKVYYLNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNP---KM 167
           +         G     +  +   ST    H   +  T      + GI++TASHNP   K 
Sbjct: 72  QKIAAIGAANGVHKLVIGQNGILSTPAASH---IIRTYPHAKITGGIILTASHNPGGAKN 128

Query: 168 DNGYKVYYSNGC--------------------QIIP--PHDRLISETIDQNLVP-WNKAW 204
           D G K   SNG                     +I+   P   L  +  DQ   P      
Sbjct: 129 DFGIKYNLSNGGPAPESVTNKIFEKSKQLTSYKIVANFPQLDLSKKGTDQRYGPLLVDII 188

Query: 205 DCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVRVPMLDCDKPWFVYTPMHGVGFEIF 264
           D  E     ++S F FD    +  K+IKT   E V   +L        +  ++GV     
Sbjct: 189 DSTEAYVKLMKSIFDFD----LIKKFIKT-QKETVGFKLL--------FDSLNGVTGPYG 235

Query: 265 EQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPNPEEKGALDLSIALAEEQDIRLVIA 324
           + + +  LGL   +      +   P P F  +  P+P    A  L +   ++  I    A
Sbjct: 236 KALFVDELGLSAEESL----QNYVPKPDFGGLH-PDPNLTYAHTL-VERVDKDKIAFGAA 289

Query: 325 NDPDADRFSVAVKNGDRWSQLTGNEIGFLFAYYQWQDYQKLGESFKKQHPLAMINSTVSS 384
           +D D DR ++    G  +    G+ +  +  Y     Y      F KQ    +  S  +S
Sbjct: 290 SDGDGDR-NMIYGYGPAFVS-PGDSVAIIAEYASEIPY------FAKQGIYGLARSFPTS 341

Query: 385 QMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQGYYVPFAYEEAIGYMFPEVEHDKDGI 444
             I  +A+A   +  +  TG+K+     F        +    EE+ G     V  +KDG+
Sbjct: 342 AAIDRVAKAHGLNCYEVPTGWKF-----FCALFDAKKLSICGEESFGTGSNHV-REKDGV 395

Query: 445 SAAVVFLQMYCEWLSKD--RMTPLQVLDEGF-GKYG 477
            A + +L +   +  K+  +   ++ + E F  KYG
Sbjct: 396 WAIMAWLNILAIYNRKNPTKEASIKTIQEEFWNKYG 431

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 16/20 (80%)

Query: 154 SAGIMITASHNPKMDNGYKV 173
           + G+MITASHNP  DNG K+
Sbjct: 57  TVGVMITASHNPPEDNGVKI 76

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 8/38 (21%)

Query: 153 ASAGIMITASHNPKMDNGYKVYYSNGCQIIPPHDRLIS 190
           A  G+M+TASHNP  DNG K        ++ PH  +++
Sbjct: 56  AYVGVMLTASHNPPEDNGVK--------LVDPHGEMLA 85

>Suva_13.282 Chr13 complement(457565..459274) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 124/542 (22%), Positives = 200/542 (36%), Gaps = 86/542 (15%)

Query: 95  SVIVGHDHRYHSNEFARVTVTAFLQLGFKVYYLNLSSKDSTETFVHTPMVPFTINQLNAS 154
           +++VG D RY+++             G K   +      ST    H         +   +
Sbjct: 56  TLVVGGDGRYYNDVILHKIAAISAANGVKKLVIGQHGLLSTPAASHI----MRTYEDKCT 111

Query: 155 AGIMITASHN---PKMDNGYKVYYSNGCQIIPPHDRLISETIDQNLVPWNKAWDCDEVIK 211
            GI++TASHN   P+ D G K   SNG          I E I + L  +    D  E+  
Sbjct: 112 GGIILTASHNPGGPENDMGIKYNLSNGGPAPESVTNAIWE-ISKKLTSYKIVKDFPELDL 170

Query: 212 TAIESG-----FLFDVKEKVTSKYIKTVSD----ELVR--VPMLDCDKPW-FVYTPMHGV 259
             I         L D+ + VT  Y++ + +     L++  +      K W  ++  M+GV
Sbjct: 171 QTIGKDRKYGPLLIDIID-VTKAYVELMEEIFDFNLIKKFIDNQRSTKNWKLLFDSMNGV 229

Query: 260 GFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPNPEEKGALDLSIALAEEQDI 319
                + I +   GL   +    V +   P P F  +  P+P    A  L   +  EQ I
Sbjct: 230 TGPYGKAIFVDKFGLPAEE----VLQNWHPSPDFGGMH-PDPNLTYASSLVKRVDREQ-I 283

Query: 320 RLVIANDPDADRFSVAVKNGDRWSQLTGNEIGFLFAYYQWQDYQKLGESFKKQHPLAMIN 379
               A+D D DR ++    G  +    G+ +  +  Y     Y      F KQ    +  
Sbjct: 284 EFGAASDGDGDR-NMIYGYGPSFVS-PGDSVAIIAEYAAEIPY------FAKQGIYGLAR 335

Query: 380 STVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQGYYVPFAYEEAIGYMFPEVEH 439
           S  +S  I  +A+A   +  +  TG+K+     F        +    EE+ G     V  
Sbjct: 336 SFPTSAAIDRVAKAHGLNCYEVPTGWKF-----FCALFDAKKLSICGEESFGTGSNHV-R 389

Query: 440 DKDGISAAVVFLQ---MYCEWLSKDRMTPLQVLDEGFGKYGVFKEYNGYYIVPRLSLTKE 496
           +KDG+ A + +L    +Y +   +   +   + DE + KYG            R   T+ 
Sbjct: 390 EKDGVWAIMAWLNILAIYNKHHPEKEASIKTIQDEFWAKYG------------RTFFTRY 437

Query: 497 VFDYIRE-------DYTPSGHAYPPAIGSEFSV---ISFRDLTTGYQSDTIDNVPNLPVD 546
            F+ +         D   +  + P  IGS F     +   D      +D   +V N    
Sbjct: 438 DFEKVESEKANEIVDQLGAFTSKPGVIGSPFPTDESVKITDCGDFSYTDLDGSVSN---- 493

Query: 547 ASSQMITATLRPSNGKESTSGEQVRFTIRGSGTEPK---LKVYIEAKSTDEKRAQHLARE 603
              Q +   L  SNG         RF +R SGT      +++YIE K  D+K   H   E
Sbjct: 494 --HQGLYVKL--SNG--------ARFVLRLSGTGSSGATIRLYIE-KYCDDKSQYHKTAE 540

Query: 604 TW 605
            +
Sbjct: 541 EY 542

>TPHA0G02900 Chr7 (622303..624012) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 56/131 (42%), Gaps = 18/131 (13%)

Query: 55  GTAGLRSRMEAGFSRMN-TLTVLQASQGLASYIKSQFPE---NLSVIVGHDHRYHSNEFA 110
           GT+GLR + +   +  N T   +QA       I    PE   N +++VG D R++++   
Sbjct: 19  GTSGLRKKSKVFMNEPNYTENFIQA-------ILDAIPEGSENSTLVVGGDGRFYNDVIL 71

Query: 111 RVTVTAFLQLGFKVYYLNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHN---PKM 167
           ++        G +   +  +   ST    H             + GI++TASHN   P+ 
Sbjct: 72  QLIAEIGAANGVRKLIIGQAGILSTPAASHI----IRTYHEEVTGGIILTASHNPGGPEN 127

Query: 168 DNGYKVYYSNG 178
           D G K   +NG
Sbjct: 128 DIGIKYNLANG 138

>Smik_11.112 Chr11 (189511..191223) [1713 bp, 570 aa] {ON} YKL127W
           (REAL)
          Length = 570

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 55/130 (42%), Gaps = 15/130 (11%)

Query: 55  GTAGLRSRMEAGFSRMN-TLTVLQASQGLASYIKS--QFPENLSVIVGHDHRYHSNEFAR 111
           GT+GLR +       ++ T   +QA+      I+S    P  ++++VG D R++++    
Sbjct: 19  GTSGLRKKTRVFMDELHYTENFIQAT------IESIPNGPGGVTLVVGGDGRFYNDVIMN 72

Query: 112 VTVTAFLQLGFKVYYLNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHN---PKMD 168
                    G +   +      ST    H   V  T     +  GI++TASHN   P+ D
Sbjct: 73  KIAAVGAANGVRKLVIGQGGLLSTPAASH---VIRTYEDKCSGGGIILTASHNPGGPEND 129

Query: 169 NGYKVYYSNG 178
            G K    NG
Sbjct: 130 LGIKYNLPNG 139

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%)

Query: 154 SAGIMITASHNPKMDNGYKVYYSNGCQI 181
           + G+MITASHN   DNG K+   +G  +
Sbjct: 57  AVGVMITASHNQPCDNGVKIVEPDGSML 84

>TPHA0G02470 Chr7 (507445..509154) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 32.3 bits (72), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 56/132 (42%), Gaps = 18/132 (13%)

Query: 55  GTAGLRSRMEAGFSRMN-TLTVLQASQGLASYIKSQFPE---NLSVIVGHDHRYHSNEFA 110
           GT+GLR + +   +  N T   +QA       I    PE   + +++VG D R++++   
Sbjct: 19  GTSGLRKKTKIFMNEPNYTENFIQA-------ILDAIPEGSEDSTLVVGGDGRFYNDVIL 71

Query: 111 RVTVTAFLQLGFKVYYLNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHN---PKM 167
           ++        G +   +  +   ST    H             + GI++TASHN   P+ 
Sbjct: 72  QLIAEIGAANGVRKLIIGQAGILSTPATSHV----IRTYHEEVTGGIILTASHNPGGPEN 127

Query: 168 DNGYKVYYSNGC 179
           D G K   +NG 
Sbjct: 128 DIGIKYNLANGA 139

>KLLA0B05863g Chr2 complement(529188..530222) [1035 bp, 344 aa] {ON}
           similar to uniprot|P53219 Saccharomyces cerevisiae
           YGR031W
          Length = 344

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 35/88 (39%), Gaps = 9/88 (10%)

Query: 352 FLFAYYQWQDYQKLGE-SFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGN 410
           FL    Q    +K GE  FK + PL ++N  +    I +       H        +W G 
Sbjct: 233 FLMTVLQKVKDEKTGEYRFKSRIPLGILNDAIVKGNIANWEFNPWVH--------RWTGP 284

Query: 411 RAFELETQGYYVPFAYEEAIGYMFPEVE 438
             F   TQ +++   Y + IG  FP  E
Sbjct: 285 SLFIRGTQSHFIADEYIQDIGRFFPNFE 312

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 14/18 (77%)

Query: 156 GIMITASHNPKMDNGYKV 173
           G MITASHNP  DNG K+
Sbjct: 59  GAMITASHNPPQDNGVKL 76

>CAGL0L02849g Chr12 (334192..337593) [3402 bp, 1133 aa] {ON} highly
           similar to uniprot|P22276 Saccharomyces cerevisiae
           YOR207c RPC128 DNA-directed RNA polymerase III
          Length = 1133

 Score = 31.6 bits (70), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 29/66 (43%), Gaps = 11/66 (16%)

Query: 117 FLQLGFKVY---------YLNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKM 167
           FL+LG   Y         Y+ L  KD T    H  + PFT+  L A AG++    HN   
Sbjct: 628 FLKLGLVEYLDVNEENDSYIALYEKDITHDITHLEIEPFTV--LGAVAGLIPYPHHNQSP 685

Query: 168 DNGYKV 173
            N Y+ 
Sbjct: 686 RNTYQC 691

>SAKL0F13442g Chr6 (1065165..1068626) [3462 bp, 1153 aa] {ON}
           similar to uniprot|P48016 Saccharomyces cerevisiae
           YPR026W ATH1 Vacuolar acid trehalase required for
           trehalose utilization
          Length = 1153

 Score = 31.2 bits (69), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 52/114 (45%), Gaps = 15/114 (13%)

Query: 295 TVSFPNPEEKGALDLSIALAEEQDIRLVIANDPDADRFS---VAVKNGDRWSQLTGNEIG 351
           + +FP  ++KG   +  ++ +  D+R  I N  D+ RF+   V  K+   ++Q      G
Sbjct: 165 STNFPELDDKGYTSVIASIPQWTDLRFSIKN--DSSRFNANDVLSKDITNYNQNLSMADG 222

Query: 352 FLFAYYQWQDYQKLGESF---KKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTL 402
            +     W DY  +  S    K+ +PL +++  +S  +       ++ H ED L
Sbjct: 223 IVTTELDWLDYIHVKSSVFTHKRIYPLGVVSLEISLNI-------DRMHEEDFL 269

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 67,895,374
Number of extensions: 2961668
Number of successful extensions: 7791
Number of sequences better than 10.0: 76
Number of HSP's gapped: 7905
Number of HSP's successfully gapped: 76
Length of query: 624
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 508
Effective length of database: 40,180,143
Effective search space: 20411512644
Effective search space used: 20411512644
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)